(data stored in SCRATCH3701 zone)

EMBL: CP001677

ID   CP001677; SV 5; circular; genomic DNA; STD; PRO; 1227328 BP.
XX
AC   CP001677; ABQW01000000-ABQW01000034;
XX
PR   Project:PRJNA29835;
XX
DT   19-JUL-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Candidatus Liberibacter asiaticus str. psy62, complete genome.
XX
KW   .
XX
OS   Candidatus Liberibacter asiaticus str. psy62
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Liberibacter.
XX
RN   [1]
RP   1-1227328
RX   DOI; 10.1094/MPMI-22-8-1011.
RX   PUBMED; 19589076.
RA   Duan Y., Zhou L., Hall D.G., Li W., Doddapaneni H., Lin H., Liu L.,
RA   Vahling C.M., Gabriel D.W., Williams K.P., Dickerman A., Sun Y.,
RA   Gottwald T.;
RT   "Complete genome sequence of citrus huanglongbing bacterium, 'Candidatus
RT   Liberibacter asiaticus' obtained through metagenomics";
RL   Mol. Plant Microbe Interact. 22(8):1011-1020(2009).
XX
RN   [2]
RC   Publication Status: Available-Online prior to print
RP   1-1227328
RX   DOI; 10.1128/AEM.05111-11.
RX   PUBMED; 21784907.
RA   Zhou L., Powell C.A., Hoffman M.T., Li W., Fan G., Liu B., Lin H., Duan Y.;
RT   "Diversity and plasticity of the intracellular plant pathogen and insect
RT   symbiont "Candidatus Liberibacter asiaticus" as revealed by hypervariable
RT   prophage genes with intragenic tandem repeats";
RL   Appl. Environ. Microbiol. 77(18):6663-6673(2011).
XX
RN   [3]
RP   1-1227328
RA   Duan Y.P., Zhou L.J., Hall D., Li W.B., Liu L., Gottwald T.R.;
RT   ;
RL   Submitted (13-JUL-2009) to the INSDC.
RL   U.S. Horticultural Research Laboratory, U.S. Dept. of Agriculture,
RL   Agricultural Research Service, 2001 South Rock Road, Fort Pierce, FL 34945,
RL   USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-1227328
RA   Duan Y.P., Zhou L.J., Hall D., Li W.B., Liu L., Gottwald T.R.;
RT   ;
RL   Submitted (21-JUL-2009) to the INSDC.
RL   U.S. Horticultural Research Laboratory, U.S. Dept. of Agriculture,
RL   Agricultural Research Service, 2001 South Rock Road, Fort Pierce, FL 34945,
RL   USA
XX
RN   [5]
RC   Sequence update by submitter
RP   1-1227328
RA   Duan Y.P., Zhou L.J., Hall D., Li W.B., Liu L., Gottwald T.R.;
RT   ;
RL   Submitted (20-SEP-2010) to the INSDC.
RL   U.S. Horticultural Research Laboratory, U.S. Dept. of Agriculture,
RL   Agricultural Research Service, 2001 South Rock Road, Fort Pierce, FL 34945,
RL   USA
XX
DR   MD5; df0381b0106b3269987a4660544e31b9.
DR   BioSample; SAMN02603311.
DR   EnsemblGenomes-Gn; CLIBASIA_r05775.
DR   EnsemblGenomes-Gn; CLIBASIA_r05777.
DR   EnsemblGenomes-Gn; CLIBASIA_r05778.
DR   EnsemblGenomes-Gn; CLIBASIA_r05779.
DR   EnsemblGenomes-Gn; CLIBASIA_r05780.
DR   EnsemblGenomes-Gn; CLIBASIA_r05781.
DR   EnsemblGenomes-Gn; CLIBASIA_r05782.
DR   EnsemblGenomes-Gn; CLIBASIA_r05783.
DR   EnsemblGenomes-Gn; CLIBASIA_r05785.
DR   EnsemblGenomes-Gn; CLIBASIA_t05687.
DR   EnsemblGenomes-Gn; CLIBASIA_t05689.
DR   EnsemblGenomes-Gn; CLIBASIA_t05691.
DR   EnsemblGenomes-Gn; CLIBASIA_t05693.
DR   EnsemblGenomes-Gn; CLIBASIA_t05695.
DR   EnsemblGenomes-Gn; CLIBASIA_t05697.
DR   EnsemblGenomes-Gn; CLIBASIA_t05699.
DR   EnsemblGenomes-Gn; CLIBASIA_t05701.
DR   EnsemblGenomes-Gn; CLIBASIA_t05703.
DR   EnsemblGenomes-Gn; CLIBASIA_t05705.
DR   EnsemblGenomes-Gn; CLIBASIA_t05707.
DR   EnsemblGenomes-Gn; CLIBASIA_t05709.
DR   EnsemblGenomes-Gn; CLIBASIA_t05711.
DR   EnsemblGenomes-Gn; CLIBASIA_t05713.
DR   EnsemblGenomes-Gn; CLIBASIA_t05715.
DR   EnsemblGenomes-Gn; CLIBASIA_t05717.
DR   EnsemblGenomes-Gn; CLIBASIA_t05719.
DR   EnsemblGenomes-Gn; CLIBASIA_t05721.
DR   EnsemblGenomes-Gn; CLIBASIA_t05723.
DR   EnsemblGenomes-Gn; CLIBASIA_t05725.
DR   EnsemblGenomes-Gn; CLIBASIA_t05727.
DR   EnsemblGenomes-Gn; CLIBASIA_t05729.
DR   EnsemblGenomes-Gn; CLIBASIA_t05731.
DR   EnsemblGenomes-Gn; CLIBASIA_t05733.
DR   EnsemblGenomes-Gn; CLIBASIA_t05735.
DR   EnsemblGenomes-Gn; CLIBASIA_t05737.
DR   EnsemblGenomes-Gn; CLIBASIA_t05739.
DR   EnsemblGenomes-Gn; CLIBASIA_t05741.
DR   EnsemblGenomes-Gn; CLIBASIA_t05743.
DR   EnsemblGenomes-Gn; CLIBASIA_t05745.
DR   EnsemblGenomes-Gn; CLIBASIA_t05747.
DR   EnsemblGenomes-Gn; CLIBASIA_t05749.
DR   EnsemblGenomes-Gn; CLIBASIA_t05751.
DR   EnsemblGenomes-Gn; CLIBASIA_t05753.
DR   EnsemblGenomes-Gn; CLIBASIA_t05755.
DR   EnsemblGenomes-Gn; CLIBASIA_t05757.
DR   EnsemblGenomes-Gn; CLIBASIA_t05759.
DR   EnsemblGenomes-Gn; CLIBASIA_t05761.
DR   EnsemblGenomes-Gn; CLIBASIA_t05763.
DR   EnsemblGenomes-Gn; CLIBASIA_t05765.
DR   EnsemblGenomes-Gn; CLIBASIA_t05767.
DR   EnsemblGenomes-Gn; CLIBASIA_t05769.
DR   EnsemblGenomes-Gn; CLIBASIA_t05771.
DR   EnsemblGenomes-Gn; CLIBASIA_t05773.
DR   EnsemblGenomes-Gn; EBG00001025760.
DR   EnsemblGenomes-Gn; EBG00001025761.
DR   EnsemblGenomes-Gn; EBG00001025762.
DR   EnsemblGenomes-Gn; EBG00001025763.
DR   EnsemblGenomes-Gn; EBG00001025764.
DR   EnsemblGenomes-Gn; EBG00001025765.
DR   EnsemblGenomes-Gn; EBG00001025766.
DR   EnsemblGenomes-Gn; EBG00001025767.
DR   EnsemblGenomes-Gn; EBG00001025768.
DR   EnsemblGenomes-Gn; EBG00001025769.
DR   EnsemblGenomes-Gn; EBG00001025770.
DR   EnsemblGenomes-Gn; EBG00001025771.
DR   EnsemblGenomes-Gn; EBG00001025772.
DR   EnsemblGenomes-Gn; EBG00001025773.
DR   EnsemblGenomes-Gn; EBG00001025774.
DR   EnsemblGenomes-Gn; EBG00001025775.
DR   EnsemblGenomes-Gn; EBG00001025776.
DR   EnsemblGenomes-Gn; EBG00001025777.
DR   EnsemblGenomes-Gn; EBG00001025778.
DR   EnsemblGenomes-Gn; EBG00001025779.
DR   EnsemblGenomes-Gn; EBG00001025780.
DR   EnsemblGenomes-Gn; EBG00001025781.
DR   EnsemblGenomes-Gn; EBG00001025782.
DR   EnsemblGenomes-Gn; EBG00001025783.
DR   EnsemblGenomes-Gn; EBG00001025784.
DR   EnsemblGenomes-Gn; EBG00001025785.
DR   EnsemblGenomes-Gn; EBG00001025786.
DR   EnsemblGenomes-Gn; EBG00001025787.
DR   EnsemblGenomes-Gn; EBG00001025788.
DR   EnsemblGenomes-Gn; EBG00001025789.
DR   EnsemblGenomes-Gn; EBG00001025790.
DR   EnsemblGenomes-Gn; EBG00001025791.
DR   EnsemblGenomes-Gn; EBG00001025792.
DR   EnsemblGenomes-Gn; EBG00001025793.
DR   EnsemblGenomes-Gn; EBG00001025794.
DR   EnsemblGenomes-Gn; EBG00001025795.
DR   EnsemblGenomes-Gn; EBG00001025796.
DR   EnsemblGenomes-Gn; EBG00001025797.
DR   EnsemblGenomes-Gn; EBG00001025798.
DR   EnsemblGenomes-Gn; EBG00001025799.
DR   EnsemblGenomes-Gn; EBG00001025800.
DR   EnsemblGenomes-Gn; EBG00001025801.
DR   EnsemblGenomes-Gn; EBG00001025802.
DR   EnsemblGenomes-Gn; EBG00001025803.
DR   EnsemblGenomes-Gn; EBG00001025804.
DR   EnsemblGenomes-Gn; EBG00001025805.
DR   EnsemblGenomes-Gn; EBG00001025806.
DR   EnsemblGenomes-Gn; EBG00001025807.
DR   EnsemblGenomes-Gn; EBG00001025808.
DR   EnsemblGenomes-Gn; EBG00001025809.
DR   EnsemblGenomes-Gn; EBG00001025810.
DR   EnsemblGenomes-Gn; EBG00001025811.
DR   EnsemblGenomes-Gn; EBG00001025812.
DR   EnsemblGenomes-Gn; EBG00001025813.
DR   EnsemblGenomes-Gn; EBG00001025814.
DR   EnsemblGenomes-Gn; EBG00001025815.
DR   EnsemblGenomes-Gn; EBG00001025816.
DR   EnsemblGenomes-Gn; EBG00001025817.
DR   EnsemblGenomes-Gn; EBG00001025818.
DR   EnsemblGenomes-Tr; CLIBASIA_r05775-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05777-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05778-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05779-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05780-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05781-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05782-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05783-1.
DR   EnsemblGenomes-Tr; CLIBASIA_r05785-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05687-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05689-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05691-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05693-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05695-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05697-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05699-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05701-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05703-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05705-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05707-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05709-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05711-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05713-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05715-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05717-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05719-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05721-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05723-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05725-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05727-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05729-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05731-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05733-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05735-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05737-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05739-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05741-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05743-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05745-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05747-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05749-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05751-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05753-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05755-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05757-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05759-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05761-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05763-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05765-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05767-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05769-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05771-1.
DR   EnsemblGenomes-Tr; CLIBASIA_t05773-1.
DR   EnsemblGenomes-Tr; EBT00001629523.
DR   EnsemblGenomes-Tr; EBT00001629524.
DR   EnsemblGenomes-Tr; EBT00001629525.
DR   EnsemblGenomes-Tr; EBT00001629526.
DR   EnsemblGenomes-Tr; EBT00001629527.
DR   EnsemblGenomes-Tr; EBT00001629528.
DR   EnsemblGenomes-Tr; EBT00001629529.
DR   EnsemblGenomes-Tr; EBT00001629530.
DR   EnsemblGenomes-Tr; EBT00001629531.
DR   EnsemblGenomes-Tr; EBT00001629532.
DR   EnsemblGenomes-Tr; EBT00001629533.
DR   EnsemblGenomes-Tr; EBT00001629534.
DR   EnsemblGenomes-Tr; EBT00001629535.
DR   EnsemblGenomes-Tr; EBT00001629536.
DR   EnsemblGenomes-Tr; EBT00001629537.
DR   EnsemblGenomes-Tr; EBT00001629538.
DR   EnsemblGenomes-Tr; EBT00001629539.
DR   EnsemblGenomes-Tr; EBT00001629540.
DR   EnsemblGenomes-Tr; EBT00001629541.
DR   EnsemblGenomes-Tr; EBT00001629542.
DR   EnsemblGenomes-Tr; EBT00001629543.
DR   EnsemblGenomes-Tr; EBT00001629544.
DR   EnsemblGenomes-Tr; EBT00001629545.
DR   EnsemblGenomes-Tr; EBT00001629546.
DR   EnsemblGenomes-Tr; EBT00001629547.
DR   EnsemblGenomes-Tr; EBT00001629548.
DR   EnsemblGenomes-Tr; EBT00001629549.
DR   EnsemblGenomes-Tr; EBT00001629550.
DR   EnsemblGenomes-Tr; EBT00001629551.
DR   EnsemblGenomes-Tr; EBT00001629552.
DR   EnsemblGenomes-Tr; EBT00001629553.
DR   EnsemblGenomes-Tr; EBT00001629554.
DR   EnsemblGenomes-Tr; EBT00001629555.
DR   EnsemblGenomes-Tr; EBT00001629556.
DR   EnsemblGenomes-Tr; EBT00001629557.
DR   EnsemblGenomes-Tr; EBT00001629558.
DR   EnsemblGenomes-Tr; EBT00001629559.
DR   EnsemblGenomes-Tr; EBT00001629560.
DR   EnsemblGenomes-Tr; EBT00001629561.
DR   EnsemblGenomes-Tr; EBT00001629562.
DR   EnsemblGenomes-Tr; EBT00001629563.
DR   EnsemblGenomes-Tr; EBT00001629564.
DR   EnsemblGenomes-Tr; EBT00001629565.
DR   EnsemblGenomes-Tr; EBT00001629566.
DR   EnsemblGenomes-Tr; EBT00001629567.
DR   EnsemblGenomes-Tr; EBT00001629568.
DR   EnsemblGenomes-Tr; EBT00001629569.
DR   EnsemblGenomes-Tr; EBT00001629570.
DR   EnsemblGenomes-Tr; EBT00001629571.
DR   EnsemblGenomes-Tr; EBT00001629572.
DR   EnsemblGenomes-Tr; EBT00001629573.
DR   EnsemblGenomes-Tr; EBT00001629574.
DR   EnsemblGenomes-Tr; EBT00001629575.
DR   EnsemblGenomes-Tr; EBT00001629576.
DR   EnsemblGenomes-Tr; EBT00001629577.
DR   EnsemblGenomes-Tr; EBT00001629578.
DR   EnsemblGenomes-Tr; EBT00001629579.
DR   EnsemblGenomes-Tr; EBT00001629580.
DR   EnsemblGenomes-Tr; EBT00001629581.
DR   EuropePMC; PMC3067300; 21239554.
DR   EuropePMC; PMC3084294; 21552483.
DR   EuropePMC; PMC3187138; 21784907.
DR   EuropePMC; PMC3296602; 22280531.
DR   EuropePMC; PMC3399792; 22815919.
DR   EuropePMC; PMC3460909; 23029520.
DR   EuropePMC; PMC3862640; 24349235.
DR   EuropePMC; PMC4152171; 25180586.
DR   EuropePMC; PMC4276833; 25540355.
DR   EuropePMC; PMC4711790; 26741827.
DR   EuropePMC; PMC5167687; 28066334.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00189; SNORD95.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001677.
DR   SILVA-SSU; CP001677.
XX
CC   On Aug 2, 2011 this sequence version replaced gi:307601367.
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1227328
FT                   /organism="Candidatus Liberibacter asiaticus str. psy62"
FT                   /strain="psy62"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:537021"
FT   gene            36..407
FT                   /locus_tag="CLIBASIA_00005"
FT   CDS_pept        36..407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56595"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH50"
FT                   /protein_id="ACT56595.1"
FT                   /translation="MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEI
FT                   SQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDE
FT                   EIYEHPDQEHREDYYANQI"
FT   gene            497..820
FT                   /locus_tag="CLIBASIA_00010"
FT   CDS_pept        497..820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56596"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH51"
FT                   /protein_id="ACT56596.1"
FT                   /translation="MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVD
FT                   PDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQ
FT                   SDA"
FT   gene            948..2114
FT                   /locus_tag="CLIBASIA_00015"
FT   CDS_pept        948..2114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56597"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH52"
FT                   /protein_id="ACT56597.1"
FT                   /translation="MAHHAFLSASSSHRWLKCPIAPTLESKIPQTTSIYASEGTFAHNL
FT                   LAHCLEQGVDAETVSHQKLTFENDTRIVDTEMASSVSMVLAYVRTFSGPFLSETEVPLE
FT                   PFTTEPGATGTADILIFNSTQWIIVDFKYGAGVPVKAENNTQLMLYACGALHQYGDIFG
FT                   RPEALTLTIIQPRVRTGSPINEWVISADDLLEKAKEFKERGTLALSLKSKRAVSLEHYG
FT                   VNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEM
FT                   FKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYK
FT                   EQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVLG"
FT   gene            2285..3073
FT                   /locus_tag="CLIBASIA_00020"
FT   CDS_pept        2285..3073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00020"
FT                   /product="prophage antirepressor"
FT                   /note="COG3617 Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56598"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH53"
FT                   /protein_id="ACT56598.1"
FT                   /translation="MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAIN
FT                   AHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKT
FT                   GSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAM
FT                   DIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEER
FT                   GGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL"
FT   gene            3091..3741
FT                   /locus_tag="CLIBASIA_00025"
FT   CDS_pept        3091..3741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00025"
FT                   /product="hypothetical protein"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56599"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022595"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH54"
FT                   /protein_id="ACT56599.1"
FT                   /translation="MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQ
FT                   INAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYT
FT                   DSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCT
FT                   LTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN"
FT   gene            3745..5772
FT                   /locus_tag="CLIBASIA_00030"
FT   CDS_pept        3745..5772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00030"
FT                   /product="putative DNA polymerase from bacteriophage
FT                   origin"
FT                   /note="COG0749 DNA polymerase I - 3'-5' exonuclease and
FT                   polymerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56600"
FT                   /db_xref="GOA:C6XH55"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH55"
FT                   /protein_id="ACT56600.1"
FT                   /translation="MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLW
FT                   DRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNG
FT                   LPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYC
FT                   KRDVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE
FT                   DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNR
FT                   LASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEIL
FT                   TQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI
FT                   KAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD
FT                   LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV
FT                   LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD
FT                   CSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE
FT                   TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK"
FT   gene            5769..6080
FT                   /locus_tag="CLIBASIA_00035"
FT   CDS_pept        5769..6080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00035"
FT                   /product="VRR-NUC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56601"
FT                   /db_xref="GOA:C6XH56"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH56"
FT                   /protein_id="ACT56601.1"
FT                   /translation="MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLI
FT                   ITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY"
FT   gene            6065..6727
FT                   /locus_tag="CLIBASIA_00040"
FT   CDS_pept        6065..6727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG0553 Superfamily II DNA/RNA helicases, SNF2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56602"
FT                   /db_xref="GOA:C6XH57"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH57"
FT                   /protein_id="ACT56602.1"
FT                   /translation="MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKI
FT                   LDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINF
FT                   ENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGT
FT                   PSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE"
FT   gene            6832..7449
FT                   /locus_tag="CLIBASIA_00045"
FT   CDS_pept        6832..7449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00045"
FT                   /product="hypothetical protein"
FT                   /note="COG0553 Superfamily II DNA/RNA helicases, SNF2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56603"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH58"
FT                   /protein_id="ACT56603.1"
FT                   /translation="MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE
FT                   KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW
FT                   NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR
FT                   AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV"
FT   gene            7442..7801
FT                   /locus_tag="CLIBASIA_00050"
FT   CDS_pept        7442..7801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00050"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56604"
FT                   /db_xref="GOA:C6XH59"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH59"
FT                   /protein_id="ACT56604.1"
FT                   /translation="MYNFDRVFRSSKFENEHNITPAQWKKLLTLEAKFLPNKRALESWL
FT                   DKAKKVTSLSKGEAMIEVEYLVKIALHHQKWYYRLDDPLFTDGLYDRVSERLDALQEQF
FT                   PELFDEDHPWNTVGY"
FT   gene            7803..8363
FT                   /gene="gmk"
FT                   /locus_tag="CLIBASIA_00055"
FT   CDS_pept        7803..8363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="CLIBASIA_00055"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COG0194 Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56605"
FT                   /db_xref="GOA:C6XH60"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH60"
FT                   /protein_id="ACT56605.1"
FT                   /translation="MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEK
FT                   QYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGL
FT                   APLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHL
FT                   PTACRQVGLIREFVKRGKKANYD"
FT   gene            8356..8547
FT                   /locus_tag="CLIBASIA_00060"
FT   CDS_pept        8356..8547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56606"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH61"
FT                   /protein_id="ACT56606.1"
FT                   /translation="MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPM
FT                   IRGDNPCLIVDNDNPLDL"
FT   gene            8544..9590
FT                   /locus_tag="CLIBASIA_00065"
FT   CDS_pept        8544..9590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00065"
FT                   /product="phage-related integrase/recombinase"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56607"
FT                   /db_xref="GOA:C6XH62"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH62"
FT                   /protein_id="ACT56607.1"
FT                   /translation="MTPSLRLPPFVTKERTRHGKIIYYFRKGHGRRIRLPYPHESTFIP
FT                   AYMSALTGSTPKREYINSPRKKPTTLKWLISEYRKSAHWGSLAVNSRISFESYFDQIIR
FT                   KSGDFDYRKITTKHIRSGVESRKHTPSSAIQFLTSMRVLFKWAVRQEYVAINPCLSVER
FT                   PKRKTEGIRPWTKEDMQQFKSFWSEGSQPRLAFEFLLYSGLRCSDSCRAGVQHLQNNIF
FT                   SIKTQKTGTIITVELPDGFMKLLAMTPIGKETFFINNDKQKMNATQFSIWFKAKATKAG
FT                   VNKSAHGVRKFSATISADAGATAHELMATYGWKTVDQAETYTKGADRIRLGIKNSRRIS
FT                   SVVDSDDP"
FT   gene            complement(9787..11013)
FT                   /locus_tag="CLIBASIA_00070"
FT   CDS_pept        complement(9787..11013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56608"
FT                   /db_xref="GOA:C6XH63"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH63"
FT                   /protein_id="ACT56608.1"
FT                   /translation="MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVT
FT                   VMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIE
FT                   SIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQ
FT                   NIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYK
FT                   NFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSN
FT                   QFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHR
FT                   TGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFS
FT                   QFTITVVDS"
FT   gene            11173..11550
FT                   /locus_tag="CLIBASIA_00075"
FT   CDS_pept        11173..11550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00075"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56609"
FT                   /db_xref="GOA:C6XGH6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C6XGH6"
FT                   /protein_id="ACT56609.1"
FT                   /translation="MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE
FT                   IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK
FT                   EKNFFETRVTEYQQGAELKWD"
FT   gene            complement(12818..15157)
FT                   /gene="maeB"
FT                   /locus_tag="CLIBASIA_00080"
FT   CDS_pept        complement(12818..15157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="CLIBASIA_00080"
FT                   /product="malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56610"
FT                   /db_xref="GOA:C6XH65"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH65"
FT                   /protein_id="ACT56610.1"
FT                   /translation="MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLN
FT                   DQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKP
FT                   VMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVER
FT                   ILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLV
FT                   TMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAG
FT                   ALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPY
FT                   IFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFD
FT                   PNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSK
FT                   RILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLN
FT                   NKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESG
FT                   YNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQ
FT                   AICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEI
FT                   FCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSS
FT                   VSVREIIDMVALVMASNNSNSSKEKM"
FT   gene            15442..16563
FT                   /locus_tag="CLIBASIA_00085"
FT   CDS_pept        15442..16563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00085"
FT                   /product="ABC transporter"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56611"
FT                   /db_xref="GOA:C6XH66"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH66"
FT                   /protein_id="ACT56611.1"
FT                   /translation="MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLS
FT                   AITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFY
FT                   NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYV
FT                   GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG
FT                   RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG
FT                   ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN
FT                   SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI"
FT   gene            16592..17365
FT                   /locus_tag="CLIBASIA_00090"
FT   CDS_pept        16592..17365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00090"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56612"
FT                   /db_xref="GOA:C6XH67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH67"
FT                   /protein_id="ACT56612.1"
FT                   /translation="MQLNNIPSQEEKILSVRNLTIELNNRIILNNINLDILRGEILGVI
FT                   GSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVLFQHGALFSS
FT                   MTVQENISMPIKEHLNLPADLIEHIVHTKIAIVGLPPETANLMPFQLSGGMIKRVSLAR
FT                   ALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHDLNNLISTCNRVA
FT                   VIQKKGIMKEGTISDIVDSNDPWIRSYFNRFTKRI"
FT   gene            17371..18729
FT                   /locus_tag="CLIBASIA_00095"
FT   CDS_pept        17371..18729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00095"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56613"
FT                   /db_xref="GOA:C6XH68"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH68"
FT                   /protein_id="ACT56613.1"
FT                   /translation="MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRI
FT                   PGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQ
FT                   GLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSR
FT                   HIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITD
FT                   LITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKI
FT                   DHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITS
FT                   NLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQN
FT                   FSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH"
FT   gene            18754..19380
FT                   /locus_tag="CLIBASIA_00100"
FT   CDS_pept        18754..19380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00100"
FT                   /product="putative ABC transporter protein"
FT                   /note="COG3218 ABC-type uncharacterized transport system,
FT                   auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56614"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH69"
FT                   /protein_id="ACT56614.1"
FT                   /translation="MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTEST
FT                   KYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIA
FT                   NFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQ
FT                   KVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN"
FT   gene            complement(19927..24123)
FT                   /gene="rpoC"
FT                   /locus_tag="CLIBASIA_00105"
FT   CDS_pept        complement(19927..24123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CLIBASIA_00105"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086 DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56615"
FT                   /db_xref="GOA:C6XH70"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH70"
FT                   /protein_id="ACT56615.1"
FT                   /translation="MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMA
FT                   HIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTE
FT                   EEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKR
FT                   LKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRL
FT                   MRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRF
FT                   RTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQA
FT                   KKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAG
FT                   YNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLST
FT                   VHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMI
FT                   IGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSS
FT                   GISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVT
FT                   EEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIE
FT                   SPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCN
FT                   TKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEK
FT                   CGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMR
FT                   TFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQY
FT                   SHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGE
FT                   STGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQ
FT                   KVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNK
FT                   SRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALA
FT                   SYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELN
FT                   RSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFK
FT                   ENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE"
FT   gene            complement(24186..28346)
FT                   /gene="rpoB"
FT                   /locus_tag="CLIBASIA_00110"
FT   CDS_pept        complement(24186..28346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CLIBASIA_00110"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56616"
FT                   /db_xref="GOA:C6XH71"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH71"
FT                   /protein_id="ACT56616.1"
FT                   /translation="MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNI
FT                   APDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKI
FT                   TLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGI
FT                   HFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALG
FT                   MDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLT
FT                   SGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSE
FT                   IRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFL
FT                   FFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDN
FT                   LGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFF
FT                   CSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSE
FT                   GHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLD
FT                   EDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGC
FT                   NMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLD
FT                   PSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNML
FT                   VAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEE
FT                   GLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLR
FT                   VPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEI
FT                   LCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSI
FT                   LEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCE
FT                   DMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDIS
FT                   PLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRM
FT                   ADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLG
FT                   GKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGT
FT                   PESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK"
FT   gene            complement(28458..28838)
FT                   /locus_tag="CLIBASIA_00115"
FT   CDS_pept        complement(28458..28838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00115"
FT                   /product="50S ribosomal protein L12P"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56617"
FT                   /db_xref="GOA:C6XH72"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH72"
FT                   /protein_id="ACT56617.1"
FT                   /translation="MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA
FT                   AEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGL
FT                   SKDEANEMKKKLEDAGATVELR"
FT   gene            complement(28887..29405)
FT                   /gene="rplJ"
FT                   /locus_tag="CLIBASIA_00120"
FT   CDS_pept        complement(28887..29405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CLIBASIA_00120"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56618"
FT                   /db_xref="GOA:C6XH73"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH73"
FT                   /protein_id="ACT56618.1"
FT                   /translation="MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMRE
FT                   AGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFR
FT                   VLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAIS
FT                   AFVDKNQQG"
FT   gene            complement(29578..30276)
FT                   /gene="rplA"
FT                   /locus_tag="CLIBASIA_00125"
FT   CDS_pept        complement(29578..30276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CLIBASIA_00125"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56619"
FT                   /db_xref="GOA:C6XH74"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH74"
FT                   /protein_id="ACT56619.1"
FT                   /translation="MVSKISKRMQQISQGIDRSALYGLSDAVVMLKERATARFDETVEI
FT                   AMNLGIDPRHANQMVRGVVTMPNGTGVNVRVAVFATSSKADEAREAGADIVGGEDLFEI
FT                   VKGGQIDFDRCIATPDMMPLVGRLGRILGPRGIMPNLRVGTVTTDVATAVRESKSGAVD
FT                   FRSEKAGIIHAGIGKVSFENKKIEENVLAFVSAVVKAKPSVAKGDYVKRVTLSSTMGCG
FT                   IKVDLSSFSV"
FT   gene            complement(30278..30706)
FT                   /gene="rplK"
FT                   /locus_tag="CLIBASIA_00130"
FT   CDS_pept        complement(30278..30706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CLIBASIA_00130"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56620"
FT                   /db_xref="GOA:C6XH75"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH75"
FT                   /protein_id="ACT56620.1"
FT                   /translation="MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAA
FT                   TEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRE
FT                   NIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD"
FT   gene            complement(30797..31330)
FT                   /gene="nusG"
FT                   /locus_tag="CLIBASIA_00135"
FT   CDS_pept        complement(30797..31330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CLIBASIA_00135"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56621"
FT                   /db_xref="GOA:C6XH76"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH76"
FT                   /protein_id="ACT56621.1"
FT                   /translation="MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERV
FT                   VSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIE
FT                   HIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRV
FT                   TPVELAYNQVEKIV"
FT   gene            complement(31352..31555)
FT                   /locus_tag="CLIBASIA_00140"
FT   CDS_pept        complement(31352..31555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00140"
FT                   /product="hypothetical protein"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56622"
FT                   /db_xref="GOA:C6XH77"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH77"
FT                   /protein_id="ACT56622.1"
FT                   /translation="MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISS
FT                   VFFLVIDQSIGWLMHFILGIGR"
FT   gene            complement(31660..31734)
FT                   /locus_tag="CLIBASIA_t05687"
FT   tRNA            complement(31660..31734)
FT                   /locus_tag="CLIBASIA_t05687"
FT                   /product="tRNA-Trp"
FT   gene            complement(31790..32968)
FT                   /locus_tag="CLIBASIA_00150"
FT   CDS_pept        complement(31790..32968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00150"
FT                   /product="translation elongation factor Tu"
FT                   /note="COG0050 GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56623"
FT                   /db_xref="GOA:C6XH78"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH78"
FT                   /protein_id="ACT56623.1"
FT                   /translation="MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD
FT                   IDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAA
FT                   EDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT
FT                   PIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRG
FT                   TVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVN
FT                   RADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRI
FT                   ILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE"
FT   gene            complement(33018..33093)
FT                   /locus_tag="CLIBASIA_t05689"
FT   tRNA            complement(33018..33093)
FT                   /locus_tag="CLIBASIA_t05689"
FT                   /product="tRNA-Met"
FT   gene            complement(33253..34479)
FT                   /gene="mnmA"
FT                   /locus_tag="CLIBASIA_00160"
FT   CDS_pept        complement(33253..34479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmA"
FT                   /locus_tag="CLIBASIA_00160"
FT                   /product="tRNA-specific 2-thiouridylase MnmA"
FT                   /EC_number="2.8.1.-"
FT                   /note="COG0482 Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56624"
FT                   /db_xref="GOA:C6XH79"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH79"
FT                   /protein_id="ACT56624.1"
FT                   /translation="MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGY
FT                   DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPF
FT                   ASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM
FT                   CRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICF
FT                   VQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVV
FT                   YLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVF
FT                   VQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSV
FT                   IGDEFPYKM"
FT   gene            complement(35674..35922)
FT                   /locus_tag="CLIBASIA_00175"
FT   CDS_pept        complement(35674..35922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00175"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56625"
FT                   /db_xref="GOA:C6XH80"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH80"
FT                   /protein_id="ACT56625.1"
FT                   /translation="MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTA
FT                   EHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG"
FT   gene            complement(36130..37305)
FT                   /locus_tag="CLIBASIA_00180"
FT   CDS_pept        complement(36130..37305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00180"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="COG1932 Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56626"
FT                   /db_xref="GOA:C6XH81"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH81"
FT                   /protein_id="ACT56626.1"
FT                   /translation="MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVL
FT                   GKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLG
FT                   WMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESRE
FT                   GLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWP
FT                   LPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAA
FT                   VLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEE
FT                   IAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS"
FT   gene            37542..37748
FT                   /locus_tag="CLIBASIA_00185"
FT   CDS_pept        37542..37748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56627"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH82"
FT                   /protein_id="ACT56627.1"
FT                   /translation="MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKY
FT                   REIVESYTPAMEGISIIDVTLVI"
FT   gene            complement(37906..38001)
FT                   /locus_tag="CLIBASIA_00190"
FT   CDS_pept        complement(37906..38001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56628"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH83"
FT                   /protein_id="ACT56628.1"
FT                   /translation="MFTILYVIYLSNSMDCILGYMNKEEEKLILD"
FT   gene            complement(38210..38980)
FT                   /locus_tag="CLIBASIA_00195"
FT   CDS_pept        complement(38210..38980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00195"
FT                   /product="putative inositol-1-monophosphatase"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56629"
FT                   /db_xref="GOA:C6XH84"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH84"
FT                   /protein_id="ACT56629.1"
FT                   /translation="MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKS
FT                   HSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISI
FT                   ALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNS
FT                   RFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGG
FT                   FATDFLGKNMGAETKSIISGNMPIHEQLLAIIND"
FT   gene            39722..40219
FT                   /gene="purE"
FT                   /locus_tag="CLIBASIA_00200"
FT   CDS_pept        39722..40219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CLIBASIA_00200"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit protein"
FT                   /note="COG0041 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56630"
FT                   /db_xref="GOA:C6XH85"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH85"
FT                   /protein_id="ACT56630.1"
FT                   /translation="MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTP
FT                   DRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSI
FT                   VQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDI
FT                   PA"
FT   gene            40216..41280
FT                   /gene="purk"
FT                   /locus_tag="CLIBASIA_00205"
FT   CDS_pept        40216..41280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purk"
FT                   /locus_tag="CLIBASIA_00205"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0026 Phosphoribosylaminoimidazole carboxylase
FT                   (NCAIR synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56631"
FT                   /db_xref="GOA:C6XH86"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH86"
FT                   /protein_id="ACT56631.1"
FT                   /translation="MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSN
FT                   QQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLY
FT                   EKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQ
FT                   NLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASI
FT                   SQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVI
FT                   SQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCG
FT                   RKMGHVTQIYPKNP"
FT   gene            complement(41643..41933)
FT                   /locus_tag="CLIBASIA_00210"
FT   CDS_pept        complement(41643..41933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56632"
FT                   /db_xref="GOA:C6XH87"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH87"
FT                   /protein_id="ACT56632.1"
FT                   /translation="MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPA
FT                   LDMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT"
FT   gene            42884..43780
FT                   /locus_tag="CLIBASIA_00215"
FT   CDS_pept        42884..43780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56633"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH88"
FT                   /protein_id="ACT56633.1"
FT                   /translation="MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARL
FT                   TENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK
FT                   KITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVR
FT                   SGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE
FT                   AVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIV
FT                   EVLMRQKRMDKNGQHNT"
FT   gene            complement(44016..44915)
FT                   /locus_tag="CLIBASIA_00220"
FT   CDS_pept        complement(44016..44915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00220"
FT                   /product="phytoene synthase protein"
FT                   /note="COG1562 Phytoene/squalene synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56634"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH89"
FT                   /protein_id="ACT56634.1"
FT                   /translation="MVLKFLTKNTRKEEKIFSRDSLFVLRNLRDIDYDRYLACLLSPPL
FT                   YRISLSFLYYFHTELMRVRDTARNPITRDMRLQWWKDIFESSTKGLIAESISPFSVELL
FT                   SIVRQYDLPNQYFLDMIEAHFFDSYNDSIFDCKQFEHYAFRISSRLIHLATMILDSERY
FT                   SASLRVIKYAGIAQFIGQLICQLPIHYHRGQLYFPLDILGAVGLDRESFLSGQNSDRIS
FT                   LAIKIFAELGLKYLFKAREEMRYILPDVFPAFIPVSITESVLKHAQNHGFKIVSHSHTP
FT                   NQLVRPWYMLSSSIKKRF"
FT   gene            complement(44983..45093)
FT                   /locus_tag="CLIBASIA_00225"
FT   CDS_pept        complement(44983..45093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56635"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH90"
FT                   /protein_id="ACT56635.1"
FT                   /translation="MTYIISMKMMYVFSCIVEKSVLEDEFSNQPGSVGCF"
FT   gene            complement(45136..47532)
FT                   /locus_tag="CLIBASIA_00230"
FT   CDS_pept        complement(45136..47532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00230"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56636"
FT                   /db_xref="GOA:C6XH91"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH91"
FT                   /protein_id="ACT56636.1"
FT                   /translation="MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIV
FT                   MLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI
FT                   VTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSS
FT                   AGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCR
FT                   RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDF
FT                   EERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGST
FT                   TYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAA
FT                   VQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTT
FT                   SFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTG
FT                   VGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNP
FT                   YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKAR
FT                   IGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQE
FT                   KGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKV
FT                   SLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV"
FT   gene            complement(47543..47959)
FT                   /locus_tag="CLIBASIA_00235"
FT   CDS_pept        complement(47543..47959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00235"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="COG2127 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56637"
FT                   /db_xref="GOA:C6XH92"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH92"
FT                   /protein_id="ACT56637.1"
FT                   /translation="MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLD
FT                   SEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGE
FT                   CGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK"
FT   gene            complement(48061..48276)
FT                   /locus_tag="CLIBASIA_00240"
FT   CDS_pept        complement(48061..48276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56638"
FT                   /db_xref="InterPro:IPR021473"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH93"
FT                   /protein_id="ACT56638.1"
FT                   /translation="MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEF
FT                   IGLVYRNDDEEEISYHFDMSILEDDL"
FT   gene            complement(48520..49305)
FT                   /locus_tag="CLIBASIA_00245"
FT   CDS_pept        complement(48520..49305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00245"
FT                   /product="hydrolase protein"
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56639"
FT                   /db_xref="GOA:C6XH94"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH94"
FT                   /protein_id="ACT56639.1"
FT                   /translation="MMNEVKFFRSWRKYQFAFYDVGDKDAPTILLIHGLASSVQTNWLF
FT                   SGWIQLLCDQGFRVIAFDNLGHGKSDKSYIENDYRLVFMAADAVSLLEHLGISKVHVMG
FT                   YSMGARIACSMVLFYPSYVRSVILGGVGSVLYDSDVVDWQSLIDSFLLPSIDEVQNPLG
FT                   KKFRKFADLDPGNDLKALASCLSMIRKPFCQDDLYRIDVPVLIAVGSQDDLAGSPQELM
FT                   SFIPSSQYLNICRRDHLLAVGDKQFKQGVVNFYANELRA"
FT   gene            49434..49670
FT                   /locus_tag="CLIBASIA_00250"
FT   CDS_pept        49434..49670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00250"
FT                   /product="hypothetical protein"
FT                   /note="COG4391 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56640"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH95"
FT                   /protein_id="ACT56640.1"
FT                   /translation="MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGE
FT                   ENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL"
FT   gene            49722..50864
FT                   /locus_tag="CLIBASIA_00255"
FT   CDS_pept        49722..50864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00255"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56641"
FT                   /db_xref="GOA:C6XH96"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH96"
FT                   /protein_id="ACT56641.1"
FT                   /translation="MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNA
FT                   SRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTL
FT                   QKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQP
FT                   ITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTL
FT                   KDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLI
FT                   GDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLN
FT                   QLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE"
FT   gene            51202..51366
FT                   /locus_tag="CLIBASIA_00260"
FT   CDS_pept        51202..51366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56642"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH97"
FT                   /protein_id="ACT56642.1"
FT                   /translation="MCTPLMKKIFVENKKVFKGFKAQPLFLSFNIDGLFEKYLEIIQQL
FT                   LSVIASYVE"
FT   gene            51506..52534
FT                   /locus_tag="CLIBASIA_00265"
FT   CDS_pept        51506..52534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00265"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56643"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH98"
FT                   /protein_id="ACT56643.1"
FT                   /translation="MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLV
FT                   GFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNT
FT                   DWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADY
FT                   FKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIIS
FT                   KSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDK
FT                   SSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPP
FT                   IR"
FT   gene            52654..53850
FT                   /gene="aapQ"
FT                   /locus_tag="CLIBASIA_00270"
FT   CDS_pept        52654..53850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapQ"
FT                   /locus_tag="CLIBASIA_00270"
FT                   /product="ABC transporter membrane spanning protein (amino
FT                   acid)"
FT                   /note="COG4597 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56644"
FT                   /db_xref="GOA:C6XH99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH99"
FT                   /protein_id="ACT56644.1"
FT                   /translation="MIKNARKTVTRYFSRMKFLYDMRVHNISVQIILALLLTVIFLWCV
FT                   NNVYNNMEKSNLSLGIGFLSERAGFEIDQGIVPYTSDSSYATAILVGFVNTFWLAFSGM
FT                   IPATIIGTLVGAGRLSANKLVAWICRVYVEVFRNIPPLVVIFFLYKSVLSVLPIPDHSI
FT                   VLPFGMFLNNRGLSFPTLTMDTNAKIFVFSFVLGIVLSLFATRLSRHFHEKTGKALPLL
FT                   YISTFLIFGLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFI
FT                   AEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSL
FT                   AVAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLSIMIALFMNRLNAKIALKEKK"
FT   gene            53847..55007
FT                   /gene="aapM"
FT                   /locus_tag="CLIBASIA_00275"
FT   CDS_pept        53847..55007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapM"
FT                   /locus_tag="CLIBASIA_00275"
FT                   /product="general L-amino acid transport system permease
FT                   protein"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56645"
FT                   /db_xref="GOA:C6XHA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA0"
FT                   /protein_id="ACT56645.1"
FT                   /translation="MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILL
FT                   TALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE
FT                   QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG
FT                   LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG
FT                   VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFE
FT                   AANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF
FT                   SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK"
FT   gene            55022..55795
FT                   /locus_tag="CLIBASIA_00280"
FT   CDS_pept        55022..55795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00280"
FT                   /product="ABC transporter related protein"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56646"
FT                   /db_xref="GOA:C6XHA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA1"
FT                   /protein_id="ACT56646.1"
FT                   /translation="MKNTPINSKNPPKNNFAVEIKFLNKWYGNFHALRDINLNVLRGER
FT                   VIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNL
FT                   FSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKSHRSSSLLSGGESQRAAI
FT                   ARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRV
FT                   VFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQIIY"
FT   gene            55938..56014
FT                   /locus_tag="CLIBASIA_t05691"
FT   tRNA            55938..56014
FT                   /locus_tag="CLIBASIA_t05691"
FT                   /product="tRNA-Pro"
FT   gene            56147..56383
FT                   /locus_tag="CLIBASIA_00285"
FT   CDS_pept        56147..56383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00285"
FT                   /product="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56647"
FT                   /db_xref="GOA:C6XHA2"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA2"
FT                   /protein_id="ACT56647.1"
FT                   /translation="MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDH
FT                   GIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH"
FT   gene            56410..56485
FT                   /locus_tag="CLIBASIA_t05693"
FT   tRNA            56410..56485
FT                   /locus_tag="CLIBASIA_t05693"
FT                   /product="tRNA-Arg"
FT   gene            57190..57306
FT                   /locus_tag="CLIBASIA_00290"
FT   CDS_pept        57190..57306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56648"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA3"
FT                   /protein_id="ACT56648.1"
FT                   /translation="MTDIAKAQIKENQQRDNHKALLASIDKVMSEKTKDDEN"
FT   gene            57340..57699
FT                   /locus_tag="CLIBASIA_00295"
FT   CDS_pept        57340..57699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56649"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA6"
FT                   /protein_id="ACT56649.1"
FT                   /translation="MAELETAQAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRI
FT                   AEAKYKYRSDIVMAIEKSKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVEN
FT                   TKVVETKEAGKTARS"
FT   gene            58021..58105
FT                   /locus_tag="CLIBASIA_t05695"
FT   tRNA            58021..58105
FT                   /locus_tag="CLIBASIA_t05695"
FT                   /product="tRNA-Leu"
FT   gene            58120..58893
FT                   /gene="lipB"
FT                   /locus_tag="CLIBASIA_00300"
FT   CDS_pept        58120..58893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="CLIBASIA_00300"
FT                   /product="lipoyltransferase"
FT                   /EC_number="2.3.1.181"
FT                   /note="COG0321 Lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56650"
FT                   /db_xref="GOA:C6XHA7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA7"
FT                   /protein_id="ACT56650.1"
FT                   /translation="MELLSRNALNTSMFPMENISPIRWWVMDNPVDYEESQIIMEREIQ
FT                   RISLGNAEELVWLLEHPPLYTSGTSAISDDLLSPKSLPVYTTGRGGGYTYHGPGQRIIY
FT                   IMLNLAKRRKDLRCFVAALEEVIIRTLKILGIVGERREDRVGIWVVRLNKTRDNQLLLI
FT                   EEKIAAIGIRIRKWISFHGLSLNISPDLSYYTGIVPCGISQHGVTSLKELGYSYSMKYI
FT                   DTLIRKSFESVFGPTILHEYANINDVISTKQSEKK"
FT   gene            complement(58960..60096)
FT                   /gene="tgt"
FT                   /locus_tag="CLIBASIA_00305"
FT   CDS_pept        complement(58960..60096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="CLIBASIA_00305"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG0343 Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56651"
FT                   /db_xref="GOA:C6XHA8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA8"
FT                   /protein_id="ACT56651.1"
FT                   /translation="MDKNFHFNLKAVSGSARLGEIITPRGVIKTPAFMPVGTAGTVKAM
FT                   YFDQVRDLGADVILGNAYHLMLRPGAERIARLGGLHKFIRWFKPILTDSGGFQVMSLSK
FT                   LCSIDEQGVRFRSHIDGSLYRVSPEESVHIQNLLGSDIQMQLDECLALPAEDKELKRAM
FT                   ELSLRWAERSLVAFGNQPGKALFGIVQGGDNINLRSFSAERLKELDLKGYAIGGLAVGE
FT                   PQEVMLHILSNVLPILPVERPHYLMGVGTPDDILKSVSYGVDMFDCVMPTRAGRHGLAF
FT                   TRFGKINLRNARHIDDMRPLDAESHCSALRDYSRAYLHHLLRVNESLAGMILSWANLAY
FT                   YQDLMKEIRSAIAEDCFVDFAMQTQENWKKGDIPPIFT"
FT   gene            60126..60353
FT                   /locus_tag="CLIBASIA_00310"
FT   CDS_pept        60126..60353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56652"
FT                   /db_xref="GOA:C6XHA9"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHA9"
FT                   /protein_id="ACT56652.1"
FT                   /translation="MLLLHQNSHKEEEIIDFNSNHLLSSLSYCHYGKRLSTQYKTLRKG
FT                   ILIPVVFSILYFTISKSIFPLSHFKKHYRF"
FT   gene            complement(60341..61423)
FT                   /gene="queA"
FT                   /locus_tag="CLIBASIA_00315"
FT   CDS_pept        complement(60341..61423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="CLIBASIA_00315"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56653"
FT                   /db_xref="GOA:C6XHB0"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB0"
FT                   /protein_id="ACT56653.1"
FT                   /translation="MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL
FT                   VSDLPAFLNSNDAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYAR
FT                   PSKVIKKGDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLP
FT                   PYIARKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHV
FT                   GAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATT
FT                   EDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHA
FT                   ISHAYRFYSYGDTSLLFQKR"
FT   gene            complement(61578..62126)
FT                   /gene="coaD"
FT                   /locus_tag="CLIBASIA_00320"
FT   CDS_pept        complement(61578..62126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="CLIBASIA_00320"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COG0669 Phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56654"
FT                   /db_xref="GOA:C6XHB1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB1"
FT                   /protein_id="ACT56654.1"
FT                   /translation="MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKG
FT                   FLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDY
FT                   EMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI
FT                   VISLVKYDSIKLFPNTIFS"
FT   gene            complement(62743..65475)
FT                   /gene="gyrA"
FT                   /locus_tag="CLIBASIA_00325"
FT   CDS_pept        complement(62743..65475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CLIBASIA_00325"
FT                   /product="DNA gyrase subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56655"
FT                   /db_xref="GOA:C6XHB2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB2"
FT                   /protein_id="ACT56655.1"
FT                   /translation="MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDL
FT                   RDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDW
FT                   SLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQE
FT                   PVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRG
FT                   PDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAML
FT                   EKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVN
FT                   MVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDE
FT                   VVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAIL
FT                   ELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRR
FT                   TRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDF
FT                   VTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMP
FT                   FPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQEN
FT                   DILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERIC
FT                   YMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRT
FT                   SSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIR
FT                   IASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE"
FT   gene            complement(65616..66095)
FT                   /locus_tag="CLIBASIA_00330"
FT   CDS_pept        complement(65616..66095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00330"
FT                   /product="single-strand binding protein (ssb)"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56656"
FT                   /db_xref="GOA:C6XHB3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB3"
FT                   /protein_id="ACT56656.1"
FT                   /translation="MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVT
FT                   NERREKTEWHSVIVFSEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIM
FT                   RSMVMLDGRRDSLQGEEQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF"
FT   gene            66299..69178
FT                   /gene="uvrA"
FT                   /locus_tag="CLIBASIA_00335"
FT   CDS_pept        66299..69178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CLIBASIA_00335"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="COG0178 Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56657"
FT                   /db_xref="GOA:C6XHB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB4"
FT                   /protein_id="ACT56657.1"
FT                   /translation="MSKIKNISIRGAREHNLQNISIELPRNKLIVMTGVSGSGKSSLAF
FT                   DTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTI
FT                   TEIHDYLRLLFARIGIPHSPTTGLPIESQTISQMADRLLSFEQGTRMYLLAPIVRNRKG
FT                   EYKKELAEILKKGFQRVQIDGVFYHISDAPDLDKKYKHTIEVVVDRIVVHENIRERIVN
FT                   SLRTCLQLTNGLAIATIADSTFHNDEKTSPNLSHNSSDHILFSENLSCPVSGFSIAEIE
FT                   PRIFSFNNPAGACHHCDGLGTRQKVDEKLVIPNSKLALNNGAIAPWSNPLSAYHTNILT
FT                   ALGKDLGFSINDSWDLLSNENQQILLYGTKKNSIALARHKKSSYSNLSFRGIIPTLEKR
FT                   WSEADSSLLQEIIQRYMSSSPCTICHGYRLKDESLAVKIAGKHIGEIADMSIKKAQIWF
FT                   EQLPTQITQKANKISESILKEIQKRIHFLVEIGLDYLTLSRNSNMLSNGESQRIRLASQ
FT                   IGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETMLAADHIVD
FT                   IGPEAGINGGKIVAEGSPSQIIAHPTSLTGKYMSGKMSIKIPEKRRQYNPNRMIHVINA
FT                   RSNNLKNVTGSIPLGLFTAITGISGGGKSTFLISTLYKAAARIIMGSKYNPGIYDRIDG
FT                   LEYIDKVVSINQSPIGHTPRSNPATYVGAFTPIRDLFSNLPESKACGYKAGCFSFNVKG
FT                   GRCEVCEGNGVIKIAMHFLPDVYITCDVCQGQRYNPETLQIRFKDKSIADVLSMTVDES
FT                   LDFFAAIPTIHNKLTTLKEVGLGYIKIGQSANTLSGGESQRVKLAKELSKQATGNTLYI
FT                   LDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWILDFGPEGGDGGGE
FT                   IIASGPPEAIAKEPLSYTGKFLKSILKNK"
FT   gene            69401..70777
FT                   /gene="glnA"
FT                   /locus_tag="CLIBASIA_00340"
FT   CDS_pept        69401..70777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="CLIBASIA_00340"
FT                   /product="glutamine synthetase protein"
FT                   /note="COG0174 Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56658"
FT                   /db_xref="GOA:C6XHB5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB5"
FT                   /protein_id="ACT56658.1"
FT                   /translation="MVDKATSIIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFNENT
FT                   LLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNR
FT                   DPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGN
FT                   NKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESL
FT                   LHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSIHKGEKAIFTGNQH
FT                   DRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIP
FT                   YENKSDNKSIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQNTIPR
FT                   ICISLRESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMYCSI
FT                   "
FT   gene            complement(71726..72661)
FT                   /gene="glsA"
FT                   /locus_tag="CLIBASIA_00345"
FT   CDS_pept        complement(71726..72661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="CLIBASIA_00345"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="COG2066 Glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56659"
FT                   /db_xref="GOA:C6XHB6"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB6"
FT                   /protein_id="ACT56659.1"
FT                   /translation="MDLKKIIDGIYEEIKPQIGQGRVADYIPELAKVRIDHFGMSLALE
FT                   DGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGSSFDSIVQLENEN
FT                   GIPRNPFVNAGAIVVSDAVLGSSSADDAIENFLNFMRGIAGDASIHIDSVVANSEIETG
FT                   YRNFALANFVRSYGNIRYKIEDVLKFYFHQCSLMMNCVQLAKSGLYLAFRGYNSLTNQS
FT                   VISPLQSRCVNAVMLTCGHYDHSGDFAYRVGFPGKSGVGGGILAIVPSKASIAVWSPGL
FT                   DNSGNSLLGAKALELLAIRTGWSIFDPSVI"
FT   gene            complement(72701..73321)
FT                   /gene="rpsD"
FT                   /locus_tag="CLIBASIA_00350"
FT   CDS_pept        complement(72701..73321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CLIBASIA_00350"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG0522 Ribosomal protein S4 and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56660"
FT                   /db_xref="GOA:C6XHB7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB7"
FT                   /protein_id="ACT56660.1"
FT                   /translation="MSKRESSKHKIDRRIGENLWGRPKSPVNTRSYGPGLHGQRRKSKP
FT                   SYFGLQLRAKQKMKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAK
FT                   FVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVLEASQLAERD
FT                   VPEYISVNHDNMVATFVRIPSSLKDVPYPVIMQPNLVVEFYSR"
FT   gene            complement(73538..73648)
FT                   /locus_tag="CLIBASIA_00355"
FT   CDS_pept        complement(73538..73648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56661"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB8"
FT                   /protein_id="ACT56661.1"
FT                   /translation="MYLYLDWYKTIIVSKGKVESFFIKNAFINGKMIFED"
FT   gene            75488..75652
FT                   /locus_tag="CLIBASIA_00370"
FT   CDS_pept        75488..75652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56662"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHB9"
FT                   /protein_id="ACT56662.1"
FT                   /translation="MKSSDQSIEGKKIGHSMSMQRHSKYDKLCKAERRATTNQGRNTIS
FT                   KTEIQESKQ"
FT   gene            76170..77561
FT                   /gene="fumC"
FT                   /locus_tag="CLIBASIA_00375"
FT   CDS_pept        76170..77561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="CLIBASIA_00375"
FT                   /product="fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /note="COG0114 Fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56663"
FT                   /db_xref="GOA:C6XHC0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC0"
FT                   /protein_id="ACT56663.1"
FT                   /translation="MTNTRNEQDSFGTMKVQEDRYWGAQAQRSLENFKIGEEKQPLVII
FT                   RALGIIKQAAARVNIELGKLDPKIGEAIVKASEEVINGKLDDHFPLVVWQTGSGTQSNM
FT                   NVNEVISNRAIEILGGVMGSKSPVHPNDHVNLCQSSNDTYPTAIHIACAERIVHRLLPT
FT                   LRNLHVALTKKISDFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKNSIKRIEMTLDGL
FT                   YELAQGGTAVGTGLNTPVGFAEKVAQNIRDITGLPFITAPNKFEALACHDAIAFCHGAI
FT                   NTSATALFKIANDIRFLGSGPRSGLGELMLPENEPGSSIMPGKVNPTQCEAITQVCAHI
FT                   FGNHAAITFANSQGHFELNVYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQ
FT                   LSLNRSLMLVTALTSKIGYDNASMIAKKAHHNSTTLKEEAIASGLISATEYDLIVKPEK
FT                   MIYPH"
FT   gene            complement(77784..80480)
FT                   /gene="alaS"
FT                   /locus_tag="CLIBASIA_00380"
FT   CDS_pept        complement(77784..80480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="CLIBASIA_00380"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COG0013 Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56664"
FT                   /db_xref="GOA:C6XHC1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC1"
FT                   /protein_id="ACT56664.1"
FT                   /translation="MSNVSSIRTTFLEFFQKNGHELLPSSSLIPCNDPTLMFTNSGMVP
FT                   FKNIFTGQEKPVYQAVTTVQKCVRAGGKHNDLDNVGRTNRHHTFFEMLGNFSFGGYFKE
FT                   RAIQLAWDLLTKEFDLDQRRLYITVYDEDEEAFKLWKKISGLSADKIIRITTNDNFWSM
FT                   AETGPCGPCSEIFFDQGECIPGGLPGSSEEGERYIEIWNLVFMQFEQQNKQERFILPKM
FT                   SIDTGMGLERMATVLQEKTNNYDIDLFKHLIQASEQVTGMKYEGNNIVNHRVIVDHLRS
FT                   SSFLIADGILPANEGRGYVLRRIMRRAMCYARLLGYTEPLMMHLLPALCTEMGSAYPEL
FT                   IQAKLLIEETLRSEDERFGKTLDRGLVLLDGVLSHLGKDEILNGDVAFKLYDTHGLPLD
FT                   IMQDILCARGLAGIDIISFNQALEEQRSRARAHSLGLGSGTTEKIWFSLKEKYGATQFI
FT                   GYDLLRGSKFMKEDRKVLCQKPPIDLTNGVSSIVKAIVQQGEIVEEAVSGQKVEVVFDQ
FT                   TPFYAEAGGQLGDTGCAIGDGIRLQITDVQKKAEGIFVHHAIVERGILRTEMSLVLTID
FT                   YQNRRQLSINHSATHLLHHALSTILGSHVSQNGSCITPDGLRFDVTHSKPITSAELKSI
FT                   EDNVNDIIAQNLPVVTRIMNREDAIASGAAALLGTKYNDRVRVVSVEYEDGGVHSSALC
FT                   GGTHVSSTGEIMLLYIVSESSIRAGIRRIEAITGQRARSHLMGQDEKLKSLASFLKVSQ
FT                   GNVVGRVEEIWEEYRKLQLIHAKRKLQLNVEDLSCHKIADVNFMSHIISEVDSKELKSV
FT                   MDALQKKIQSGIIMLVGISKEKKASVLIVVTEDLLDRFNAVDLARLSAKVLGGGGGGGR
FT                   PHMAQSGGPNGNKADQAIAGVASFLKK"
FT   gene            complement(80562..81653)
FT                   /gene="recA"
FT                   /locus_tag="CLIBASIA_00385"
FT   CDS_pept        complement(80562..81653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="CLIBASIA_00385"
FT                   /product="recombinase A"
FT                   /note="COG0468 RecA/RadA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56665"
FT                   /db_xref="GOA:C6XHC2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC2"
FT                   /protein_id="ACT56665.2"
FT                   /translation="MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGI
FT                   EVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE
FT                   HALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEI
FT                   EGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNA
FT                   LKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGE
FT                   LIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVAD
FT                   SLLQEPAINTKDDADKDDTDNVE"
FT   gene            complement(81849..83435)
FT                   /locus_tag="CLIBASIA_00390"
FT   CDS_pept        complement(81849..83435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00390"
FT                   /product="lipid A ABC exporter family, fused ATPase and
FT                   inner membrane subunits"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56666"
FT                   /db_xref="GOA:C6XHC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC3"
FT                   /protein_id="ACT56666.1"
FT                   /translation="MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILF
FT                   MQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMC
FT                   MMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSF
FT                   NAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEM
FT                   PRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFP
FT                   SPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFY
FT                   DPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNA
FT                   AMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALD
FT                   IENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGF
FT                   YAHYHILGMSQ"
FT   gene            83786..84010
FT                   /gene="rpmE"
FT                   /locus_tag="CLIBASIA_00395"
FT   CDS_pept        83786..84010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="CLIBASIA_00395"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56667"
FT                   /db_xref="GOA:C6XHC4"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC4"
FT                   /protein_id="ACT56667.1"
FT                   /translation="MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHF
FT                   AWIGGRQKITDRGGQVSRFKKRFAGLSIE"
FT   gene            85055..85129
FT                   /locus_tag="CLIBASIA_t05697"
FT   tRNA            85055..85129
FT                   /locus_tag="CLIBASIA_t05697"
FT                   /product="tRNA-Glu"
FT   gene            complement(85675..87309)
FT                   /gene="pyrG"
FT                   /locus_tag="CLIBASIA_00400"
FT   CDS_pept        complement(85675..87309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="CLIBASIA_00400"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="COG0504 CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56668"
FT                   /db_xref="GOA:C6XHC5"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC5"
FT                   /protein_id="ACT56668.1"
FT                   /translation="MVKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLN
FT                   SDPGTMSPVQHGEVFVTDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERR
FT                   GDYLGTTVQVIPHVTNEIKEFITQGNEDADFVICEIGGTIGDIEVMPFVEAIRQFGNEF
FT                   SHRGSKALYIHLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMER
FT                   RKISLFCNVPMSAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTF
FT                   CDRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDP
FT                   VKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGI
FT                   PNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRI
FT                   YGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHP
FT                   ELKSRPLDPHPLFVSFIQATVLYSQSL"
FT   gene            complement(87397..87774)
FT                   /locus_tag="CLIBASIA_00405"
FT   CDS_pept        complement(87397..87774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56669"
FT                   /db_xref="GOA:C6XHC6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC6"
FT                   /protein_id="ACT56669.1"
FT                   /translation="MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHS
FT                   LGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD
FT                   SVSAKSSSSVVAGKRSSSRTK"
FT   gene            complement(87823..88617)
FT                   /locus_tag="CLIBASIA_00410"
FT   CDS_pept        complement(87823..88617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00410"
FT                   /product="triosephosphate isomerase protein"
FT                   /note="COG0149 Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56670"
FT                   /db_xref="GOA:C6XHC7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC7"
FT                   /protein_id="ACT56670.1"
FT                   /translation="MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICP
FT                   PATLIYESSRLCKTSSVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIG
FT                   HREDSYVVQSKVKSACNAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVP
FT                   VIAYEPIWAIGTGRVPAVVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDF
FT                   SLIENIDGLLVGGASLQHELFLKIVEIVERVYVDSCLEDTSL"
FT   gene            89046..89255
FT                   /locus_tag="CLIBASIA_00415"
FT   CDS_pept        89046..89255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56671"
FT                   /db_xref="GOA:C6XHC8"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC8"
FT                   /protein_id="ACT56671.1"
FT                   /translation="MIQHFWIAVDVFVIVATIITCFFMNKQCAWWLRVFLPFLLISIMI
FT                   VHITHISGHVNFLLFPPLSMIFLK"
FT   gene            89418..89900
FT                   /locus_tag="CLIBASIA_00420"
FT   CDS_pept        89418..89900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00420"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56672"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHC9"
FT                   /protein_id="ACT56672.1"
FT                   /translation="MQARCFLSLSFLFPLVAAIAVVSCSALSVVVDSSELLPEPMDITG
FT                   YWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIRNTSGKIQ
FT                   CQFLDSNKLNCLAKDQKQFYLRRTHLTELPSSKPQDDVAEIPEDPTTPSTSIIFYK"
FT   gene            90066..91097
FT                   /gene="hemH"
FT                   /locus_tag="CLIBASIA_00425"
FT   CDS_pept        90066..91097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="CLIBASIA_00425"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COG0276 Protoheme ferro-lyase (ferrochelatase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56673"
FT                   /db_xref="GOA:C6XHD0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD0"
FT                   /protein_id="ACT56673.1"
FT                   /translation="MNISSFAPRNHPKVKFGKIGVLLVNLGTPDGHDFFSLRRYLREFL
FT                   LDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIWNTAKNESILRTHTRDQATNLAK
FT                   RLESISSIVVDWAMRYGKPSVKEIINNLREEGCDRLLIFPLYPQYSAATTGTAQDKVFQ
FT                   ELIHMRWSPSLRTVPPYYEDSDYISALAQSIREHFESIQWTPEMLLVSFHQMPVSYLLK
FT                   GDPYGCHCHKTARLLKEFLSWPDDRFKICFQSRFGRIKCLEPPTDKTVEKLAHDGIKSL
FT                   AIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCLNSSNLSIDLLEKITRRELM
FT                   GWI"
FT   gene            complement(91430..92614)
FT                   /locus_tag="CLIBASIA_00430"
FT   CDS_pept        complement(91430..92614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00430"
FT                   /product="hypothetical protein"
FT                   /note="COG3754 Lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56674"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD1"
FT                   /protein_id="ACT56674.1"
FT                   /translation="MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLW
FT                   SFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAF
FT                   LRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTW
FT                   IEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLEL
FT                   GVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG
FT                   MIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEP
FT                   LRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH"
FT   gene            complement(92663..93298)
FT                   /locus_tag="CLIBASIA_00435"
FT   CDS_pept        complement(92663..93298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00435"
FT                   /product="hypothetical protein"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56675"
FT                   /db_xref="GOA:C6XHD2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD2"
FT                   /protein_id="ACT56675.1"
FT                   /translation="MKLYSIKEIFLTLQGEGGHAGRVAVFCRFSGCNLWSGREQDRLSA
FT                   QCRFCDTDFVGIQGTKGGRYNVDQLADLIEEQWITGEKEGRYCVLTGGEPLLQVDVPLI
FT                   QALNKRGFEIAVETNGTIEPPQGIDWICVSPKAGCDLKIKGGQELKLVFPQVNVSPENY
FT                   IGFDFERFSLQPMDGPFLEENTNLAISYCFQNPKWRLSVQTHKFIGIR"
FT   gene            complement(93989..94237)
FT                   /locus_tag="CLIBASIA_00440"
FT   CDS_pept        complement(93989..94237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56676"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD3"
FT                   /protein_id="ACT56676.1"
FT                   /translation="MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGK
FT                   GYESYISHVCELIELLKNKDFDGVEIERKSYNLRKNT"
FT   gene            complement(94327..94869)
FT                   /locus_tag="CLIBASIA_00445"
FT   CDS_pept        complement(94327..94869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56677"
FT                   /db_xref="GOA:C6XHD4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD4"
FT                   /protein_id="ACT56677.1"
FT                   /translation="MNLKGYDILKATVDYGGLILSFLSVIVSPVYSYFRHTVAETPKIM
FT                   WKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIA
FT                   IPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIG
FT                   FRVPIYLLQFQILSMKH"
FT   gene            complement(95327..96259)
FT                   /gene="ubiA"
FT                   /locus_tag="CLIBASIA_00450"
FT   CDS_pept        complement(95327..96259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="CLIBASIA_00450"
FT                   /product="prenyltransferase"
FT                   /note="COG0382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56678"
FT                   /db_xref="GOA:C6XHD5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD5"
FT                   /protein_id="ACT56678.1"
FT                   /translation="MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWST
FT                   VLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPL
FT                   PSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVV
FT                   LGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTA
FT                   RLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSK
FT                   QCCSFFHSAGVVGILILICLIISLFLDQF"
FT   gene            96451..97725
FT                   /gene="purD"
FT                   /locus_tag="CLIBASIA_00455"
FT   CDS_pept        96451..97725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="CLIBASIA_00455"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COG0151 Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56679"
FT                   /db_xref="GOA:C6XHD6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD6"
FT                   /protein_id="ACT56679.1"
FT                   /translation="MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA
FT                   IDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKS
FT                   FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEAT
FT                   SAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGG
FT                   MGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNV
FT                   RFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHG
FT                   TIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENID
FT                   WKHGYWREDIGLQKKERNVKYRNKS"
FT   gene            97816..98112
FT                   /locus_tag="CLIBASIA_00460"
FT   CDS_pept        97816..98112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56680"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD7"
FT                   /protein_id="ACT56680.1"
FT                   /translation="MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTL
FT                   NKHHINKTPSSSSAVYTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK"
FT   gene            98389..98589
FT                   /locus_tag="CLIBASIA_00465"
FT   CDS_pept        98389..98589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56681"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD8"
FT                   /protein_id="ACT56681.1"
FT                   /translation="MCIWGMMIRIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTA
FT                   FISSFKSFISRFLHMIANKDR"
FT   gene            99491..99646
FT                   /locus_tag="CLIBASIA_00470"
FT   CDS_pept        99491..99646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56682"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHD9"
FT                   /protein_id="ACT56682.1"
FT                   /translation="MYTKSLLMVAYLLSSVAISGGLCFNRPKGPSKEEQARIEQIRAEA
FT                   RERRYQ"
FT   gene            99710..99883
FT                   /locus_tag="CLIBASIA_00475"
FT   CDS_pept        99710..99883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56683"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE0"
FT                   /protein_id="ACT56683.1"
FT                   /translation="MSLVRYGSLSDHGKVAGEEAPRKKSEQPKREPQPQQENRKFIRRS
FT                   EISTRTHSLSDH"
FT   gene            complement(99917..100087)
FT                   /locus_tag="CLIBASIA_00480"
FT   CDS_pept        complement(99917..100087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56684"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE1"
FT                   /protein_id="ACT56684.1"
FT                   /translation="MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAF
FT                   GKSKCKRGRGK"
FT   gene            100088..100561
FT                   /locus_tag="CLIBASIA_00485"
FT   CDS_pept        100088..100561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00485"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="COG1225 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56685"
FT                   /db_xref="GOA:C6XHE2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE2"
FT                   /protein_id="ACT56685.1"
FT                   /translation="MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSG
FT                   CTAEAINFSSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYD
FT                   VWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ"
FT   gene            100932..101123
FT                   /locus_tag="CLIBASIA_00490"
FT   CDS_pept        100932..101123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56686"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE3"
FT                   /protein_id="ACT56686.1"
FT                   /translation="MGFITSLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLE
FT                   KLVVESLDRSLRCNYEKK"
FT   gene            complement(101444..102259)
FT                   /locus_tag="CLIBASIA_00495"
FT   CDS_pept        complement(101444..102259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00495"
FT                   /product="metal-dependent hydrolase protein"
FT                   /note="COG1235 Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56687"
FT                   /db_xref="GOA:C6XHE4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE4"
FT                   /protein_id="ACT56687.1"
FT                   /translation="MKDYYHFTILGCGASLGVPRITGDWGACDPTNPKNRRTRSSLKIS
FT                   RVSERGSNTTVIVDTGPDFYMQVLREQVLSIDAVLYTHPHADHIHGIDGLRGYFLKQKR
FT                   PIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPICMKSAGGVIEAIP
FT                   ILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQNLDFLIIDALKNGLHSSHFSLSE
FT                   SLKKIELINPKNAILTHMHVDLDYDMVLKSTPSRVVPAFDGMQFSSPIP"
FT   gene            complement(102259..103047)
FT                   /locus_tag="CLIBASIA_00500"
FT   CDS_pept        complement(102259..103047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00500"
FT                   /product="hypothetical protein"
FT                   /note="COG0084 Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56688"
FT                   /db_xref="GOA:C6XHE5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE5"
FT                   /protein_id="ACT56688.1"
FT                   /translation="MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVKDFVP
FT                   LIKLCQDYPSSIFCSVGTHPCHAHEENEVLVDELVCLASHPRVVAIGETGLDRYHNAHT
FT                   IEEQKVVFLRHIEASRITGIPLVIHSRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKL
FT                   ADICLELGGYISFTGMITFPKYDALRAIARGIPMDRVLVETDSPYIVPVSCQGKRNEPA
FT                   YVVNTAKALAKEKDVSYEDLMEETTKNALKLFSKISECVV"
FT   gene            complement(103058..104593)
FT                   /locus_tag="CLIBASIA_00505"
FT   CDS_pept        complement(103058..104593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00505"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="COG0143 Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56689"
FT                   /db_xref="GOA:C6XHE6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE6"
FT                   /protein_id="ACT56689.2"
FT                   /translation="MKEREKLYISTAIAYPNAQPHIGHAYEMIIADVLARFHRLDGLDV
FT                   LFTTGTDEHGQKIAKAAQNAGVTTKVFVDQNSRNFRDMADVLDISYDDFIRTTEKRHHD
FT                   TCRILWKKISDKGDIYKGCYSGWYSLRDEAYYNDDEVYKGADGQYYNAQHNPVQWMEEE
FT                   GYFFRLSAYQDKLLSYYESHPEFILPIERRNEVISFVKSGLKDLSLSRKTFDWGIKIPD
FT                   DPQYIMYVWIDALTNYLTTTGYLDNPDGSKAKFWPADLHVIGKDILRFHAIYWPAFLLS
FT                   ANLPLPKKVFSHGFILHKGEKISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKDGF
FT                   YDKDGLKKRVNADLANGIGNLVSRSVSMILKDYDGMIPTPGAFTESDESILSVCSRVLQ
FT                   EIRENMQNQLIHRALAQVISLVSEVDRYFDAQKPWELKKTNPDRASTVLYVTVEVIRQL
FT                   AILLQAFVPKLANKIFDILFVADENRCFQSLDQRLKPGFMLHKTFDPIFPRFL"
FT   gene            complement(104669..105712)
FT                   /gene="holB"
FT                   /locus_tag="CLIBASIA_00510"
FT   CDS_pept        complement(104669..105712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="CLIBASIA_00510"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56690"
FT                   /db_xref="GOA:C6XHE7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE7"
FT                   /protein_id="ACT56690.1"
FT                   /translation="MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGI
FT                   GKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTG
FT                   KWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLF
FT                   ILISHASPTILSTIRSRCLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVA
FT                   RAIKILHYDCDKIISSYIDLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKE
FT                   ICKSAKAAALSGQLEEADQIAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARECNDLY
FT                   FRDFYAI"
FT   gene            complement(105715..106392)
FT                   /gene="tmk"
FT                   /locus_tag="CLIBASIA_00515"
FT   CDS_pept        complement(105715..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="CLIBASIA_00515"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56691"
FT                   /db_xref="GOA:C6XHE8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE8"
FT                   /protein_id="ACT56691.1"
FT                   /translation="MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTP
FT                   AAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYA
FT                   YQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE
FT                   RKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRVSPLSSK
FT                   KDI"
FT   gene            106620..106973
FT                   /locus_tag="CLIBASIA_00520"
FT   CDS_pept        106620..106973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56692"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHE9"
FT                   /protein_id="ACT56692.1"
FT                   /translation="MHFKIKRFLFPLLALLGSCDDNPKDPIVQFKQMKYESQESKKSLS
FT                   DALFKTYPDTMDKINTVQTALRNLHNAISKMESELKELLSDILLKRHPDEIDKINPIKN
FT                   SANEISKLKEDLS"
FT   gene            107082..107375
FT                   /locus_tag="CLIBASIA_00525"
FT   CDS_pept        107082..107375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56693"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF0"
FT                   /protein_id="ACT56693.1"
FT                   /translation="MKKTQLLLPLLTLLSSCSDYVYEDAIRSQFENEIRYYKSMHPSTQ
FT                   DDIEYNLSEIKSFENQILAISNKLEKGQKPKYLHLKEAIQKIVKTIEQNEKE"
FT   gene            107532..107825
FT                   /locus_tag="CLIBASIA_00530"
FT   CDS_pept        107532..107825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56694"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF1"
FT                   /protein_id="ACT56694.1"
FT                   /translation="MRFKTKQLILAVLVTLLGSCADDRITELNTLLAEYKEENLKIREL
FT                   QKELYPAISTLAHRMDKLHFESDALDPILRRMDGPVKHVERRINSKTTTLEQ"
FT   gene            108048..110108
FT                   /locus_tag="CLIBASIA_00535"
FT   CDS_pept        108048..110108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00535"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56695"
FT                   /db_xref="GOA:C6XHF2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF2"
FT                   /protein_id="ACT56695.1"
FT                   /translation="MTDDSIDLFSTLPPQSQGSSEKLKKSGEIPDSPAFANQSASDNYD
FT                   ASSIRILEGLEPVRMRPGMYIGGTDEKALHHLFSEVIDNAMDEVIAGYANLIEVSLDGN
FT                   GFLTVVDNGRGIPVENHPKFPNKSTLEIILTTLHAGGKFDNSTYEISGGLHGVGISVVN
FT                   ALSDELHVTVARQNTIFSQKFSRGIPLSPLEKKEKVRNKRGTRITFRPDPKIFGDKAGF
FT                   DAARLLKMTQSKAYLSGRVKTCWSCDKEIAEKYGIPEKEEFYFPGGLKTYLQTKLENRS
FT                   LISSEIFTGKTEKKGTHRGTVEWAIAWCEENPEITSYCNTILTDEGGTHESGLRVALTR
FT                   GIKKYAELTQNKRAISIISDDLMISAVGILSVFIREPEFAGQTKTKLVSLDAQRTVENA
FT                   LRDPFDHYLVQNPIEATKLLEWVIERSEERLRRRKQREVNRKTAIRKLRLPGKLADCSQ
FT                   NIAHGTELFIVEGDSAGGSAKQARNRSNQAVLPLRGKILNVASAGSEKIRNNQQIMDLV
FT                   QALGCRTRSQYREEDLRYEKVIIMTDADVDGAHIASLLLTFFYQEMYDLIEQKHLFLIS
FT                   PPLFRITQGTKSVYAHDEEHKQKILEEFKKHGKGKIEISRFKGLGEMLASQLKETAMDA
FT                   NKRTLLRVEINKDLNSLKDTQDSINKLMGTKADERFKFIQERASFIDDVGT"
FT   gene            110290..111372
FT                   /locus_tag="CLIBASIA_00540"
FT   CDS_pept        110290..111372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00540"
FT                   /product="ABC transporter permease"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56696"
FT                   /db_xref="GOA:C6XHF3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF3"
FT                   /protein_id="ACT56696.1"
FT                   /translation="MRETMLNPQGIMRWMIMFIILVSLYFLKGFFAPVLSALIIGFTSW
FT                   PIYSSFISKKEESSTFLAVIATVSVMCLFIVPLLFLFYYGMLEMKELVSKVVLANQHGI
FT                   PVPRWLSDIPGGMWASELWTKHLSHPQSLKILSETFLKTNGIDFIPRFASRFGMIFLDY
FT                   CLSIIFMIIALFFFYRDGFSISQQLDSLGEHLFPAYWKKISRIVPKVIRSTFLGMTIIA
FT                   IGEGLVLGSAYWLAGVPSHVALGVITAIMAMIPGGAPISFTAVSIYLLIKGNIFNATCL
FT                   FLWGAIELFIVDKTLRPFLVGGPIKLPFLPTFFGLVGGVRTMGLLGLFIGPVLMALIAV
FT                   IWKESIMAIKENKEKISSNF"
FT   gene            complement(111601..112749)
FT                   /locus_tag="CLIBASIA_00545"
FT   CDS_pept        complement(111601..112749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56697"
FT                   /db_xref="GOA:C6XHF4"
FT                   /db_xref="InterPro:IPR014598"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF4"
FT                   /protein_id="ACT56697.1"
FT                   /translation="MSVQSFIKWAKNAKLQERISIARILGRTWCMEELLDQEKDSLVLA
FT                   MMHLLDDPSSRVRLSLARAIALSDTAPKHVVLALSEDHPDVSGTIILHSPVLKDNDLVD
FT                   LIGRGNKLTSIFVASRHKLSHVVVENLIETGCVDNIVALLGNKSVFLSNSLLMQIVERF
FT                   CHDASIRNLLSLRTDLSLKARYLLMKSVCNVLSQSKIVQKSITFRRTQILFEESMRVGI
FT                   LEMISHVRDVQALRELVDLLHDDGQLTPALLIYAIMIGAIDFVSVILANIAEYSTDRVY
FT                   SILSTGGFHVICALYELVGLSPEISEIFVEATMIWRELAVGSTVMEPGIIAEKLLERMR
FT                   KRNISGLPAGELLEMVERIYLDVNRRFVRSMATRSSRLIAAA"
FT   gene            113144..113713
FT                   /gene="pth"
FT                   /locus_tag="CLIBASIA_00550"
FT   CDS_pept        113144..113713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="CLIBASIA_00550"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56698"
FT                   /db_xref="GOA:C6XHF5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF5"
FT                   /protein_id="ACT56698.1"
FT                   /translation="MFIVAGLGNPGHEYCENRHNIGFMCIDRIHSFHFFPAWKKKFHAE
FT                   ISEGQLDGLRTILIKPQTFMNLSGQSLLEVMNFYKLPNLENYLVIHDDLDLDFGTLRLK
FT                   TGGGDAGHNGLKSISEKCGKNYKRLRIGIGRPPDTAHIIRHVLGNFSSPERYFLLPIID
FT                   NIARSLPLLAKREDVSFLNHIVSVRK"
FT   gene            113918..115021
FT                   /locus_tag="CLIBASIA_00555"
FT   CDS_pept        113918..115021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00555"
FT                   /product="translation-associated GTPase"
FT                   /note="COG0012 Predicted GTPase, probable translation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56699"
FT                   /db_xref="GOA:C6XHF6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF6"
FT                   /protein_id="ACT56699.1"
FT                   /translation="MGFKCGIIGLPNVGKSTLFNALTRTASAQAANYPFCTIEPNSGEV
FT                   AVPDPRMHKLAEIAESKDLVPTRMSFVDIAGLVRGASKGEGLGNQFLAHIREVDAIIHV
FT                   LRCFKDENIIHVEGRIDPINDIETIETELMLSDLERLERLFEKNKKYRNHKSEEIVLLQ
FT                   SIISSSLRLIEEGKPVRSLLESLDSDAIPIFKSLNLLTAKPILYICNVSEHDCKKGNIY
FT                   TEAVQRLASQQNAEMIIISAAIEAEISQLPEEERALFMEELDISISGLELLIRSGYRLL
FT                   DLITYFTVGPKETRAWTIPRGTNAQKAAGVIHTDFEKGFIRALTISYKDYVAMGGENAA
FT                   KEAGKARDEGKEYIVKDGDILHFRFNV"
FT   gene            115253..116533
FT                   /gene="pfk"
FT                   /locus_tag="CLIBASIA_00560"
FT   CDS_pept        115253..116533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /locus_tag="CLIBASIA_00560"
FT                   /product="pyrophosphate--fructose-6-phosphate
FT                   1-phosphotransferase"
FT                   /EC_number="2.7.1.90"
FT                   /note="COG0205 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56700"
FT                   /db_xref="GOA:C6XHF7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF7"
FT                   /protein_id="ACT56700.1"
FT                   /translation="MVEFLSYISNLDMWILTGVLSFLEKDMVAHKVAFLTAGGIAPCLS
FT                   SIIGMLINHYNKILPKAELIYYRFGYQGLLLDDKITITEDMRQNAEQLLSYGGSPIGNS
FT                   RVKLTNFSDCIKRGLIKKDENPLEVSAHHLMQSGVTILHTIGGDDTNTTACDLLRYLKE
FT                   KNYNITVVGLPKTIDNDIIPIHQSLGALTAAQVSACFFDNISNERSATPRSLIIHEVMG
FT                   RNCGWLTAYSAHCYLNMIQDRNYIDGFIFSPDFKGIDGVYLPEMSFNLEVEIERLSKVM
FT                   EKKGSVAIFVSEGACRDVIMDNRLSSGEKIKRDSFGHILLDKMNVGSWFADKFANMIKA
FT                   ERSIVQKSGYFARSAPSGSEDLSLIKKMVVLAVDSAISGISGVTGEDERENNILRIIKF
FT                   EDIRGGRVFDTNTPWFSDILRHTGQKS"
FT   gene            116798..117838
FT                   /locus_tag="CLIBASIA_00565"
FT   CDS_pept        116798..117838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00565"
FT                   /product="hypothetical protein"
FT                   /note="COG2899 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56701"
FT                   /db_xref="GOA:C6XHF8"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF8"
FT                   /protein_id="ACT56701.1"
FT                   /translation="MKSNSLYASLIHHFRWAILVTVAGFLCGLGIGWQFTHTLSGTIST
FT                   VYICIILAVVEISLSFENAILNAKNLQKMSSIWQKRFLTWGILIAVFGMRIIFPIMIVC
FT                   IVSTINPIEAMNLAIYSPQDYLKIISQAHVPISGFGGTFLMMVSLTFFFNSQNKLHWIH
FT                   FLEIAMSHLSKIKGIKIFIVLSIIFGISNILPTNEMYSFVSSSTAAIIIFYGINFLESV
FT                   LSSDSSNNVTHGKHGLNLFLYLEIIDASLSLDGVISSFAITKNFFIIVIGLTIGAIYVR
FT                   SMTLLMLKQGILNKYKYLEHGSYYSIFVLSVIMFLQTIVDIPEIFTGTSSTILIFLSIY
FT                   SSIKNK"
FT   gene            complement(118077..123404)
FT                   /locus_tag="CLIBASIA_00570"
FT   CDS_pept        complement(118077..123404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00570"
FT                   /product="hypothetical protein"
FT                   /note="COG1112 Superfamily I DNA and RNA helicases and
FT                   helicase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56702"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHF9"
FT                   /protein_id="ACT56702.1"
FT                   /translation="MNNYNIKHVRQCLDDMRRKLLDCSVQNKLLNFRMDQQSVLRIFNT
FT                   SPNQLYQQIFREEVMQFMPLPMPTKKQAQAYGFADTGNHHTIDESTWIEKLGLSINYDL
FT                   PIEYDSDDEKKNYQVLQKVRDLIVEDIKTSNDLVDIREIEKKIEISLQKLTSIIQNYGY
FT                   ADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLINEKSQISIKETGT
FT                   SILYIVLGFLEWYEIDDYDNPRLAPLFTIPVALEKRSSTSQPGLTQYHLRYTGEEIILN
FT                   LSLKEKLQSDFGIILPAIAEGMWPEDYFLQIQKIIEESKSHWAVRRYGVLGLLNFSKML
FT                   MYLDLDHLRWPEGEDNILNHDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQRC
FT                   PLIDDSDSSQHSAVIDVINGKNLIIEGPPGTGKSQTITNIIAAAMLHGKKILFCAQKMA
FT                   AIEVVRHRLEKAGLGEFCLELHSHKVHKRAILDDLRKRIDNRNIKTVPQEIDVEITRYE
FT                   ELKGQLNQYAQEINQIWKNTELSIHQILMGAARYRHNLPLDPVQLHVEGLSGENADRLL
FT                   RSRLEDQIKAFKDVIVEFHKQAGESMELMNHPWYGVHSSDIHILNYNKALSSLENWQSA
FT                   LIKWQKDHEVFLNRYGVQNQRQRLLYWQGQLLAAVDQVPSLPRVICFKAFKKLEDSSIA
FT                   SIKQWIVDFSHLQDDFNDINIHLDPKKLEELKVGKDIPYFPDLSGEFGISAESSFKDIR
FT                   NTISSLQKMMVSCEKYWESFSGLMQCFPPVFSQKILPNRQGFENAVLLMELAVELPVSL
FT                   LRLRDDFFNNSGIDSVLEELFERLDSLKILQESLDDVFNMKKLPDAQVLQDLNKVLHSA
FT                   GLLSSWWGASCKKAKASLLSLAKNPGISWKKLYAQLPNAYQFAVEKEKLEKRNFGNTLG
FT                   EHYRGLSTDIVALKNIREWYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKLHCDE
FT                   LSKKITKVFGRIQELEQFLPKQKELQNRSALFVGEGNVFDSLIQRLSHNFDPWQNWFKE
FT                   DEILLQEAQEFSAKLHKIREKNIVLAEESLIKKFFGEEIKLSVFDSNTKESNKSLAVIN
FT                   STLEFAHSIRERVLFDELIQGINHIDDHTIYNSFIKDLKNLRMIWQQQVKTQEDFIEDT
FT                   QLDMAQWAARCNDELVKLISRNSEAIKKPRWLNGWVNLMHMVQDMQDKGLKEIQAAIFN
FT                   NSLDVKYLESSLLAAIYHQLSQEILTEKPHLMHYSAVQFTAKQERFREYDKRLQFLQRQ
FT                   RIASVIGNQKIAQGISGGLKSDYTELSLIRSELGKKNRNIPIRQLISRAKNSLLQLKPC
FT                   FMMSPMSVANYLEPKDVKFDLVIMDESSQIKPEDALGVIARGKQIVVVGDPKQLPPTRF
FT                   FDHDNDQEDYDEEVAAVSQTESILDALLPLFSMRRLQWHYRSLNENLIACSNYYFYDNS
FT                   LIVFPSPYTSVDRYGVGFTHVKNGVVVDQGNPEEARVIALAVKDHALRYPEESLGVIAM
FT                   NAKQRDLIESTINKLCRKDSEVEKAISKLRMHADPFFIKNLENVQGDERDRIFISFTYG
FT                   PHEPGGRVFQRFGPINSDIGWRRLNVLFTRSRRRIEVFSTMRYLDVVVDIDSKLGIRVM
FT                   RDFLHFAETGYMEHSLKTKTNKQDSDFAVSVVNELEKTGFACDSQLGDMGFSIDVVVRD
FT                   PNNPGHYLMGIECDGAMYNSAKSARDRDRLRQEVLERMGWRIRRIWSVDWFSNPDEVIE
FT                   PIIRELRELISQKSSSTRE"
FT   gene            124546..124836
FT                   /locus_tag="CLIBASIA_00575"
FT   CDS_pept        124546..124836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00575"
FT                   /product="hypothetical protein"
FT                   /note="COG0762 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56703"
FT                   /db_xref="GOA:C6XHG0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG0"
FT                   /protein_id="ACT56703.1"
FT                   /translation="MNFLFKILLLLLELYANIVITRIVFSFLYTYDIINPLNFFVQTAR
FT                   QLLYSFTEPFLIPIRRFTPSLGVEWKRIDLSPIILLTVIYILQCFLKFLIL"
FT   gene            124869..125165
FT                   /locus_tag="CLIBASIA_00580"
FT   CDS_pept        124869..125165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56704"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG1"
FT                   /protein_id="ACT56704.1"
FT                   /translation="MCNVIVRLIPNAKKSGIASLEIPKDTSDTIHMKIKVTATPQKGKA
FT                   NKAMLAMLAKKLALSKSSLRMLSKQSSPLKIIYIDKDCKEITELLQNNDSLTL"
FT   gene            complement(125155..125688)
FT                   /locus_tag="CLIBASIA_00585"
FT   CDS_pept        complement(125155..125688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00585"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG0221 Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56705"
FT                   /db_xref="GOA:C6XHG2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG2"
FT                   /protein_id="ACT56705.1"
FT                   /translation="MVQLNEISLGSNSPIDVNVFIEISLGGYPIKYEMDKKSGVLVVDR
FT                   FISTPMLYPGNYGFIPNTLSDDGDPVDVIMYSSEPILPGSVISTRPIGVMKMEDDGGID
FT                   EKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEHFFKHYKDLEDGKWAKLDGWEGVNSA
FT                   HKIILEAVKRGIKE"
FT   gene            complement(125840..127714)
FT                   /locus_tag="CLIBASIA_00590"
FT   CDS_pept        complement(125840..127714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00590"
FT                   /product="GTP-binding protein"
FT                   /note="COG1217 Predicted membrane GTPase involved in stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56706"
FT                   /db_xref="GOA:C6XHG3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG3"
FT                   /protein_id="ACT56706.1"
FT                   /translation="MFYDDGLFFIYGRLGYMQIRNIAIIAHVDHGKTTLVDELLKQSGV
FT                   FRDNQRVSERVMDCNDLEKERGITILAKVTSIVWNDVRINIVDTPGHADFGGEVERILC
FT                   MVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVVVNKVDRSDARADEVINEVFDLFS
FT                   ALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQGMVPLLNLIVDHVPPPVISEGEFKMI
FT                   GTILEKDPFLGRIVTGRIHSGTIKSNQNIKALSPDGALVEVGRVSKILAFRGIDRQPID
FT                   EAHAGDIVSIAGLVKATVADTFCDPSIDEPLKAQPIDPPTVTMTFGVNDSPLAGTEGDK
FT                   VTSRMIRDRLFKEAEGNIALKIEESSSKDAFFVSGRGELQLAVLIETMRREGFELAVSR
FT                   PRVVIKKEGDSLLEPIEEVVIDVDEEHSGAVVQKMTLHKSEMIELRPSGTGRVRLVFLS
FT                   PTRGLIGYQSQLMTDTRGTAIMNRLFHSYQPHKGEIGGRSNGVLLSNEEGKVVAYALFN
FT                   LEDRGSMIVEPGDKVYQGMIVGIHTRENDLDVNVLKGKKLTNMRASGKDEAVKLVPAVK
FT                   MTLEQALSWIQNDELVEVTPKSIRLRKMYLDPNERKRKGKSVNLEYNV"
FT   gene            complement(127808..129022)
FT                   /gene="argG"
FT                   /locus_tag="CLIBASIA_00595"
FT   CDS_pept        complement(127808..129022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="CLIBASIA_00595"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG0137 Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56707"
FT                   /db_xref="GOA:C6XHG4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG4"
FT                   /protein_id="ACT56707.1"
FT                   /translation="MSRDVKKVVLAYSGGLDTSIILKWLQVEKGLEVIVFIADLGQGEE
FT                   LKIASDKARLLGAKEVYVKDLRREFVRDFVFPMFRANALYEGYYLLGTAIARPLIAKYL
FT                   VDIANETGADAIAHGSTGKGNDQVRFELSAYSLNSDIEIIAPWRHWSFKGRQDLIDFAE
FT                   KHAIPIDKNKRGEAPFSIDTNLLHSSSEGRVLEDPSQPAPEYVYKMIVSPEEAPDTPTT
FT                   IRIDFQRGDPIAINGQVMSPEVLLEQLNQYGRCNGIGRIDIVENRFVGIKSRGVYETPG
FT                   GTILLHAHRAIESISLDSGSAHLKDDLMSRYASIVYQGFWFSPEREMLQALIDKSQEYV
FT                   EGSITLKLYKGNVMVVGRESNKSLYSDKLVTFEDDLDAYNQSDSEGFIKLHALRLRTLA
FT                   RRNKV"
FT   gene            complement(129027..129251)
FT                   /locus_tag="CLIBASIA_00600"
FT   CDS_pept        complement(129027..129251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56708"
FT                   /db_xref="GOA:C6XHG5"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG5"
FT                   /protein_id="ACT56708.1"
FT                   /translation="MFVKEIFLFSFCKAGTVFLSLKKDMYLGWDNNSMFILKQEFFIFM
FT                   MEKLVCLLLCVCGMLWFSSSGIFAYLNIG"
FT   gene            complement(129268..129678)
FT                   /gene="rplQ"
FT                   /locus_tag="CLIBASIA_00605"
FT   CDS_pept        complement(129268..129678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CLIBASIA_00605"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG0203 Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56709"
FT                   /db_xref="GOA:C6XHG6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG6"
FT                   /protein_id="ACT56709.1"
FT                   /translation="MRHAISGRKLNRTSSHRKAMFSNMAASIIWHEQIVTTLPKAKELR
FT                   PIVEKLVTLGKKGGLHSLRLAISKIGDVDVVNKLFGIIAKRYSDRSGGYLRIMKRGFRY
FT                   GDSAPMAVIEFVDRDLSAKGTPVSRKSHKVEK"
FT   gene            complement(129714..130736)
FT                   /gene="rpoA"
FT                   /locus_tag="CLIBASIA_00610"
FT   CDS_pept        complement(129714..130736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CLIBASIA_00610"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56710"
FT                   /db_xref="GOA:C6XHG7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG7"
FT                   /protein_id="ACT56710.1"
FT                   /translation="MIQKNWQELIKPNNIEYIVLGQEEENRTLMIAEPLPRGFAHTLGN
FT                   ALRRVLMSSLRGAAITAVQIDGVLHEISSIKGVHEDLTDIILNIKGINLKMSGDSHKRV
FT                   TIFKRGPGVVTAGDIQTVNDIEVLNPDHVICNLDVDAVVRMELTVSKGHGYVPAKHHRT
FT                   ENDPIGLITIDALYSPIKKVSYTVESAREGQVLDYDKLSMTIDTDGSITGEDSVALASR
FT                   ILQDQLGMFINFEEPKKEVKEDINVKSLPFNPALLKKVEELELSVRSTNCLRGENIVYM
FT                   GDLIQRTEADMLRMANFGRKSLVEIKGVLGTMGLFLGMNLPDWPPESIEELAKKYEDKC
FT                   "
FT   gene            complement(130827..131216)
FT                   /gene="rpsK"
FT                   /locus_tag="CLIBASIA_00615"
FT   CDS_pept        complement(130827..131216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CLIBASIA_00615"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100 Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56711"
FT                   /db_xref="GOA:C6XHG8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG8"
FT                   /protein_id="ACT56711.1"
FT                   /translation="MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWS
FT                   SPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIG
FT                   FTIVSICDVTMIAHNGCRPRKRRRI"
FT   gene            complement(131308..131676)
FT                   /gene="rpsM"
FT                   /locus_tag="CLIBASIA_00620"
FT   CDS_pept        complement(131308..131676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CLIBASIA_00620"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56712"
FT                   /db_xref="GOA:C6XHG9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHG9"
FT                   /protein_id="ACT56712.1"
FT                   /translation="MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRV
FT                   HQLVESEVIQIRQAIEQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTH
FT                   TNARTRKKFGKGGVARKR"
FT   gene            complement(131793..132398)
FT                   /gene="adk"
FT                   /locus_tag="CLIBASIA_00625"
FT   CDS_pept        complement(131793..132398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="CLIBASIA_00625"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56713"
FT                   /db_xref="GOA:C6XHH0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH0"
FT                   /protein_id="ACT56713.1"
FT                   /translation="MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLL
FT                   GKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMD
FT                   CAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSS
FT                   YYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS"
FT   gene            complement(132395..133729)
FT                   /gene="secY"
FT                   /locus_tag="CLIBASIA_00630"
FT   CDS_pept        complement(132395..133729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CLIBASIA_00630"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="COG0201 Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56714"
FT                   /db_xref="GOA:C6XHH1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH1"
FT                   /protein_id="ACT56714.1"
FT                   /translation="MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPL
FT                   PSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVP
FT                   SLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTII
FT                   TLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLML
FT                   LIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFA
FT                   SSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNP
FT                   KEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVP
FT                   VSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKNS"
FT   gene            complement(133884..134339)
FT                   /gene="rplO"
FT                   /locus_tag="CLIBASIA_00635"
FT   CDS_pept        complement(133884..134339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CLIBASIA_00635"
FT                   /product="50S ribosomal protein L15"
FT                   /note="COG0200 Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56715"
FT                   /db_xref="GOA:C6XHH2"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH2"
FT                   /protein_id="ACT56715.1"
FT                   /translation="MKLNEISYDKGSCKVKKRVARGIGSGTGKTAGRGVKGQKSRSGVS
FT                   VRGFEGGQMPLYRRLPKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVAS
FT                   GLVRRSQRGIRILSDGDLKAKVVLRVSGASASAVEKVEKLGGQVIVI"
FT   gene            complement(134361..134555)
FT                   /gene="rpmD"
FT                   /locus_tag="CLIBASIA_00640"
FT   CDS_pept        complement(134361..134555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CLIBASIA_00640"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG1841 Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56716"
FT                   /db_xref="GOA:C6XHH3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH3"
FT                   /protein_id="ACT56716.1"
FT                   /translation="MSSSLKMQKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDD
FT                   TPSVRGMISTVHHLVRIVE"
FT   gene            complement(134556..135155)
FT                   /gene="rpsE"
FT                   /locus_tag="CLIBASIA_00645"
FT   CDS_pept        complement(134556..135155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CLIBASIA_00645"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56717"
FT                   /db_xref="GOA:C6XHH4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH4"
FT                   /protein_id="ACT56717.1"
FT                   /translation="MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFS
FT                   VLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAG
FT                   KVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPR
FT                   DVANRRGIKHSLLQARRVVSSKSSSYSRDSKNKGGN"
FT   gene            complement(135224..135586)
FT                   /gene="rplR"
FT                   /locus_tag="CLIBASIA_00650"
FT   CDS_pept        complement(135224..135586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CLIBASIA_00650"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG0256 Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56718"
FT                   /db_xref="GOA:C6XHH5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH5"
FT                   /protein_id="ACT56718.1"
FT                   /translation="MATKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDD
FT                   SIGHTLVSASSLNEPLRSSLKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCG
FT                   RIAALADAVRKGGVSF"
FT   gene            complement(135595..136128)
FT                   /gene="rplF"
FT                   /locus_tag="CLIBASIA_00655"
FT   CDS_pept        complement(135595..136128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CLIBASIA_00655"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56719"
FT                   /db_xref="GOA:C6XHH6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH6"
FT                   /protein_id="ACT56719.1"
FT                   /translation="MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTL
FT                   QEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLK
FT                   MSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIR
FT                   YSGEVIIRKEGKKK"
FT   gene            complement(136171..136560)
FT                   /gene="rpsH"
FT                   /locus_tag="CLIBASIA_00660"
FT   CDS_pept        complement(136171..136560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CLIBASIA_00660"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096 Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56720"
FT                   /db_xref="GOA:C6XHH7"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH7"
FT                   /protein_id="ACT56720.1"
FT                   /translation="MSCLGDMLTRIRNANLRYKPSVVIPFSRLHARVLDVLKTEGYIGE
FT                   YCEIDAGKGRIQLKVDLKYHNGASVIRKIDCVSKPGRRLYSSFKDIPQVCNGLGIMIVT
FT                   TSKGVMAGHQARECKVGGEVLCSVF"
FT   gene            complement(136575..136880)
FT                   /gene="rpsN"
FT                   /locus_tag="CLIBASIA_00665"
FT   CDS_pept        complement(136575..136880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="CLIBASIA_00665"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56721"
FT                   /db_xref="GOA:C6XHH8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH8"
FT                   /protein_id="ACT56721.1"
FT                   /translation="MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAM
FT                   LQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW"
FT   gene            complement(136902..137459)
FT                   /gene="rplE"
FT                   /locus_tag="CLIBASIA_00670"
FT   CDS_pept        complement(136902..137459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CLIBASIA_00670"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094 Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56722"
FT                   /db_xref="GOA:C6XHH9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHH9"
FT                   /protein_id="ACT56722.1"
FT                   /translation="MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMG
FT                   VGESIADSKKAESAAADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYD
FT                   FLDRLINMGMPRIRDFHGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISIC
FT                   TTTRSDREAKYLLTLFGFPFPK"
FT   gene            complement(137452..137760)
FT                   /gene="rplX"
FT                   /locus_tag="CLIBASIA_00675"
FT   CDS_pept        complement(137452..137760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CLIBASIA_00675"
FT                   /product="50S ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56723"
FT                   /db_xref="GOA:C6XHI0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI0"
FT                   /protein_id="ACT56723.1"
FT                   /translation="MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRH
FT                   QRQTPNKEAGIISKEASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG"
FT   gene            complement(137773..138141)
FT                   /gene="rplN"
FT                   /locus_tag="CLIBASIA_00680"
FT   CDS_pept        complement(137773..138141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CLIBASIA_00680"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56724"
FT                   /db_xref="GOA:C6XHI1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI1"
FT                   /protein_id="ACT56724.1"
FT                   /translation="MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKE
FT                   VIPRSKVKKGSVQKAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPR
FT                   ELRIKGHLKILSLAAEVV"
FT   gene            complement(138268..138507)
FT                   /gene="rpsQ"
FT                   /locus_tag="CLIBASIA_00685"
FT   CDS_pept        complement(138268..138507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="CLIBASIA_00685"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56725"
FT                   /db_xref="GOA:C6XHI2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI2"
FT                   /protein_id="ACT56725.1"
FT                   /translation="MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVH
FT                   DENNKYKVGDFVSIEESAPISKKKSWLVIDSEGV"
FT   gene            complement(138518..138721)
FT                   /locus_tag="CLIBASIA_00690"
FT   CDS_pept        complement(138518..138721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00690"
FT                   /product="ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56726"
FT                   /db_xref="GOA:C6XHI3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI3"
FT                   /protein_id="ACT56726.1"
FT                   /translation="MLKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMR
FT                   EVSRDIARIKTMMNSRVFKNNS"
FT   gene            complement(138729..139145)
FT                   /gene="rplP"
FT                   /locus_tag="CLIBASIA_00695"
FT   CDS_pept        complement(138729..139145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="CLIBASIA_00695"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG0197 Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56727"
FT                   /db_xref="GOA:C6XHI4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI4"
FT                   /protein_id="ACT56727.1"
FT                   /translation="MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGS
FT                   SEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRIL
FT                   FEIDGVSEEVARRAFRLGAAKLSVVTKFIQRVVE"
FT   gene            complement(139204..139887)
FT                   /gene="rpsC"
FT                   /locus_tag="CLIBASIA_00700"
FT   CDS_pept        complement(139204..139887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CLIBASIA_00700"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56728"
FT                   /db_xref="GOA:C6XHI5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI5"
FT                   /protein_id="ACT56728.1"
FT                   /translation="MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQC
FT                   HLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVN
FT                   EVPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELS
FT                   RTECYLEGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV
FT                   VEKDS"
FT   gene            complement(139887..140282)
FT                   /gene="rplV"
FT                   /locus_tag="CLIBASIA_00705"
FT   CDS_pept        complement(139887..140282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CLIBASIA_00705"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56729"
FT                   /db_xref="GOA:C6XHI6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI6"
FT                   /protein_id="ACT56729.1"
FT                   /translation="MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSD
FT                   ALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGR
FT                   QRIGRIVRPFSRLTVIVREVSDEGKVV"
FT   gene            complement(140286..140564)
FT                   /gene="rpsS"
FT                   /locus_tag="CLIBASIA_00710"
FT   CDS_pept        complement(140286..140564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CLIBASIA_00710"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COG0185 Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56730"
FT                   /db_xref="GOA:C6XHI7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI7"
FT                   /protein_id="ACT56730.1"
FT                   /translation="MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFI
FT                   GLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK"
FT   gene            complement(140577..141413)
FT                   /gene="rplB"
FT                   /locus_tag="CLIBASIA_00715"
FT   CDS_pept        complement(140577..141413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="CLIBASIA_00715"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG0090 Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56731"
FT                   /db_xref="GOA:C6XHI8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI8"
FT                   /protein_id="ACT56731.1"
FT                   /translation="MALKNFNPDTSGRRQLVMVDRNSLHSGKPIKSLTRGLCSKGGRNN
FT                   TGRVTMRFRGGGHKNRYRLVDFKRGEYGLEGVVKRLEYDPNRTAFIALISYSNGSLAYI
FT                   LAPQRLSVGDKVISSDSAVDVKPGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYA
FT                   RLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNHAKAGRARWLGMRSHVR
FT                   GVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARSRHKNKK"
FT   gene            complement(141442..141774)
FT                   /gene="rplW"
FT                   /locus_tag="CLIBASIA_00720"
FT   CDS_pept        complement(141442..141774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CLIBASIA_00720"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089 Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56732"
FT                   /db_xref="GOA:C6XHI9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHI9"
FT                   /protein_id="ACT56732.1"
FT                   /translation="MINIRFYDTIISPVIAEKSTLLAGQNQVVFNVKKDSSKSEIKSAV
FT                   EALFSVKVVSVNTLIRKGKVKRLSRISAARSRVRSSRDMYVSRKDVKRAFVTLAKGYSI
FT                   DISAGV"
FT   gene            complement(141771..142394)
FT                   /gene="rplD"
FT                   /locus_tag="CLIBASIA_00725"
FT   CDS_pept        complement(141771..142394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CLIBASIA_00725"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088 Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56733"
FT                   /db_xref="GOA:C6XHJ0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ0"
FT                   /protein_id="ACT56733.1"
FT                   /translation="MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKR
FT                   IGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKK
FT                   VRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF
FT                   QLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRFK"
FT   gene            complement(142391..143056)
FT                   /gene="rplC"
FT                   /locus_tag="CLIBASIA_00730"
FT   CDS_pept        complement(142391..143056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="CLIBASIA_00730"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087 Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56734"
FT                   /db_xref="GOA:C6XHJ1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ1"
FT                   /protein_id="ACT56734.1"
FT                   /translation="MRSGVVARKLGMTCVYNIEGRRIPVTVLHLDNCQVVVHRTLDKNG
FT                   YMAVQVGAGEAKVKNVSKPMRGFFSSVNVSPKKKLFEFRVQKDDDLLPVGSVFSPSYFT
FT                   VGQLVDVTGMTIGKGFSGAMKRHNFGGLRATHGVSISHRSHGSTGCRQDPGRVFKNKKM
FT                   AGRMGGNRVTVKNLEVVSVDDKRGLILVKGCVPGAKKNSWILVRDSFKSAVNCKGKVS"
FT   gene            complement(143076..143390)
FT                   /gene="rpsJ"
FT                   /locus_tag="CLIBASIA_00735"
FT   CDS_pept        complement(143076..143390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="CLIBASIA_00735"
FT                   /product="30S ribosomal protein S10"
FT                   /note="COG0051 Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56735"
FT                   /db_xref="GOA:C6XHJ2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ2"
FT                   /protein_id="ACT56735.1"
FT                   /translation="MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFP
FT                   RSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
FT                   "
FT   gene            complement(143477..144655)
FT                   /locus_tag="CLIBASIA_00740"
FT   CDS_pept        complement(143477..144655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00740"
FT                   /product="translation elongation factor Tu"
FT                   /note="COG0050 GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56736"
FT                   /db_xref="GOA:C6XH78"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH78"
FT                   /protein_id="ACT56736.1"
FT                   /translation="MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD
FT                   IDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAA
FT                   EDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT
FT                   PIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRG
FT                   TVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVN
FT                   RADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRI
FT                   ILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE"
FT   gene            complement(144746..146851)
FT                   /gene="fusA"
FT                   /locus_tag="CLIBASIA_00745"
FT   CDS_pept        complement(144746..146851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CLIBASIA_00745"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56737"
FT                   /db_xref="GOA:C6XHJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ4"
FT                   /protein_id="ACT56737.1"
FT                   /translation="MARKCKIEDSRNFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHD
FT                   GSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHVDFTMEVERSIRVT
FT                   DGAIALLDSNAGVEPQTETVWRQADKYSVPRVIFCNKMDKMGADFYRSVEMISSRLGAN
FT                   PLVIQLPVGSESNFQGVIDLVEMKALLWKNEDLGSSWDVVEIPEDMKDSANSYRDKMIE
FT                   SIVELDDSAMDSYLQGESFSSDRIRSLIRLGTISVKFFPVLCGSSFKNKGVQPLLDAVV
FT                   DYLPSPLDVRAIKGVDVKSNSEIDVSAVDSSPLSMLAFKVMADSFVGSLTFCRIYSGKI
FT                   SKGDSLLNTVKGKKERVGRMLQMHSNSREDIDEAYCGDIIALAGLKETTTGDTLCDPSR
FT                   PIVLERMDFPEPVIQIAIEPKSKGDQERMSLALSRLVAEDPSLRVSMDPNSGQTNLSGM
FT                   GELHLEIIVDRMLREFKVDANVGAPYVSYRESVTKSCVHDYIHKKQSGGAGQFAKVKIA
FT                   FEPNPDGDDFVFESKIVGGAIPKEYIPGVRKGIESMLSSGPLAGFPMLGMKVTLLDGDY
FT                   HDVDSSVLAFEIAARACFREAASKMGVQLLEPLMKVEVTVPAEYVGDVIGDLSSRRGQI
FT                   QGQENRSVYVVIDAHVPLSCMFKYVDSLRSMSQGRGQYTMIFDHYAPVPAHVSKEIQEK
FT                   YSVVKSA"
FT   gene            complement(146876..147346)
FT                   /gene="rpsG"
FT                   /locus_tag="CLIBASIA_00750"
FT   CDS_pept        complement(146876..147346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CLIBASIA_00750"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56738"
FT                   /db_xref="GOA:C6XHJ5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ5"
FT                   /protein_id="ACT56738.1"
FT                   /translation="MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYG
FT                   AFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWL
FT                   IMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW"
FT   gene            complement(147423..147797)
FT                   /gene="rpsL"
FT                   /locus_tag="CLIBASIA_00755"
FT   CDS_pept        complement(147423..147797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CLIBASIA_00755"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56739"
FT                   /db_xref="GOA:C6XHJ6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ6"
FT                   /protein_id="ACT56739.1"
FT                   /translation="MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKK
FT                   PNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLD
FT                   AQGVKNRKQARSRYGAERPK"
FT   gene            148507..149022
FT                   /gene="accB"
FT                   /locus_tag="CLIBASIA_00760"
FT   CDS_pept        148507..149022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="CLIBASIA_00760"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0511 Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56740"
FT                   /db_xref="GOA:C6XHJ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ7"
FT                   /protein_id="ACT56740.1"
FT                   /translation="MTDKKQKINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQK
FT                   DTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPDNYHTVTSPMVGTAYLAS
FT                   SPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLV
FT                   LEKTGDNK"
FT   gene            149019..150350
FT                   /locus_tag="CLIBASIA_00765"
FT   CDS_pept        149019..150350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00765"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56741"
FT                   /db_xref="GOA:C6XHJ8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ8"
FT                   /protein_id="ACT56741.1"
FT                   /translation="MISKILIANRGEIALRILRACKELGIPTVAVHSTADSGAMHVRLA
FT                   DESVCIGPPSSKDSYLNIQQIVAACEVTGADAIHPGYGFLSENAKFAEILEDHHIKFIG
FT                   PSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASAGGGG
FT                   RGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIFGDGMGNAIHF
FT                   GERDCSVQRRNQKIWEEAHSPVISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQF
FT                   YFIEMNTRLQVEHPVTEAITGIDLVHEQIYVASENRLSVQQKDITFSGHAIECRINAED
FT                   PENFIPNPGEITYFHAPGGLGIRMDSASYQGYTVPSYYDSLIAKLIVHGKNRKECMMRL
FT                   NRALNEIIIDGIKTTIPLFQKLIKNEDIIEGNYDIHWLENKYLK"
FT   gene            150442..150981
FT                   /gene="aat"
FT                   /locus_tag="CLIBASIA_00770"
FT   CDS_pept        150442..150981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="CLIBASIA_00770"
FT                   /product="leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="COG2360 Leu/Phe-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56742"
FT                   /db_xref="GOA:C6XHJ9"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHJ9"
FT                   /protein_id="ACT56742.1"
FT                   /translation="MADSANSQDISWIKPLRRGIIPLETFHTPKRLKKYIRRELYDIRI
FT                   NTAFESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVS
FT                   LGAVFFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQFITNHLRQFGAIEITHVQY
FT                   AKLLENALKHPEISFL"
FT   gene            complement(151069..153531)
FT                   /gene="lon"
FT                   /locus_tag="CLIBASIA_00775"
FT   CDS_pept        complement(151069..153531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="CLIBASIA_00775"
FT                   /product="ATP-dependent protease La"
FT                   /note="COG0466 ATP-dependent Lon protease, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56743"
FT                   /db_xref="GOA:C6XHK0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK0"
FT                   /protein_id="ACT56743.1"
FT                   /translation="MNQSDEKREYVTCEDESKDRCGADGIIYPLLPLRDIVVFPYMIVP
FT                   LFVGREKSVRALDEAMNSHKKIILVTQMNSNDENPIASSVYRIGTIVDIVQILRLPDGT
FT                   VKILVEGSVRARIVEYIEREDFLEAITQVLPDPTEDPVELEALSRSVIAEFSNYIKLNK
FT                   KISPEVIGITSQIEGFSKLADVIAANLSIKVAERQKILEAVSVKERLEMLLVFMESEIS
FT                   VLQVEKRIRSRVKRQMEKTQREYYLHEQMKAIQKELDNGEEGRDEISDFEARISKIRLS
FT                   KEAREKALSELQKLRQMNPLSAESSVVRNYLDWLLGVPWDKKSKTKKNLDFAIRILDQD
FT                   HFGLEKVKERIIEYLAVQMRVIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSL
FT                   GGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNPLLLLDEIDKMGSDLRGDPSAALL
FT                   EVLDPAQNSSFVDHYLEVEYDLSDVMFIMTANTLNIPLPLMDRMEIIRIAGYTEEEKLQ
FT                   IAKNHLVKKVLTEHALKQEECCISDGVLLDIIRLFTHEAGVRSFERALMKIARKAVTKI
FT                   VKNSDTTVSINENNLQDYLGVPRYKYGKIEGEDQVGIVTGLAWTEVGGEILTVEGVIMP
FT                   GKGEITITGNLKEIMKESILAASSYVRSKATTFGIIPSAFNEINIHVHVPEGATPKDGP
FT                   SAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGGLKEKLLAALRAGVTKVLIP
FT                   EENIKDLMDIPENVKNGLEIIPVSFMGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVG
FT                   KDGRSVAH"
FT   gene            complement(153788..155062)
FT                   /gene="clpX"
FT                   /locus_tag="CLIBASIA_00780"
FT   CDS_pept        complement(153788..155062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="CLIBASIA_00780"
FT                   /product="ATP-dependent protease ATP-binding subunit ClpX"
FT                   /note="COG1219 ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56744"
FT                   /db_xref="GOA:C6XHK1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK1"
FT                   /protein_id="ACT56744.1"
FT                   /translation="MSKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVEL
FT                   CMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSS
FT                   KSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENII
FT                   LKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIAS
FT                   VPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRP
FT                   VGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLF
FT                   DMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISD
FT                   DVVKGKACPLNVYTDRRDEKANVSA"
FT   gene            complement(155338..155988)
FT                   /gene="clpP"
FT                   /locus_tag="CLIBASIA_00785"
FT   CDS_pept        complement(155338..155988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="CLIBASIA_00785"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56745"
FT                   /db_xref="GOA:C6XHK2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK2"
FT                   /protein_id="ACT56745.1"
FT                   /translation="MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIV
FT                   FVTGQIEDHMATLICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPIS
FT                   TFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKR
FT                   RLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK"
FT   gene            complement(156624..158243)
FT                   /locus_tag="CLIBASIA_00790"
FT   CDS_pept        complement(156624..158243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00790"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56746"
FT                   /db_xref="GOA:C6XHK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK3"
FT                   /protein_id="ACT56746.1"
FT                   /translation="MARKFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGK
FT                   STILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRY
FT                   NELMMNYSEKTEEEIAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKR
FT                   RVALCKLLLSSPDLLLLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNW
FT                   ILEVDRGKGIPYQGNYSAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKS
FT                   KARIRSYEELVESAAHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKL
FT                   PPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVW
FT                   EDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGN
FT                   VILLDEPTNDLDTETLSALEDALENFAGCAVIISHDRMFLDRLATHILAFEGNGHVEWF
FT                   EGNFEEYEKDKLSRSSRVLSGA"
FT   gene            158391..159344
FT                   /locus_tag="CLIBASIA_00795"
FT   CDS_pept        158391..159344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00795"
FT                   /product="lysophospholipase protein"
FT                   /note="COG2267 Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56747"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK4"
FT                   /protein_id="ACT56747.1"
FT                   /translation="MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYN
FT                   DFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNT
FT                   SVLLFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSD
FT                   TPSRLMRHLTTDLWNRNNQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDI
FT                   SSRGSFNPLSRFIPFCLIGGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHS
FT                   NDPHNVFPPPAIKKLRNWIVNSYLPKVIPLISQHKK"
FT   gene            159622..159697
FT                   /locus_tag="CLIBASIA_t05699"
FT   tRNA            159622..159697
FT                   /locus_tag="CLIBASIA_t05699"
FT                   /product="tRNA-Lys"
FT   gene            complement(159969..160448)
FT                   /gene="smpB"
FT                   /locus_tag="CLIBASIA_00800"
FT   CDS_pept        complement(159969..160448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="CLIBASIA_00800"
FT                   /product="SsrA-binding protein"
FT                   /note="COG0691 tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56748"
FT                   /db_xref="GOA:C6XHK5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK5"
FT                   /protein_id="ACT56748.1"
FT                   /translation="MSLKSRGNPPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLR
FT                   VSKVNISDSYATFENDEIWLTNSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVR
FT                   RDGMTLVPMKIYFNAKGLAKIDLALAQGKKNYDKRETEKKRDWDRQKHRILREHN"
FT   gene            complement(160523..161401)
FT                   /locus_tag="CLIBASIA_00805"
FT   CDS_pept        complement(160523..161401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00805"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56749"
FT                   /db_xref="GOA:C6XHK6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK6"
FT                   /protein_id="ACT56749.1"
FT                   /translation="MFRGSIPALITPFTKGNLIDEDAFVEHIEWQITEGSGGLVPAGTT
FT                   GESSTLSHEEHCRIIELCVKTVASRVPVMAGIGSNNTRESVELAQYAHSIGADALLVVI
FT                   PYYNKPNRRGLLAHFGEIATTVSSPIYIYNNPSRTVIEMDVDTMAELAATYPNIVGVKD
FT                   ATGKIELVSEQRLSCGFDFIQLSGEDSSALGFNAHGGVGCISVTANVVPRICAEFQQAM
FT                   IRGDYRQALLYQDKLMPLHQALFMEPAVCCVKYALSRLGRNVSLAVRSPMVSTLEKDTM
FT                   IAIDQALERLG"
FT   gene            161960..164890
FT                   /locus_tag="CLIBASIA_00810"
FT   CDS_pept        161960..164890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00810"
FT                   /product="DNA polymerase I"
FT                   /note="COG0258 5'-3' exonuclease (including N-terminal
FT                   domain of PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56750"
FT                   /db_xref="GOA:C6XHK7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK7"
FT                   /protein_id="ACT56750.1"
FT                   /translation="MQKENHLFLVDGSSFIYRAFYATPLLSRKHDGLPVNAIAGFCNML
FT                   WKLLQNSRKESIASHFAVIFDYPAVTFRNEIYPDYKANRPKIPEMLLPQLPLVRLATQA
FT                   FGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKEEKI
FT                   DIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENILINAS
FT                   RIKQKKRRENILEYAETARLSRKLVMLRTDVPITIPLEHLILEDCNGPRLISFLKALEF
FT                   TKLINRVATTYDCDAANIEPVVLDINTTENKGIAIETEIDRDTTIKTSQFSSLSDQTSK
FT                   INSEQTPQKLFLERLQKLSQYPINNDSYTKIVNTKDIQQWVQKLETIGSASFKIITDTM
FT                   DAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFE
FT                   NEHFLKIGHNIKYDKLVLHRYGISMRGFEDIMLMSYVLDSGRSSHDIASIAQKWLSYTR
FT                   KEILKSRKSSIPIDKISDSQVQEHAIENSNVILQLWLLLRPKLIVEKLLHVYERLDKPM
FT                   IDVVSQMEITGIQIDQDLLKQVSAEISKNLLSLEENIYDLSGEKFNLSSPKQLGDILFT
FT                   KLKFPSGAKTKTGQWKTTAQDLEQINCGDNPIIKNILEWRQLSKIKSTYADSLPNHINK
FT                   RTQRVHTFYSLASTMTGRLASLEPNLQNIPIKTDLGQKIRRAFISPPTKKLISADYSQI
FT                   ELRILAHIAKITPLYQVFENSLDIHRMVAAEIFGVNIEKVSPQMRRHAKTINFSIIYGI
FT                   SPFRLATQLRIPRSEAADYIKRYFHRFPGIHEYIEKTKNFVRQNGYVETIFGRRIHYDE
FT                   INSPKSSIRNINERAAINAPIQGSAADITRRAMISVHKSLEDHKLATKMLLQIHDELVF
FT                   EVPEEEITTASQIIVHSMEKACLPKINLRVPLKVNIKVSNNWQEEN"
FT   gene            complement(164941..165579)
FT                   /locus_tag="CLIBASIA_00815"
FT   CDS_pept        complement(164941..165579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00815"
FT                   /product="phosphoglyceromutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG0588 Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56751"
FT                   /db_xref="GOA:C6XHK8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK8"
FT                   /protein_id="ACT56751.1"
FT                   /translation="MNRRLVLVRHGQSEWNIKNLFTGLRNPPLTSIGMSEANEIGKLLA
FT                   KQGMVFDAAFSSSLKRAQDTCQIILQEINQQHITPIYDDALNERDYGHIAGMNKDDVCN
FT                   KWGAEQVHLWRRSYSVAPPGGESLRDTVARVLAYYVQFILPLILQNKSILVVAHGNSLR
FT                   SLIMVLEKITVDDIPKVTIGTGEAFVYQLGADASIVSKNIMRGQSPAEK"
FT   gene            complement(165572..166414)
FT                   /locus_tag="CLIBASIA_00820"
FT   CDS_pept        complement(165572..166414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00820"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56752"
FT                   /db_xref="GOA:C6XHK9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHK9"
FT                   /protein_id="ACT56752.1"
FT                   /translation="MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIG
FT                   QDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTG
FT                   FSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRR
FT                   KLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHS
FT                   VVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE"
FT   gene            complement(166467..167513)
FT                   /gene="glk"
FT                   /locus_tag="CLIBASIA_00825"
FT   CDS_pept        complement(166467..167513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="CLIBASIA_00825"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="COG0837 Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56753"
FT                   /db_xref="GOA:C6XHL0"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL0"
FT                   /protein_id="ACT56753.1"
FT                   /translation="MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQT
FT                   SDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQF
FT                   EDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAK
FT                   DSWIPISCEGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIAD
FT                   GFESNKVLSSKDIVSKSEDPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYK
FT                   IIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEG
FT                   IKRRWFKD"
FT   gene            complement(168162..168767)
FT                   /locus_tag="CLIBASIA_00830"
FT   CDS_pept        complement(168162..168767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00830"
FT                   /product="cytochrome-c oxidase assembly factor protein"
FT                   /note="COG1999 Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56754"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL1"
FT                   /protein_id="ACT56754.1"
FT                   /translation="MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQD
FT                   GTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKR
FT                   DTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTA
FT                   LLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK"
FT   gene            complement(169094..169993)
FT                   /locus_tag="CLIBASIA_00835"
FT   CDS_pept        complement(169094..169993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00835"
FT                   /product="putative transcription regulator protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56755"
FT                   /db_xref="GOA:C6XHL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL2"
FT                   /protein_id="ACT56755.1"
FT                   /translation="MSFDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEV
FT                   GIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQIELQESSVKPSGKLRIATTIDLG
FT                   QNLLQGNLKEFLLLYPDIQIQLILDNKDIDISMDYADCAIRLRKPIQSSSLIQRKLVTI
FT                   HMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISC
FT                   LQVNSYLSIMQYCVLGSGIALLPDYIVKDNPNLVRIMEDVITPSFTVYFCYPEALKNTG
FT                   KLKAFRNFIFLKARDWKF"
FT   gene            complement(170035..171000)
FT                   /locus_tag="CLIBASIA_00840"
FT   CDS_pept        complement(170035..171000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00840"
FT                   /product="thioredoxin reductase (NADPH) protein"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56756"
FT                   /db_xref="GOA:C6XHL3"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL3"
FT                   /protein_id="ACT56756.1"
FT                   /translation="MASHDSKILIIGSGPAGYTAAIYAARAMLKPVIIAGSDLGGQLMI
FT                   TESIENYPGFATSIRGDWLMEQMRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLW
FT                   HADAVVIATGSEVKWLRLESEKKFQGFGVSACATCDGFFYKNKDVIVVGGGNTAAEEAL
FT                   HLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVDVIGSIPEPPLFPSVS
FT                   GVRLHNKKEGNFFERNVDGIFIAIGYKPNTKIFRHQLKMTNTNYIWTMPDSTATSIPGI
FT                   FAAGDVADERYRQAITAAAMGCMAALEVEHYLSIHQSSIT"
FT   gene            complement(171395..173266)
FT                   /locus_tag="CLIBASIA_00845"
FT   CDS_pept        complement(171395..173266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56757"
FT                   /db_xref="GOA:C6XHL4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL4"
FT                   /protein_id="ACT56757.1"
FT                   /translation="MKNEKEFLDKRDASFRIGQFPSSIPSLDSSIKDYSRQLTNIFLKD
FT                   KVFFDGLEQELLASLGSMGQEKFVSYARKKRSQRSPEDQLPSSKHLSPRFGSAHENFFD
FT                   CDLENKPFPVETVVEKKENVDKSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLD
FT                   DDLDRCFEKKDRTSAIQLDKTEEILKGELTDKTDSSFSDSMAKYGTGMSSALEGKKENI
FT                   FLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLTESPKKRLGSHSAIDDDLGLDFG
FT                   DIEKELLSISGCANRESDSRDQEKKSSDIEKSESQGPVFDLKKIVRFEEYPKDMDELVI
FT                   SSLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINRDCSLGDD
FT                   VHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFWLIGYILIVVGCGIYWF
FT                   FQLHREISFANEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDRFSGEKPSSPKQ
FT                   KTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENEDRSRSESIIVE
FT                   KEIPQLSQQSSFLMDNKENFQGVDSLQINLSKLKGNIPVPRSYSNRS"
FT   gene            complement(173322..175082)
FT                   /gene="argS"
FT                   /locus_tag="CLIBASIA_00850"
FT   CDS_pept        complement(173322..175082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="CLIBASIA_00850"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018 Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56758"
FT                   /db_xref="GOA:C6XHL5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL5"
FT                   /protein_id="ACT56758.1"
FT                   /translation="MYLFADFSSRLKNYLKEIDCKIKVEKKILDRIVIERPRDCAHGHL
FT                   STNAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILSS
FT                   IVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTR
FT                   EYYINDAGAQINTLALSVFWRYQQALYNNDSDLPEGYYPGVYLKHVGKELADKYSSELL
FT                   NFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDDFHRGDPSPIRDIIDNLA
FT                   RQGYVYEGILPPPKSKTTQKCDMDRKQLLFRSTMVGDDVDRPLLKSDGSYTYFAADLAY
FT                   FKCKYERGFDNMIYVMGSDHSGYVKRLEAVAAAVSEKKAQINVLLCELVRLYRDGMPIK
FT                   MSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPVFYVQYAY
FT                   ARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQE
FT                   PYKLAFYLYDLASVFHGHWSHGRENPRLRFVQANNRKLTMMRLQLVHAVASIINSGLNI
FT                   IGVESPNEMS"
FT   gene            complement(175129..176361)
FT                   /locus_tag="CLIBASIA_00855"
FT   CDS_pept        complement(175129..176361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00855"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="COG0232 dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56759"
FT                   /db_xref="GOA:C6XHL6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL6"
FT                   /protein_id="ACT56759.1"
FT                   /translation="MIVVRKLGFGHQKKVAYAADPTQSLGRMYPEKRSLTRSEFQRDRD
FT                   RMIHTTAFRRLKDKTQVFFHRQRDHYRTRLMHTIEVSQIARSLARALRIDEDLVEAIAL
FT                   AHDFGHPPFGHVGEDVLQELLSSYGGFDHNIQSFRIVTELECSYADFDGINLTWETLEG
FT                   LIGHNGPILPQDLDKPRIIPRIFSDYYHIHGLSLANFASLEGQVAAIADDIAYDAHDID
FT                   DGVRAGLLTVDMLKEISFLEKHIASLHDLYGHLDDKRLVHELVRRQITAMVEDVITVSQ
FT                   KRIAHLKPHAIHDIRSAGYRIIDFSDEMTLVDKEIKSMLVKYVYRHPSIMTCCNQIANV
FT                   IRNLFSAYMSDPRKMRGCNQLEYERDMTDSIKARHVGDYLAGMTDSYAIREHHILFGYI
FT                   PDFAVDYSEFH"
FT   gene            176457..176786
FT                   /locus_tag="CLIBASIA_00860"
FT   CDS_pept        176457..176786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00860"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56760"
FT                   /db_xref="GOA:C6XHL7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL7"
FT                   /protein_id="ACT56760.1"
FT                   /translation="MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFD
FT                   LESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCG
FT                   TSFSI"
FT   gene            176801..177646
FT                   /gene="xthA"
FT                   /locus_tag="CLIBASIA_00865"
FT   CDS_pept        176801..177646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="CLIBASIA_00865"
FT                   /product="exodeoxyribonuclease III protein"
FT                   /note="COG0708 Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56761"
FT                   /db_xref="GOA:C6XHL8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL8"
FT                   /protein_id="ACT56761.1"
FT                   /translation="MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNF
FT                   PFETLQSLNYHIETCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ
FT                   TLRIGNLYLPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC
FT                   YNPIIWENDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIR
FT                   IDHIMLSPEATSLLHSARIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNMKPI
FT                   "
FT   gene            complement(177937..179985)
FT                   /gene="rpoD"
FT                   /locus_tag="CLIBASIA_00870"
FT   CDS_pept        complement(177937..179985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="CLIBASIA_00870"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56762"
FT                   /db_xref="GOA:C6XHL9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHL9"
FT                   /protein_id="ACT56762.1"
FT                   /translation="MTIGKKRNRDSDSEHEDSDDSLVFDFSDDSWKKMIKLARQRGYVT
FT                   IEELNAFLPPDEVSSEQMEDTVAMLSNMGINVVDGDDLEDEEGSEDSLDLASSASNSSV
FT                   FLQKRKDSADRSTDDPVRMYLREMGSIELLSREGEIAIAKRIEAGRAMMMASLCESPLT
FT                   FQALIIWRDELNDGTTLLREIIDLEACIGPESKGGFFHGTEGHSYQKREDSSQEKERDD
FT                   VQETEGDIESAAKVSKDDRSKVDSPPENAENDERNLDEDEDDSAHTLSAMEDQLRPKVM
FT                   CALDEIAEVYRELRSLQDNAVNGQKDEKSSVKCKVLKEKLVKLVGSLSLNQSRIDLLVE
FT                   QLYDISKRIMHNEGELLRLAQSYGIKRDVFLERHQGRELDPHWVSYAKDFPEGEWKNFV
FT                   ACEVDSILKIRNEIKSISVETGISISEFRHIVSMVRKGECEASIAKKEMVEANLRLVIS
FT                   VAKKYTNRGLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAMWWVKQAITRSIADQSC
FT                   TIRIPVHMRDKIHKVVRTARRMSNKIKREPTPEEIAKKLAMPVEGVRKVLKITKEPISL
FT                   ETPIGDEDTSHLGDFIEDKNAVSPLDSAIQANLRETTTRVLASLTPREERVLRMRFGIG
FT                   MNTDHTLEEVGKQFCVTRERIRQIEAKAIRKLKHPSRSKKLRSFLDG"
FT   gene            180474..181472
FT                   /locus_tag="CLIBASIA_00875"
FT   CDS_pept        180474..181472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00875"
FT                   /product="quinone oxidoreductase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56763"
FT                   /db_xref="GOA:C6XHM0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM0"
FT                   /protein_id="ACT56763.1"
FT                   /translation="MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGV
FT                   NRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYC
FT                   LSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAI
FT                   QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV
FT                   GAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQS
FT                   IRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP"
FT   gene            181640..183067
FT                   /locus_tag="CLIBASIA_00880"
FT   CDS_pept        181640..183067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56764"
FT                   /db_xref="GOA:C6XHM1"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM1"
FT                   /protein_id="ACT56764.1"
FT                   /translation="MSKTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILY
FT                   HRASIEASADEALNHGIVLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKE
FT                   SSINYQGKIPLSQGTYLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIA
FT                   VIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSSTTKELKRFYNIYSLKFPFF
FT                   RGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRY
FT                   RNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVPEHIS
FT                   KQDLPSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSK
FT                   ISTIFTTRFTSSPESYIKDSTGRPVRVYNINKNSKNEFILLEMTPHYINVTAYERRGKV
FT                   PHITRKMSPIDLLPKQR"
FT   gene            183368..183835
FT                   /gene="rplM"
FT                   /locus_tag="CLIBASIA_00885"
FT   CDS_pept        183368..183835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="CLIBASIA_00885"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56765"
FT                   /db_xref="GOA:C6XHM2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM2"
FT                   /protein_id="ACT56765.1"
FT                   /translation="MIPTFFQKSSEVEKKWILVDAKGLIVGRLASQIALRLRGKNKPTY
FT                   TPSADDGDHVVIINASKVAFSGKKYDQKTYYRHTGYPGGIKKTTAKEILAGASPTNILK
FT                   KAIARMLPRGPLARKQMKNLHIYAEDHHPHEAQKPVFMDIAKMNPKNSRRT"
FT   gene            183838..184350
FT                   /gene="rpsI"
FT                   /locus_tag="CLIBASIA_00890"
FT   CDS_pept        183838..184350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="CLIBASIA_00890"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56766"
FT                   /db_xref="GOA:C6XHM3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM3"
FT                   /protein_id="ACT56766.1"
FT                   /translation="MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQR
FT                   SYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVF
FT                   ATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARR
FT                   SFQFSKR"
FT   gene            184511..185446
FT                   /locus_tag="CLIBASIA_00895"
FT   CDS_pept        184511..185446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00895"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COG0002 Acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56767"
FT                   /db_xref="GOA:C6XHM4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM4"
FT                   /protein_id="ACT56767.1"
FT                   /translation="MYKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLRYRED
FT                   LLNAADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKE
FT                   KIRSARYITNPGCYATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQK
FT                   NMPDTISSNHFFYSLDLLHKHLPEITQYSLIKTSPMFLPSVGRFPQGIAIQISLDMERL
FT                   SWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHLFFFDSSELP
FT                   YINIIAVFDNLGKGASGAAIQNMDLLLSSL"
FT   gene            complement(185481..186224)
FT                   /gene="truA"
FT                   /locus_tag="CLIBASIA_00900"
FT   CDS_pept        complement(185481..186224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CLIBASIA_00900"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56768"
FT                   /db_xref="GOA:C6XHM5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM5"
FT                   /protein_id="ACT56768.1"
FT                   /translation="MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVV
FT                   HGAGRTDSGVHALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHAR
FT                   FSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHC
FT                   QASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKAL
FT                   QAQDRKECGPLAPPEGLYFDSVEYS"
FT   gene            complement(186224..187156)
FT                   /gene="fmt"
FT                   /locus_tag="CLIBASIA_00905"
FT   CDS_pept        complement(186224..187156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="CLIBASIA_00905"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56769"
FT                   /db_xref="GOA:C6XHM6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM6"
FT                   /protein_id="ACT56769.2"
FT                   /translation="MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLK
FT                   SVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLG
FT                   FYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINT
FT                   AGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENV
FT                   HNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRI
FT                   MRLQRAGGRVLDIGDFLLGCPVIIGCIVG"
FT   gene            complement(187187..187699)
FT                   /gene="def"
FT                   /locus_tag="CLIBASIA_00910"
FT   CDS_pept        complement(187187..187699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="CLIBASIA_00910"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56770"
FT                   /db_xref="GOA:C6XHM7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM7"
FT                   /protein_id="ACT56770.1"
FT                   /translation="MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGI
FT                   GLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADV
FT                   KRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMS
FT                   KLVQLRD"
FT   gene            188291..188647
FT                   /locus_tag="CLIBASIA_00915"
FT   CDS_pept        188291..188647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00915"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56771"
FT                   /db_xref="GOA:C6XHM8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM8"
FT                   /protein_id="ACT56771.1"
FT                   /translation="MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLF
FT                   WLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIM
FT                   FVMIGITLISFHTI"
FT   gene            complement(188764..190452)
FT                   /locus_tag="CLIBASIA_00920"
FT   CDS_pept        complement(188764..190452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00920"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56772"
FT                   /db_xref="GOA:C6XHM9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHM9"
FT                   /protein_id="ACT56772.1"
FT                   /translation="MTLREIYRRLAMNQVHQPSDSLFALNQPPLFIGMNAYSSDSLLVA
FT                   LIANFPSVVHKELELLGEYVLSCTAQELARMANYNTPQLHAYGPGGERWDKVEFHPAWH
FT                   ALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVA
FT                   LMTTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIAAITSQGQKIS
FT                   DGIYCLSGHKWFLSSPMSDAFIMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLKNKIGN
FT                   RSNATVELEFSNTFGFLLGDLNVSTGPVEDMKILIYLDSAIMSVSGMRVSLAEAIHYAR
FT                   RRHVSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRSEEAAYARIMAPI
FT                   TKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSGNAMVLDVLNLL
FT                   EKGTNLFEQLFSTLEQDLGSSGKKVITILRDSISLCKEDKGLARFLTEKIALASSAAAL
FT                   YRAGMNDIADVFLENRFLDNCHSTHCMLHGRFNAAHIIDSLYLDC"
FT   gene            190645..191595
FT                   /gene="pyrB"
FT                   /locus_tag="CLIBASIA_00925"
FT   CDS_pept        190645..191595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="CLIBASIA_00925"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /EC_number="2.1.3.2"
FT                   /note="COG0540 Aspartate carbamoyltransferase, catalytic
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56773"
FT                   /db_xref="GOA:C6XHN0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN0"
FT                   /protein_id="ACT56773.1"
FT                   /translation="MYSFPLYNFVTVKDLSMQDVNYLLDRANEYFQKKSHFNPSTTRLQ
FT                   GLTQINLFLETSTRTQTSFEVAGKLLGVHVININTKNSAMKKGENIADTIATLNALRPN
FT                   IIVIRHPYSGAVNSLMHKIKGPSIINAGDGTHEHPSQALLDAFAIRHFKGKISNLHIAI
FT                   CGDILHSRVARSDIMLLNTMGARIRVIAPITLLPKDISNMGVEVFHDMQKGLKNVDVIM
FT                   ILRMQQERIPRSLIPSIREYKHVYSLDEKKLKYAKKDALVMHPGPINRNYEISSSVADG
FT                   SQSIIQYQVEMGVAVRMAIIKELLENQNKITQKEL"
FT   gene            191592..192887
FT                   /locus_tag="CLIBASIA_00930"
FT   CDS_pept        191592..192887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00930"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56774"
FT                   /db_xref="GOA:C6XHN1"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN1"
FT                   /protein_id="ACT56774.1"
FT                   /translation="MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPT
FT                   SALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSF
FT                   LDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIH
FT                   DTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLAR
FT                   DLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLR
FT                   KVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSA
FT                   ALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMS
FT                   SIHKNTVFDKEFFTGKVVRTYISGKQVYTLES"
FT   gene            192895..193512
FT                   /locus_tag="CLIBASIA_00935"
FT   CDS_pept        192895..193512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00935"
FT                   /product="putative glycerol-3-phosphate acyltransferase
FT                   PlsY"
FT                   /note="COG0344 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56775"
FT                   /db_xref="GOA:C6XHN2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN2"
FT                   /protein_id="ACT56775.1"
FT                   /translation="MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSI
FT                   GSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIF
FT                   PVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMII
FT                   WITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK"
FT   gene            193546..193779
FT                   /locus_tag="CLIBASIA_00940"
FT   CDS_pept        193546..193779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00940"
FT                   /product="DNA protecting protein DprA"
FT                   /note="COG0758 Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56776"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN3"
FT                   /protein_id="ACT56776.1"
FT                   /translation="MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSA
FT                   EQALEMIPELAQRGAVYAGKRAFVQKNQQKKS"
FT   gene            194079..194183
FT                   /locus_tag="CLIBASIA_00945"
FT   CDS_pept        194079..194183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00945"
FT                   /product="DNA protecting protein DprA"
FT                   /note="COG0758 Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56777"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN4"
FT                   /protein_id="ACT56777.1"
FT                   /translation="[protein fragment, 34 aa]"
FT   gene            194424..194711
FT                   /locus_tag="CLIBASIA_00950"
FT   CDS_pept        194424..194711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56778"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN5"
FT                   /protein_id="ACT56778.1"
FT                   /translation="MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN
FT                   VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ"
FT   gene            194907..197420
FT                   /locus_tag="CLIBASIA_00955"
FT   CDS_pept        194907..197420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00955"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG0550 Topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56779"
FT                   /db_xref="GOA:C6XHN6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN6"
FT                   /protein_id="ACT56779.1"
FT                   /translation="MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPE
FT                   KEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEK
FT                   TKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGA
FT                   RSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKK
FT                   SISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTM
FT                   RIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYS
FT                   SKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTV
FT                   NIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATET
FT                   NASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTG
FT                   RIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLR
FT                   ISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKY
FT                   TRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWK
FT                   SDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTID
FT                   LEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLS
FT                   KEESPDTVDLEKALKILNIKKQKKL"
FT   gene            198265..199272
FT                   /gene="asd"
FT                   /locus_tag="CLIBASIA_00960"
FT   CDS_pept        198265..199272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="CLIBASIA_00960"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56780"
FT                   /db_xref="GOA:C6XHN7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN7"
FT                   /protein_id="ACT56780.1"
FT                   /translation="MTFKVAVVGATGNVGREMLNIICERGFPISEVVALASERSAGTKV
FT                   PFGKETIDVQDVKSYDFSDTDICLMSAGHAVSSQMSPKIAANGCIVIDNSSAWRYDSDV
FT                   PLIVPEVNPQTISLASRKNIIANPNCSTIQLVVALKPLHDLAMIKRVVVTTYQSVSGAG
FT                   KKGIDELLAQTKAFLAKKTIENRVFTKNIAFNVIPHIDVFMDGGSTKEEWKVLVETQKI
FT                   LDPNIKVSCTAARVPVFIGHAESVNIEFEKDISIKDAVAAINKSKGCIVVDKPDKNEYI
FT                   TPVESIRRDLVFVSRIRKDPTLKSGLNLWIVANNLRKGAALNAVQIAELVAQEA"
FT   gene            199329..200195
FT                   /locus_tag="CLIBASIA_00965"
FT   CDS_pept        199329..200195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00965"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase signal peptide protein"
FT                   /note="COG2951 Membrane-bound lytic murein transglycosylase
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56781"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN8"
FT                   /protein_id="ACT56781.1"
FT                   /translation="MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEW
FT                   KSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII
FT                   AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR
FT                   RAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV
FT                   KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP
FT                   IGKGYDT"
FT   gene            complement(200229..200408)
FT                   /locus_tag="CLIBASIA_00970"
FT   CDS_pept        complement(200229..200408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00970"
FT                   /product="comF family protein"
FT                   /note="COG1040 Predicted amidophosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56782"
FT                   /db_xref="GOA:C6XHN9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHN9"
FT                   /protein_id="ACT56782.1"
FT                   /translation="MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA
FT                   MTVSILTFSRSLKD"
FT   gene            complement(200604..200963)
FT                   /locus_tag="CLIBASIA_00975"
FT   CDS_pept        complement(200604..200963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56783"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP0"
FT                   /protein_id="ACT56783.1"
FT                   /translation="MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKI
FT                   HFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDL
FT                   AIMMAQWMFRVLEKI"
FT   gene            201151..201235
FT                   /locus_tag="CLIBASIA_t05701"
FT   tRNA            201151..201235
FT                   /locus_tag="CLIBASIA_t05701"
FT                   /product="tRNA-Leu"
FT   gene            complement(201484..202017)
FT                   /locus_tag="CLIBASIA_00980"
FT   CDS_pept        complement(201484..202017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00980"
FT                   /product="hypothetical protein"
FT                   /note="COG0678 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56784"
FT                   /db_xref="GOA:C6XHP1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP1"
FT                   /protein_id="ACT56784.1"
FT                   /translation="MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLF
FT                   ALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLL
FT                   PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEIS
FT                   SPENVLKVIRESKK"
FT   gene            202550..202918
FT                   /locus_tag="CLIBASIA_00985"
FT   CDS_pept        202550..202918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00985"
FT                   /product="response regulator receiver protein"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56785"
FT                   /db_xref="GOA:C6XHP2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP2"
FT                   /protein_id="ACT56785.1"
FT                   /translation="MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREE
FT                   PFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKP
FT                   FHLRDLVNEVNRLLTIKN"
FT   gene            202993..203067
FT                   /locus_tag="CLIBASIA_t05703"
FT   tRNA            202993..203067
FT                   /locus_tag="CLIBASIA_t05703"
FT                   /product="tRNA-Val"
FT   gene            complement(204153..204836)
FT                   /locus_tag="CLIBASIA_00990"
FT   CDS_pept        complement(204153..204836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00990"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="COG0293 23S rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56786"
FT                   /db_xref="GOA:C6XHP3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP3"
FT                   /protein_id="ACT56786.1"
FT                   /translation="MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLE
FT                   GWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDIL
FT                   DMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCE
FT                   AATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLA
FT                   KGFRK"
FT   gene            205134..205207
FT                   /locus_tag="CLIBASIA_t05705"
FT   tRNA            205134..205207
FT                   /locus_tag="CLIBASIA_t05705"
FT                   /product="tRNA-Gln"
FT   gene            complement(205404..206459)
FT                   /locus_tag="CLIBASIA_00995"
FT   CDS_pept        complement(205404..206459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_00995"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56787"
FT                   /db_xref="GOA:C6XHP4"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP4"
FT                   /protein_id="ACT56787.1"
FT                   /translation="MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGK
FT                   VGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAK
FT                   LKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYS
FT                   PTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRS
FT                   TVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVA
FT                   KSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKG
FT                   VDLSVGLKKSF"
FT   gene            complement(206780..206917)
FT                   /locus_tag="CLIBASIA_01000"
FT   CDS_pept        complement(206780..206917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56788"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP5"
FT                   /protein_id="ACT56788.1"
FT                   /translation="MRSIWELSLGGSPCLMFFLLRSFLKDQIVFFKLKFLRFDLYFLGK
FT                   "
FT   gene            complement(207009..209426)
FT                   /gene="pheT"
FT                   /locus_tag="CLIBASIA_01005"
FT   CDS_pept        complement(207009..209426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="CLIBASIA_01005"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56789"
FT                   /db_xref="GOA:C6XHP6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP6"
FT                   /protein_id="ACT56789.1"
FT                   /translation="MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFT
FT                   IVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIV
FT                   NVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTP
FT                   NRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCV
FT                   KGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRA
FT                   CSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDP
FT                   INIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITY
FT                   KPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKAD
FT                   LVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFIS
FT                   KEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVY
FT                   ENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSL
FT                   DSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSI
FT                   PISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVF
FT                   QGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS"
FT   gene            complement(209439..210539)
FT                   /gene="pheS"
FT                   /locus_tag="CLIBASIA_01010"
FT   CDS_pept        complement(209439..210539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="CLIBASIA_01010"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="COG0016 Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56790"
FT                   /db_xref="GOA:C6XHP7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP7"
FT                   /protein_id="ACT56790.1"
FT                   /translation="MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSI
FT                   SSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLP
FT                   VFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQM
FT                   HDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQ
FT                   IEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDG
FT                   IIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREF
FT                   FGADVRWIEHYGFSPLDIPPLFSRLA"
FT   gene            complement(210758..211129)
FT                   /gene="rplT"
FT                   /locus_tag="CLIBASIA_01015"
FT   CDS_pept        complement(210758..211129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="CLIBASIA_01015"
FT                   /product="ribosomal protein L20"
FT                   /note="COG0292 Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56791"
FT                   /db_xref="GOA:C6XHP8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP8"
FT                   /protein_id="ACT56791.1"
FT                   /translation="MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQY
FT                   AYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD
FT                   SFKKIVELSRSRLLVDVAS"
FT   gene            complement(211174..211377)
FT                   /gene="rpmI"
FT                   /locus_tag="CLIBASIA_01020"
FT   CDS_pept        complement(211174..211377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="CLIBASIA_01020"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG0291 Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56792"
FT                   /db_xref="GOA:C6XHP9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHP9"
FT                   /protein_id="ACT56792.1"
FT                   /translation="MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNAR
FT                   GTMVLASADAKKVIRNYLPNGI"
FT   gene            complement(211525..211935)
FT                   /gene="infC"
FT                   /locus_tag="CLIBASIA_01025"
FT   CDS_pept        complement(211525..211935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="CLIBASIA_01025"
FT                   /product="translation initiation factor IF-3"
FT                   /note="COG0290 Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56793"
FT                   /db_xref="GOA:C6XHQ0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ0"
FT                   /protein_id="ACT56793.1"
FT                   /translation="MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKK
FT                   QKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLS
FT                   NIKERFGEISRIDCEPKFEGRQMIMILSSKCV"
FT   gene            212344..214164
FT                   /gene="lepA"
FT                   /locus_tag="CLIBASIA_01030"
FT   CDS_pept        212344..214164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="CLIBASIA_01030"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56794"
FT                   /db_xref="GOA:C6XHQ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ1"
FT                   /protein_id="ACT56794.1"
FT                   /translation="MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS
FT                   QVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEG
FT                   SLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE
FT                   DALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRII
FT                   NGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGD
FT                   TITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENS
FT                   TALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDM
FT                   PEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNE
FT                   VIFDFYDRLKSVSKGYASFDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRG
FT                   RGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEK
FT                   QKEGKKRMRRFGRVDIPQSAFISILKTDNE"
FT   gene            214734..215555
FT                   /locus_tag="CLIBASIA_01035"
FT   CDS_pept        214734..215555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01035"
FT                   /product="SAM-dependent methyltransferase protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56795"
FT                   /db_xref="GOA:C6XHQ2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ2"
FT                   /protein_id="ACT56795.1"
FT                   /translation="MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQ
FT                   TFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSV
FT                   DLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGG
FT                   ASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRR
FT                   SKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE"
FT   gene            complement(215813..217288)
FT                   /locus_tag="CLIBASIA_01040"
FT   CDS_pept        complement(215813..217288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01040"
FT                   /product="ATP/ADP translocase"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56796"
FT                   /db_xref="GOA:C6XHQ3"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ3"
FT                   /protein_id="ACT56796.1"
FT                   /translation="MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFST
FT                   LRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVS
FT                   FFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVM
FT                   INLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTL
FT                   ILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLL
FT                   VICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFR
FT                   WFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKAT
FT                   KYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSI
FT                   VPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE"
FT   gene            complement(217926..218111)
FT                   /locus_tag="CLIBASIA_01045"
FT   CDS_pept        complement(217926..218111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56797"
FT                   /db_xref="GOA:C6XHQ4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ4"
FT                   /protein_id="ACT56797.1"
FT                   /translation="MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRI
FT                   VDYVDQKHDLYHDYRR"
FT   gene            complement(218229..218654)
FT                   /gene="mutT"
FT                   /locus_tag="CLIBASIA_01050"
FT   CDS_pept        complement(218229..218654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="CLIBASIA_01050"
FT                   /product="mutator MutT protein"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56798"
FT                   /db_xref="GOA:C6XHQ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ5"
FT                   /protein_id="ACT56798.1"
FT                   /translation="MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGK
FT                   IEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQS
FT                   CEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM"
FT   gene            complement(218787..220037)
FT                   /gene="argJ"
FT                   /locus_tag="CLIBASIA_01055"
FT   CDS_pept        complement(218787..220037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="CLIBASIA_01055"
FT                   /product="bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56799"
FT                   /db_xref="GOA:C6XHQ6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ6"
FT                   /protein_id="ACT56799.1"
FT                   /translation="MLPISCLPFMLQSHVSPVLLPIKGVRLSAAALGIKYVGRDDVFLM
FT                   VFDNPASVAGVFTRSSCPSAPVDFCKGNLSHGIARALIVNSGIANAFTGKRGRDTVRFI
FT                   AKAVSELIPCKEEEVYVASTGIIGEFLDVALFDGVLSKMLCDATDDAWLDSAKAMMTTD
FT                   RYAKVAVRTVDIDGIRVTINGLAKGAGMIAPDMATTLAFVVTDINISPAVLQNILSEGA
FT                   EYSFNSITVDGDTSTSDTLLLFATGTVLGNFAPITDVSDKRLSLFRPALFDLLKDLALQ
FT                   VVCDGEGASKLLEVTVKGAADCASAKKVALSIANSPLVKTAFASESFGWWGRIVMAVGK
FT                   SGVLVDRDRLSVWFGDVRIANNGEPEINFSQESVRSIVKKKCVPITVDLQIGNGIHTVW
FT                   TCDFSKEYIHFNSNVQS"
FT   gene            220345..223017
FT                   /gene="secA"
FT                   /locus_tag="CLIBASIA_01060"
FT   CDS_pept        220345..223017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="CLIBASIA_01060"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="COG0653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56800"
FT                   /db_xref="GOA:C6XHQ7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ7"
FT                   /protein_id="ACT56800.1"
FT                   /translation="MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDS
FT                   LANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAE
FT                   MKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHD
FT                   LSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEA
FT                   RTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGEN
FT                   LLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYS
FT                   DGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDV
FT                   IEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQ
FT                   LRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHE
FT                   LANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQG
FT                   DPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARN
FT                   FETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSY
FT                   PEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTE
FT                   KMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLT
FT                   HLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRN
FT                   HPCPCGSGKKYKHCHGSYL"
FT   gene            223175..224176
FT                   /locus_tag="CLIBASIA_01065"
FT   CDS_pept        223175..224176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01065"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="COG1087 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56801"
FT                   /db_xref="GOA:C6XHQ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ8"
FT                   /protein_id="ACT56801.1"
FT                   /translation="MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVL
FT                   WGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIA
FT                   TAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGL
FT                   RSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCL
FT                   RDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYE
FT                   SRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE"
FT   gene            224635..225042
FT                   /gene="rpsF"
FT                   /locus_tag="CLIBASIA_01070"
FT   CDS_pept        224635..225042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="CLIBASIA_01070"
FT                   /product="30S ribosomal protein S6"
FT                   /note="COG0360 Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56802"
FT                   /db_xref="GOA:C6XHQ9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHQ9"
FT                   /protein_id="ACT56802.1"
FT                   /translation="MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGM
FT                   RTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI
FT                   QRHDRDDRNDRFPRDRNVDRKQHVSEEKPLS"
FT   gene            225055..225306
FT                   /gene="rpsR"
FT                   /locus_tag="CLIBASIA_01075"
FT   CDS_pept        225055..225306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="CLIBASIA_01075"
FT                   /product="30S ribosomal protein S18"
FT                   /note="COG0238 Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56803"
FT                   /db_xref="GOA:C6XHR0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR0"
FT                   /protein_id="ACT56803.1"
FT                   /translation="MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQ
FT                   RGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL"
FT   gene            225696..226235
FT                   /gene="rplI"
FT                   /locus_tag="CLIBASIA_01080"
FT   CDS_pept        225696..226235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="CLIBASIA_01080"
FT                   /product="50S ribosomal protein L9"
FT                   /note="COG0359 Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56804"
FT                   /db_xref="GOA:C6XHR1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR1"
FT                   /protein_id="ACT56804.1"
FT                   /translation="MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLP
FT                   KKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYG
FT                   SVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEE
FT                   MVKQDILGEHEEEILS"
FT   gene            226455..227969
FT                   /gene="dnaB"
FT                   /locus_tag="CLIBASIA_01085"
FT   CDS_pept        226455..227969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="CLIBASIA_01085"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305 Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56805"
FT                   /db_xref="GOA:C6XHR2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR2"
FT                   /protein_id="ACT56805.1"
FT                   /translation="MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFY
FT                   RVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLAR
FT                   LASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLF
FT                   HLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLI
FT                   IIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRI
FT                   ISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKR
FT                   QRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVEN
FT                   RDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVK
FT                   GIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA"
FT   gene            228006..229118
FT                   /locus_tag="CLIBASIA_01090"
FT   CDS_pept        228006..229118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01090"
FT                   /product="alanine racemase"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56806"
FT                   /db_xref="GOA:C6XHR3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR3"
FT                   /protein_id="ACT56806.1"
FT                   /translation="MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGC
FT                   EKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVIS
FT                   SVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISH
FT                   LACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG
FT                   TDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPL
FT                   TLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD
FT                   IKLDDVALASGTTNYDLLVRIGTRYAKFYT"
FT   gene            229184..230623
FT                   /locus_tag="CLIBASIA_01095"
FT   CDS_pept        229184..230623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01095"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56807"
FT                   /db_xref="GOA:C6XHR4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR4"
FT                   /protein_id="ACT56807.1"
FT                   /translation="MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQR
FT                   FSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKS
FT                   TLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLI
FT                   TNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEG
FT                   QIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVS
FT                   DPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAM
FT                   ILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGE
FT                   VSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKIT
FT                   ALQKKDKKTVHKTRSLNSPWE"
FT   gene            230614..231084
FT                   /locus_tag="CLIBASIA_01100"
FT   CDS_pept        230614..231084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01100"
FT                   /product="colicin V production protein"
FT                   /note="COG1286 Uncharacterized membrane protein, required
FT                   for colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56808"
FT                   /db_xref="GOA:C6XHR5"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR5"
FT                   /protein_id="ACT56808.1"
FT                   /translation="MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRY
FT                   LYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGC
FT                   AFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ"
FT   gene            231334..232800
FT                   /locus_tag="CLIBASIA_01105"
FT   CDS_pept        231334..232800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01105"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56809"
FT                   /db_xref="GOA:C6XHR6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR6"
FT                   /protein_id="ACT56809.1"
FT                   /translation="MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEAT
FT                   GIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFA
FT                   DLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFID
FT                   SLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRD
FT                   VENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNM
FT                   GKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIR
FT                   AFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLY
FT                   PDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFA
FT                   DHCFTGDYPTPLVDKQSQHNDEELSLIISS"
FT   gene            232797..233570
FT                   /locus_tag="CLIBASIA_01110"
FT   CDS_pept        232797..233570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01110"
FT                   /product="oxidoreductase protein"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56810"
FT                   /db_xref="GOA:C6XHR7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR7"
FT                   /protein_id="ACT56810.1"
FT                   /translation="MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYV
FT                   IACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAG
FT                   ILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP
FT                   LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQ
FT                   KVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN"
FT   gene            complement(233782..234171)
FT                   /locus_tag="CLIBASIA_01115"
FT   CDS_pept        complement(233782..234171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01115"
FT                   /product="hypothetical protein"
FT                   /note="COG1495 Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56811"
FT                   /db_xref="GOA:C6XHR8"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR8"
FT                   /protein_id="ACT56811.1"
FT                   /translation="MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGD
FT                   LGYSIPVFGMHLYTWSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFA
FT                   NFISTILECGLTQCFDNPTFYQLLN"
FT   gene            234860..235126
FT                   /locus_tag="CLIBASIA_01120"
FT   CDS_pept        234860..235126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56812"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHR9"
FT                   /protein_id="ACT56812.1"
FT                   /translation="MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWK
FT                   ILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFLLSTNLSEC"
FT   gene            complement(236356..237402)
FT                   /locus_tag="CLIBASIA_01125"
FT   CDS_pept        complement(236356..237402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01125"
FT                   /product="proline/glycine betaine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="COG4175 ABC-type proline/glycine betaine transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56813"
FT                   /db_xref="GOA:C6XHS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS0"
FT                   /protein_id="ACT56813.1"
FT                   /translation="MNDCAVKFRDVDIVFGETSNKIRKRSRYSIKKHDKVSEYGMVSAV
FT                   IKANLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANV
FT                   LRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWA
FT                   DCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT
FT                   IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPANCYVSEFIQKLNPITALVA
FT                   ADVMRVCSIDDESNIVHKISRQMPLIDIIDMVADNLGKIGVVEDDRIVGIITAIDIVRG
FT                   LSCCRRFS"
FT   gene            complement(237399..238244)
FT                   /locus_tag="CLIBASIA_01130"
FT   CDS_pept        complement(237399..238244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01130"
FT                   /product="proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /note="COG4176 ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56814"
FT                   /db_xref="GOA:C6XHS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS1"
FT                   /protein_id="ACT56814.1"
FT                   /translation="MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVL
FT                   FVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVST
FT                   FISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATI
FT                   VFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIML
FT                   SLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
FT                   "
FT   gene            complement(238316..239245)
FT                   /locus_tag="CLIBASIA_01135"
FT   CDS_pept        complement(238316..239245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01135"
FT                   /product="substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COG2113 ABC-type proline/glycine betaine transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56815"
FT                   /db_xref="GOA:C6XHS2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS2"
FT                   /protein_id="ACT56815.1"
FT                   /translation="MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMT
FT                   SVILEEILGYKTNIKLLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVA
FT                   ENLQGAKYMLAVNDVGFALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNK
FT                   FSLKGFRLIEASELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFG
FT                   EASVYTVVRSDYLDKCPNISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHP
FT                   DLLKNWLIGVTTFDGQDPSRQLERFMNN"
FT   gene            239785..240720
FT                   /locus_tag="CLIBASIA_01140"
FT   CDS_pept        239785..240720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01140"
FT                   /product="probable cation efflux protein"
FT                   /note="COG0053 Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56816"
FT                   /db_xref="GOA:C6XHS3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS3"
FT                   /protein_id="ACT56816.1"
FT                   /translation="MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLE
FT                   SIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHN
FT                   MSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAG
FT                   VLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNI
FT                   IALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAI
FT                   ITIHIEPANEVTHGIHVPLKENKNQCLKSL"
FT   gene            240702..241166
FT                   /locus_tag="CLIBASIA_01145"
FT   CDS_pept        240702..241166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01145"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="COG0780 Enzyme related to GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56817"
FT                   /db_xref="GOA:C6XHS4"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS4"
FT                   /protein_id="ACT56817.1"
FT                   /translation="MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTI
FT                   PEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRL
FT                   VTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG"
FT   gene            complement(241187..241699)
FT                   /gene="nusB"
FT                   /locus_tag="CLIBASIA_01150"
FT   CDS_pept        complement(241187..241699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="CLIBASIA_01150"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56818"
FT                   /db_xref="GOA:C6XHS5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS5"
FT                   /protein_id="ACT56818.1"
FT                   /translation="MTIQDNKKDLKLSHRRGIARLAAVQALYQIDIIGCSTTEIISEYE
FT                   TYRFCADTELDVESVYLHVDLEWFRVIIHGVMDRKQHIDLLISSCLTEKWSFSRLDMIL
FT                   CSILRAGVLELIECHSVPVEVIISEYVCIAHDFFYGDEPKFINAVLDKVSRKEEIKRSG
FT                   CVSAITQ"
FT   gene            complement(241705..242154)
FT                   /gene="ribH"
FT                   /locus_tag="CLIBASIA_01155"
FT   CDS_pept        complement(241705..242154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="CLIBASIA_01155"
FT                   /product="riboflavin synthase subunit beta"
FT                   /note="COG0054 Riboflavin synthase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56819"
FT                   /db_xref="GOA:C6XHS6"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS6"
FT                   /protein_id="ACT56819.1"
FT                   /translation="MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPG
FT                   VLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLP
FT                   IGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE"
FT   gene            complement(242218..242832)
FT                   /gene="ribE"
FT                   /locus_tag="CLIBASIA_01160"
FT   CDS_pept        complement(242218..242832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CLIBASIA_01160"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /EC_number="2.5.1.9"
FT                   /note="COG0307 Riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56820"
FT                   /db_xref="GOA:C6XHS7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS7"
FT                   /protein_id="ACT56820.1"
FT                   /translation="MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAG
FT                   ICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVS
FT                   GHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVL
FT                   LIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ"
FT   gene            complement(242814..243908)
FT                   /locus_tag="CLIBASIA_01165"
FT   CDS_pept        complement(242814..243908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01165"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase/diaminohydroxyphosphoribosylaminopyrimidine"
FT                   /note="COG0117 Pyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56821"
FT                   /db_xref="GOA:C6XHS8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS8"
FT                   /protein_id="ACT56821.1"
FT                   /translation="MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRG
FT                   VTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCV
FT                   DDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNM
FT                   IGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRI
FT                   ILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTI
FT                   LVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMC
FT                   VRRDYFGSDVCLEYIGKNLCLQEL"
FT   gene            complement(244052..245353)
FT                   /gene="glyA"
FT                   /locus_tag="CLIBASIA_01170"
FT   CDS_pept        complement(244052..245353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="CLIBASIA_01170"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG0112 Glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56822"
FT                   /db_xref="GOA:C6XHS9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHS9"
FT                   /protein_id="ACT56822.1"
FT                   /translation="MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIV
FT                   SRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSG
FT                   SQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMH
FT                   EIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPS
FT                   PVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAF
FT                   GEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAES
FT                   ILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSS
FT                   SDEENHSLELTVLHKVQEFVHCFPIYDFSASALK"
FT   gene            complement(245465..246760)
FT                   /locus_tag="CLIBASIA_01175"
FT   CDS_pept        complement(245465..246760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01175"
FT                   /product="hypothetical protein"
FT                   /note="COG2989 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56823"
FT                   /db_xref="GOA:C6XHT0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT0"
FT                   /protein_id="ACT56823.1"
FT                   /translation="MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYH
FT                   SIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHL
FT                   GNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLE
FT                   AMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVG
FT                   RVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEV
FT                   FVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFET
FT                   SGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPK
FT                   DSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD"
FT   gene            complement(246959..247474)
FT                   /locus_tag="CLIBASIA_01180"
FT   CDS_pept        complement(246959..247474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01180"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56824"
FT                   /db_xref="GOA:C6XHT1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT1"
FT                   /protein_id="ACT56824.1"
FT                   /translation="MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRD
FT                   EFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQR
FT                   SRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFW
FT                   GDQIAYRL"
FT   gene            247816..248829
FT                   /locus_tag="CLIBASIA_01185"
FT   CDS_pept        247816..248829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01185"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG0113 Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56825"
FT                   /db_xref="GOA:C6XHT2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT2"
FT                   /protein_id="ACT56825.2"
FT                   /translation="MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIF
FT                   LTSGEKTVESINSMPDVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHII
FT                   DPDNLINEGICAIKKNIPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAV
FT                   IQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTR
FT                   DLLKGDKKTYYLDPANVQEAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTF
FT                   AYQVSGEYAMIKAASLQGWINKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS"
FT   gene            complement(249125..251386)
FT                   /gene="parC"
FT                   /locus_tag="CLIBASIA_01190"
FT   CDS_pept        complement(249125..251386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="CLIBASIA_01190"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56826"
FT                   /db_xref="GOA:C6XHT3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT3"
FT                   /protein_id="ACT56826.1"
FT                   /translation="MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPD
FT                   LRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQP
FT                   FVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDS
FT                   EPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYII
FT                   GPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSR
FT                   LIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFP
FT                   LNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLN
FT                   IDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEK
FT                   EKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEK
FT                   EPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLP
FT                   AGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANT
FT                   RKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKD
FT                   GGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
FT                   "
FT   gene            complement(251559..251675)
FT                   /locus_tag="CLIBASIA_01195"
FT   CDS_pept        complement(251559..251675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56827"
FT                   /db_xref="GOA:C6XHT4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT4"
FT                   /protein_id="ACT56827.1"
FT                   /translation="MPLSFCDLRVIFQEAFFICSLFVVIACFVWIISEIVLN"
FT   gene            complement(251721..253010)
FT                   /gene="gltA"
FT                   /locus_tag="CLIBASIA_01200"
FT   CDS_pept        complement(251721..253010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="CLIBASIA_01200"
FT                   /product="type II citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG0372 Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56828"
FT                   /db_xref="GOA:C6XHT5"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT5"
FT                   /protein_id="ACT56828.1"
FT                   /translation="MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPA
FT                   FSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFN
FT                   DKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLR
FT                   MIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRI
FT                   FILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSL
FT                   ERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVA
FT                   IELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEM
FT                   IVDPSRRIGRPRQLYTGALKRDYVPLEERE"
FT   gene            253208..253570
FT                   /locus_tag="CLIBASIA_01205"
FT   CDS_pept        253208..253570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56829"
FT                   /db_xref="GOA:C6XHT6"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT6"
FT                   /protein_id="ACT56829.1"
FT                   /translation="MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFW
FT                   FVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPT
FT                   TILSQSITTNLRGIVK"
FT   gene            253661..254845
FT                   /locus_tag="CLIBASIA_01210"
FT   CDS_pept        253661..254845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01210"
FT                   /product="hypothetical protein"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56830"
FT                   /db_xref="GOA:C6XHT7"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT7"
FT                   /protein_id="ACT56830.1"
FT                   /translation="MLSITKKYDPFPAETTIEGIARLSPPSGPAFPGLFDFNFSSYYKG
FT                   ISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSASASIFLIKHF
FT                   HCIPVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVMAWGLDIIIHIAHRI
FT                   SVAHNEFCIGRIPETSFVTIVVEFLLMVFCKTNIRHIGSIMIGITIIILFTFPYSFSPD
FT                   LLISEKGNLVALVDKNTLISNYSNPPSFIFSQWKSALITPFHEAPHVQKEDLQEKNQSS
FT                   LKEILRSMQPRKFLCIKKSFCVGCHRSDVIVGVLKRKDMIRLSCQLSDILITTIRDINT
FT                   KLCNVSLLITPEILQKQGSLEITIIPPSNDNDKVKFIIKSAIENLHFPWTKHRI"
FT   gene            255669..256118
FT                   /locus_tag="CLIBASIA_01215"
FT   CDS_pept        255669..256118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01215"
FT                   /product="Cytidine/deoxycytidylate deaminase, zinc-binding
FT                   region"
FT                   /note="COG0590 Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56831"
FT                   /db_xref="GOA:C6XHT8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT8"
FT                   /protein_id="ACT56831.2"
FT                   /translation="MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNR
FT                   ELKDVTAHAEILAIRMGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASN
FT                   PKGGGIENGTQFYTLATCHHSPEIYPGISEQRSRQIIQDFFKERR"
FT   gene            256428..257060
FT                   /locus_tag="CLIBASIA_01220"
FT   CDS_pept        256428..257060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01220"
FT                   /product="GTP cyclohydrolase II protein (riboflavin
FT                   biosynthesis)"
FT                   /note="COG0108 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56832"
FT                   /db_xref="GOA:C6XHT9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHT9"
FT                   /protein_id="ACT56832.1"
FT                   /translation="MKQKKSLDERYIEDVIQSFQKGEMVIVTDADDRENEADLVLAAIH
FT                   CTSEKMAFIIRHTCGIVCTPMPFHTAHKLKLNPMVLENESVHKTAFTVSVDSKHGITTG
FT                   ISADDRAYTIKNLANPHSIADNFVRPGHIFPLISRDGGVLVRPGHTEASVDLCKITGLP
FT                   PIAVICELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIAWRKKKEI"
FT   gene            complement(257275..258192)
FT                   /locus_tag="CLIBASIA_01225"
FT   CDS_pept        complement(257275..258192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01225"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="COG0109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56833"
FT                   /db_xref="GOA:C6XHU0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU0"
FT                   /protein_id="ACT56833.1"
FT                   /translation="MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVI
FT                   SIFAIAMGAGASGALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVI
FT                   MGLAINWVSATLLFMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVS
FT                   IASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSI
FT                   VGVLPTMLGFASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVL
FT                   FTILMVDHLIDMKTVERYFFSSFL"
FT   gene            complement(258969..259154)
FT                   /locus_tag="CLIBASIA_01230"
FT   CDS_pept        complement(258969..259154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01230"
FT                   /product="ribosomal protein L32"
FT                   /note="COG0333 Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56834"
FT                   /db_xref="GOA:C6XHU1"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU1"
FT                   /protein_id="ACT56834.1"
FT                   /translation="MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMK
FT                   TGLYRGRQVFVLKTKE"
FT   gene            259515..260663
FT                   /gene="nhaA"
FT                   /locus_tag="CLIBASIA_01235"
FT   CDS_pept        259515..260663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="CLIBASIA_01235"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="COG3004 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56835"
FT                   /db_xref="GOA:C6XHU2"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU2"
FT                   /protein_id="ACT56835.2"
FT                   /translation="MTKNKFFLYRDNFTGILLISTTFITMILANISFSSAYYFDALEYK
FT                   IANLTLRDWVNDILMILYFFMIGLELKHELIHGELSSWTKRSLPLLGAIGGITFPACIY
FT                   MIINCHTEIYLKGWAIPTATDIAFTLGILSWIGPNIPSSLKIFFTALTMIDDFSAIAIM
FT                   AIFYTQSLNLFALQVAITLIFLLFLLNRCGFTNLFIYGFLGFFLWHSIFKSGIHTTVFG
FT                   VIMALLLPDIKNYHSPSNRISFYLLGDGLKSWVMPLVLPAFVFVNTGLTISTIPYTDIS
FT                   DPIVWGVMLGLFLGKQSGIFLFAFSTVKIGWGKLPKDTNWCLLYGGSILCGIGFTMSLF
FT                   LTLQAFPNANNLQEKAKIGIILSSVISIIYAYLVFKIPLRKK"
FT   gene            complement(260694..261488)
FT                   /gene="fpr"
FT                   /locus_tag="CLIBASIA_01240"
FT   CDS_pept        complement(260694..261488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="CLIBASIA_01240"
FT                   /product="ferredoxin-NADP+ reductase protein"
FT                   /note="COG1018 Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56836"
FT                   /db_xref="GOA:C6XHU3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU3"
FT                   /protein_id="ACT56836.1"
FT                   /translation="MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEF
FT                   VMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKST
FT                   GTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGID
FT                   VMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTD
FT                   RIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL"
FT   gene            complement(261830..262504)
FT                   /locus_tag="CLIBASIA_01245"
FT   CDS_pept        complement(261830..262504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01245"
FT                   /product="ferredoxin-NADP+ reductase protein"
FT                   /note="COG1018 Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56837"
FT                   /db_xref="GOA:C6XHU4"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU4"
FT                   /protein_id="ACT56837.1"
FT                   /translation="MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEF
FT                   VMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKST
FT                   GDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGID
FT                   VMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTR
FT                   IG"
FT   gene            complement(262679..263578)
FT                   /locus_tag="CLIBASIA_01250"
FT   CDS_pept        complement(262679..263578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01250"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase
FT                   protein"
FT                   /note="COG1210 UDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56838"
FT                   /db_xref="GOA:C6XHU5"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU5"
FT                   /protein_id="ACT56838.1"
FT                   /translation="MGSLKKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVI
FT                   EEALEAGLTDFVFVTGRGKGLIKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAV
FT                   FTWQYERKGLGHAVWCARNIIGDNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANIL
FT                   AVSECDPQLSCKYGMVQVGKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFS
FT                   ILNDWKENEGKGEIQLTDSMRKLSERHDFLAYHFKGHTYDCGSKKGFVLANIAFALARQ
FT                   DIRSDIETDLKTLVSALK"
FT   gene            264256..264780
FT                   /locus_tag="CLIBASIA_01255"
FT   CDS_pept        264256..264780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01255"
FT                   /product="hypothetical protein"
FT                   /note="COG1495 Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56839"
FT                   /db_xref="GOA:C6XHU6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU6"
FT                   /protein_id="ACT56839.2"
FT                   /translation="MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCI
FT                   QEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWE
FT                   KNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFIT
FT                   SIAMLKISRKK"
FT   gene            complement(264875..265720)
FT                   /locus_tag="CLIBASIA_01260"
FT   CDS_pept        complement(264875..265720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01260"
FT                   /product="ribonuclease protein"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56840"
FT                   /db_xref="GOA:C6XHU7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU7"
FT                   /protein_id="ACT56840.1"
FT                   /translation="MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF
FT                   GANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYF
FT                   SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV
FT                   RKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWV
FT                   VGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
FT                   "
FT   gene            266258..267007
FT                   /gene="etfB"
FT                   /locus_tag="CLIBASIA_01265"
FT   CDS_pept        266258..267007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="CLIBASIA_01265"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /note="COG2086 Electron transfer flavoprotein, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56841"
FT                   /db_xref="GOA:C6XHU8"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU8"
FT                   /protein_id="ACT56841.1"
FT                   /translation="MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEE
FT                   SLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREI
FT                   VKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGT
FT                   MTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEE
FT                   NRAERKGLRLYSTTKLIEILKSKHDLL"
FT   gene            266994..267950
FT                   /gene="etfA"
FT                   /locus_tag="CLIBASIA_01270"
FT   CDS_pept        266994..267950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="CLIBASIA_01270"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="COG2025 Electron transfer flavoprotein, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56842"
FT                   /db_xref="GOA:C6XHU9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHU9"
FT                   /protein_id="ACT56842.1"
FT                   /translation="MTYCDMPVLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDN
FT                   IENIAQQAARIQGVTQVIVAQSTIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDIL
FT                   PRVAAMLDVMQVSEVIEIISPKIFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAPKA
FT                   EKVASIHKISAEVLEKYISNTRFIKEERTSLSPTDLSSAKIVISGGKSFGSMENFHKLL
FT                   LPLAKKLGAAIGATRDAVDAGFAPNDWQIGQTGVTVSPELYIAAGISGAIQHISGMKDS
FT                   KVIVSINTDENAPIFKISDYFIVGDIFKILPEIEKNL"
FT   gene            268037..269458
FT                   /gene="argH"
FT                   /locus_tag="CLIBASIA_01275"
FT   CDS_pept        268037..269458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="CLIBASIA_01275"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG0165 Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56843"
FT                   /db_xref="GOA:C6XHV0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV0"
FT                   /protein_id="ACT56843.1"
FT                   /translation="MSKKIKSNEVNQMWGGRFSSSPSWIMEKINVSIDFDKKLFEQDIL
FT                   GSKVHTTMLAKQGIISSEEAQKIIEGLKVIRAEIVDGSFVFSRDLEDIHMNIEARLTSL
FT                   IGSIAGKMHTARSRNDQVALDLRLWIKEKTLEITNDLKKLLTILLDKAEEHHNTIMPGF
FT                   THLQTAQPVTFGHHCMAYVEMFGRDISRFFDSIERLDECPLGAAALAGTSFPIDRHFTA
FT                   KELGFREPTRNSIDSVSDRDFILECLSHSAICAMHMSRLAEEIILWSTPQFNFVRLSDA
FT                   FSTGSSIMPQKRNPDGAELVRAKTGRINGALLSLLTIMKGLPLAYSKDMQEDKEPVFDA
FT                   LETLQIIILAISAMIEDLTVNKDRLQEAATKSHSTATDLADWLVSHAGLPFREAHYITG
FT                   CTVSLAEKNQCELAKLPLAMLQQISPVITSAVYDILKVESSISSRKSFGGTCAAEVLKQ
FT                   VTYWRNRIQNIPKKI"
FT   gene            269636..270931
FT                   /gene="lysA"
FT                   /locus_tag="CLIBASIA_01280"
FT   CDS_pept        269636..270931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="CLIBASIA_01280"
FT                   /product="diaminopimelate decarboxylase protein"
FT                   /note="COG0019 Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56844"
FT                   /db_xref="GOA:C6XHV1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV1"
FT                   /protein_id="ACT56844.1"
FT                   /translation="MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFS
FT                   NAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGV
FT                   GKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKIS
FT                   TGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQ
FT                   QLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVA
FT                   DVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADI
FT                   VGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFH
FT                   IIRPRMTFQELIELDSIPAWLQKTPKQSSENY"
FT   gene            complement(271164..271904)
FT                   /gene="fliP"
FT                   /locus_tag="CLIBASIA_01285"
FT   CDS_pept        complement(271164..271904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="CLIBASIA_01285"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /note="COG1338 Flagellar biosynthesis pathway, component
FT                   FliP"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56845"
FT                   /db_xref="GOA:C6XHV2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV2"
FT                   /protein_id="ACT56845.1"
FT                   /translation="MIRYCFFALFLVTPELVFAKSSLHDVMNIPADLSISTWIVRTFGI
FT                   FTILSIAPILLIMVTCFPRFIIVFSILRTGMGMGSVPPNLVIISLALFMTFYVMSPTLD
FT                   RSIEMGIQPLMNNQITETTAIQRVAEPFWVFMRNNTREKDLSLFMDMAHSSHRNTDITK
FT                   NDHIEYRILIPSFMISELRRSFEIGFLIILPFLIIDMIVATIVMAMGMMMLPPTSISLP
FT                   FKVIFFVLIDGWSLLVENLVKSFI"
FT   gene            complement(271901..272419)
FT                   /gene="fliL"
FT                   /locus_tag="CLIBASIA_01290"
FT   CDS_pept        complement(271901..272419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="CLIBASIA_01290"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56846"
FT                   /db_xref="GOA:C6XHV3"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV3"
FT                   /protein_id="ACT56846.1"
FT                   /translation="MSYDDTTSQYIRGNQHKLFVTWFVVYTFIGIFCGWLGGIVMLFLF
FT                   AGQKEEKYQKFILNNFYDNSVRSVHTGDTISLKKLQIFSLQPIITNFDSSPKDWLRLDI
FT                   ALICKDIPDKVFLETLHQDIMAYIRTVSIKQITGAQGFRYFKEDIEERVKLRSQGFVSS
FT                   VIFRTFIIA"
FT   gene            complement(272438..273154)
FT                   /gene="flgH"
FT                   /locus_tag="CLIBASIA_01295"
FT   CDS_pept        complement(272438..273154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="CLIBASIA_01295"
FT                   /product="flagellar basal body L-ring protein"
FT                   /note="COG2063 Flagellar basal body L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56847"
FT                   /db_xref="GOA:C6XHV4"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV4"
FT                   /protein_id="ACT56847.1"
FT                   /translation="MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMP
FT                   FLGIDFKNSDSTKKSYSLWRDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSR
FT                   NNSLHRKLSGGFSLFGQQTPQMNGNLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILE
FT                   NGNLIISGSQEVRVNDEIRSLNVTGIVRPQDVDAHNSVSYDKIAEARISYGGKGRTTEL
FT                   LRPPIGHQLIENLSPL"
FT   gene            complement(273154..273681)
FT                   /locus_tag="CLIBASIA_01300"
FT   CDS_pept        complement(273154..273681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01300"
FT                   /product="hypothetical protein"
FT                   /note="COG3334 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56848"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV5"
FT                   /protein_id="ACT56848.1"
FT                   /translation="MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREI
FT                   QQYCTNVIDSVRERDYLSQKKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYN
FT                   KNILDIYKKMDSDSAALQLEQIDPDISSHILMRLSPRQSSLIMSKMNPKSATMITNVVA
FT                   NMLKFKKLKRSS"
FT   gene            complement(273678..274787)
FT                   /gene="flgI"
FT                   /locus_tag="CLIBASIA_01305"
FT   CDS_pept        complement(273678..274787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="CLIBASIA_01305"
FT                   /product="flagellar basal body P-ring protein"
FT                   /note="COG1706 Flagellar basal-body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56849"
FT                   /db_xref="GOA:C6XHV6"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV6"
FT                   /protein_id="ACT56849.1"
FT                   /translation="MIFRIAFLIFSLIGLHEISAQVVSRIKDVVSLQSGRDNQLIGYGL
FT                   VVGLQGTGDSLRSSPFTEQSMRSLLQNLGISTPGGRLGSKNVAAVMVTANLPPFASPGS
FT                   RIDVSINSLGDASSLRGGILVMTSLLGADGNIYAVAQGSVVVSGLFVKGQSSSFMEGIS
FT                   TGGKIVNGAIVERELPKKFKDSADLILQLRNPDFSTAIRIADQINSYSLNRFSRPIAEA
FT                   YDSRTVKVSKPTNIDLTRLMSEVEMLTVETDTPARVIINERTGTIVIGDNVRISKVVVS
FT                   YGNLTVQITENEQVVQPNAFSSNGSTVTQNNTDLKVSDNKGSFSLIDAPDLNSLISGMN
FT                   SIGLKTDGIISILQGIKAAGALQSEIIIQ"
FT   gene            complement(274784..275242)
FT                   /gene="flgA"
FT                   /locus_tag="CLIBASIA_01310"
FT   CDS_pept        complement(274784..275242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="CLIBASIA_01310"
FT                   /product="flagellar basal body P-ring biosynthesis protein
FT                   FlgA"
FT                   /note="COG1261 Flagellar basal body P-ring biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56850"
FT                   /db_xref="GOA:C6XHV7"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV7"
FT                   /protein_id="ACT56850.1"
FT                   /translation="MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESR
FT                   LKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILT
FT                   QGNMTISTAGIALSDASIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK"
FT   gene            complement(275260..276048)
FT                   /gene="flgG"
FT                   /locus_tag="CLIBASIA_01315"
FT   CDS_pept        complement(275260..276048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="CLIBASIA_01315"
FT                   /product="flagellar basal body rod protein FlgG"
FT                   /note="COG4786 Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56851"
FT                   /db_xref="GOA:C6XHV8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV8"
FT                   /protein_id="ACT56851.1"
FT                   /translation="MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLY
FT                   QAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWF
FT                   QVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTG
FT                   KNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEA
FT                   SNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR"
FT   gene            complement(276077..276403)
FT                   /gene="fliE"
FT                   /locus_tag="CLIBASIA_01320"
FT   CDS_pept        complement(276077..276403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="CLIBASIA_01320"
FT                   /product="flagellar hook-basal body protein FliE"
FT                   /note="COG1677 Flagellar hook-basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56852"
FT                   /db_xref="GOA:C6XHV9"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHV9"
FT                   /protein_id="ACT56852.1"
FT                   /translation="MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQ
FT                   DMAKGAIGDMEKAENVSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVS
FT                   KMQI"
FT   gene            complement(276403..276807)
FT                   /gene="flgC"
FT                   /locus_tag="CLIBASIA_01325"
FT   CDS_pept        complement(276403..276807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="CLIBASIA_01325"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /note="COG1558 Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56853"
FT                   /db_xref="GOA:C6XHW0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW0"
FT                   /protein_id="ACT56853.1"
FT                   /translation="MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYR
FT                   RKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADM
FT                   RETNRLYMANLQTIKQSHDMMTTTLDLLRD"
FT   gene            complement(276812..277204)
FT                   /gene="flgB"
FT                   /locus_tag="CLIBASIA_01330"
FT   CDS_pept        complement(276812..277204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="CLIBASIA_01330"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /note="COG1815 Flagellar basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56854"
FT                   /db_xref="GOA:C6XHW1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW1"
FT                   /protein_id="ACT56854.1"
FT                   /translation="MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFE
FT                   TILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSG
FT                   HIKYLYELNTKLIKKLNSMVMHVVRG"
FT   gene            278091..279488
FT                   /locus_tag="CLIBASIA_01335"
FT   CDS_pept        278091..279488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01335"
FT                   /product="ATP dependent RNA helicase protein"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56855"
FT                   /db_xref="GOA:C6XHW2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW2"
FT                   /protein_id="ACT56855.1"
FT                   /translation="MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIA
FT                   QTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVA
FT                   LLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGF
FT                   IPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFV
FT                   ATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQ
FT                   RSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAG
FT                   RHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPI
FT                   PQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNR
FT                   GKLNDKL"
FT   gene            279613..280296
FT                   /locus_tag="CLIBASIA_01340"
FT   CDS_pept        279613..280296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01340"
FT                   /product="endonuclease III"
FT                   /note="COG0177 Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56856"
FT                   /db_xref="GOA:C6XHW3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW3"
FT                   /protein_id="ACT56856.1"
FT                   /translation="MVSSKKSDSYQGNSPLGCLYTPKELEEIFYLFSLKWPSPKGELYY
FT                   VNHFTLIVAVLLSAQSTDVNVNKATKHLFEIADTPQKMLAIGEKKLQNYIRTIGIYRKK
FT                   SENIISLSHILINEFDNKIPQTLEGLTRLPGIGRKGANVILSMAFGIPTIGVDTHIFRI
FT                   SNRIGLAPGKTPNKVEQSLLRIIPPKHQYNAHYWLVLHGRYVCKARKPQCQSCIISNLC
FT                   KRIKQ"
FT   gene            complement(280315..282312)
FT                   /locus_tag="CLIBASIA_01345"
FT   CDS_pept        complement(280315..282312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01345"
FT                   /product="serralysin"
FT                   /note="COG2931 RTX toxins and related Ca2+-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56857"
FT                   /db_xref="GOA:C6XHW4"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW4"
FT                   /protein_id="ACT56857.1"
FT                   /translation="MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDIT
FT                   ELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINF
FT                   DKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVM
FT                   SYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTI
FT                   YDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVI
FT                   GNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSD
FT                   VERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITF
FT                   DSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFAD
FT                   APDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKE
FT                   GRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSY
FT                   DDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHK
FT                   KVDLYTDYFGDGNYYDSDLYSMHDINHDFS"
FT   gene            282556..284253
FT                   /locus_tag="CLIBASIA_01350"
FT   CDS_pept        282556..284253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01350"
FT                   /product="Type I secretion system ATPase, PrtD"
FT                   /note="COG4618 ABC-type protease/lipase transport system,
FT                   ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56858"
FT                   /db_xref="GOA:C6XHW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW5"
FT                   /protein_id="ACT56858.2"
FT                   /translation="MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDS
FT                   VIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEM
FT                   DGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLL
FT                   TITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQ
FT                   EYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAP
FT                   LEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRD
FT                   KKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRD
FT                   FIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGY
FT                   QTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKK
FT                   TIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI"
FT   gene            284258..285580
FT                   /locus_tag="CLIBASIA_01355"
FT   CDS_pept        284258..285580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01355"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56859"
FT                   /db_xref="GOA:C6XHW6"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW6"
FT                   /protein_id="ACT56859.1"
FT                   /translation="MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVS
FT                   SSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIK
FT                   NLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRS
FT                   LKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERI
FT                   VYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLT
FT                   ILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQ
FT                   HVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFS
FT                   DNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER"
FT   gene            285887..287167
FT                   /locus_tag="CLIBASIA_01360"
FT   CDS_pept        285887..287167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01360"
FT                   /product="C4-dicarboxylate transporter DctA"
FT                   /note="COG1301 Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56860"
FT                   /db_xref="GOA:C6XHW7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW7"
FT                   /protein_id="ACT56860.1"
FT                   /translation="MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQ
FT                   PLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLI
FT                   VGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTL
FT                   IVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGL
FT                   SSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESA
FT                   LPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLS
FT                   LLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIG
FT                   NAVMTVVVSRWEKKLDPKLFNKYIGIE"
FT   gene            complement(287740..289116)
FT                   /locus_tag="CLIBASIA_01365"
FT   CDS_pept        complement(287740..289116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56861"
FT                   /db_xref="GOA:C6XHW8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW8"
FT                   /protein_id="ACT56861.1"
FT                   /translation="MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVR
FT                   WSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKK
FT                   NFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAE
FT                   AETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKV
FT                   GIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASV
FT                   IRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAIN
FT                   DAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIR
FT                   IMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
FT                   "
FT   gene            complement(289587..289724)
FT                   /locus_tag="CLIBASIA_01370"
FT   CDS_pept        complement(289587..289724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56862"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHW9"
FT                   /protein_id="ACT56862.1"
FT                   /translation="MMHPFIFDGMGNIRFLKFNGEGGYSKYYRNFIISCRTYRVFTAIF
FT                   "
FT   gene            complement(289840..290262)
FT                   /gene="ndk"
FT                   /locus_tag="CLIBASIA_01375"
FT   CDS_pept        complement(289840..290262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="CLIBASIA_01375"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105 Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56863"
FT                   /db_xref="GOA:C6XHX0"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX0"
FT                   /protein_id="ACT56863.1"
FT                   /translation="MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRK
FT                   QAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIR
FT                   NKYGISIGENSIHGSDSLKTALEEISYWFARNEIIG"
FT   gene            complement(290437..290862)
FT                   /locus_tag="CLIBASIA_01380"
FT   CDS_pept        complement(290437..290862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01380"
FT                   /product="DNA polymerase III subunit chi"
FT                   /note="COG2927 DNA polymerase III, chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56864"
FT                   /db_xref="GOA:C6XHX1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX1"
FT                   /protein_id="ACT56864.1"
FT                   /translation="MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLN
FT                   EYLWTWKKDGFLPHGVDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVD
FT                   YYEKVVFIINTDDQGSLEWGRAHWRSLKNSGYAPDVI"
FT   gene            complement(290859..292343)
FT                   /locus_tag="CLIBASIA_01385"
FT   CDS_pept        complement(290859..292343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01385"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56865"
FT                   /db_xref="GOA:C6XHX2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX2"
FT                   /protein_id="ACT56865.1"
FT                   /translation="MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAV
FT                   SVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIE
FT                   IFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQ
FT                   SSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKL
FT                   GMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMK
FT                   GDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVIN
FT                   TDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLS
FT                   SGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHID
FT                   IAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK"
FT   gene            292560..293645
FT                   /locus_tag="CLIBASIA_01390"
FT   CDS_pept        292560..293645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01390"
FT                   /product="permease protein"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56866"
FT                   /db_xref="GOA:C6XHX3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX3"
FT                   /protein_id="ACT56866.2"
FT                   /translation="MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTES
FT                   LNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVL
FT                   FLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISK
FT                   YNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMK
FT                   FKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLF
FT                   PVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILY
FT                   LFLFCISSIFLLMIKKKYTKI"
FT   gene            293686..294771
FT                   /locus_tag="CLIBASIA_01395"
FT   CDS_pept        293686..294771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01395"
FT                   /product="putative permease protein"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56867"
FT                   /db_xref="GOA:C6XHX4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX4"
FT                   /protein_id="ACT56867.2"
FT                   /translation="MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN
FT                   YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP
FT                   FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIF
FT                   IGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPID
FT                   KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP
FT                   LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA
FT                   LIPVILTISLSILILLQKEDG"
FT   gene            294774..297062
FT                   /locus_tag="CLIBASIA_01400"
FT   CDS_pept        294774..297062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01400"
FT                   /product="organic solvent tolerance protein"
FT                   /note="COG1452 Organic solvent tolerance protein OstA"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56868"
FT                   /db_xref="GOA:C6XHX5"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX5"
FT                   /protein_id="ACT56868.1"
FT                   /translation="MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNE
FT                   TNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIK
FT                   LIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYT
FT                   ACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVV
FT                   RKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSG
FT                   KHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDA
FT                   LSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQY
FT                   AKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGI
FT                   LFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHIL
FT                   EGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIG
FT                   SFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITF
FT                   STQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKIN
FT                   DVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIG
FT                   DFNPIDIDG"
FT   gene            297120..298073
FT                   /locus_tag="CLIBASIA_01405"
FT   CDS_pept        297120..298073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01405"
FT                   /product="peptidyl-prolyl cis-trans isomerase protein"
FT                   /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56869"
FT                   /db_xref="GOA:C6XHX6"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX6"
FT                   /protein_id="ACT56869.1"
FT                   /translation="MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTT
FT                   INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY
FT                   FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI
FT                   PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF
FT                   ASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE
FT                   IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY"
FT   gene            298091..299122
FT                   /gene="pdxA"
FT                   /locus_tag="CLIBASIA_01410"
FT   CDS_pept        298091..299122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="CLIBASIA_01410"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56870"
FT                   /db_xref="GOA:C6XHX7"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX7"
FT                   /protein_id="ACT56870.1"
FT                   /translation="MDEFLPLILTQGDPAGIGPDISLKAWASRQITAIPPFIYIGDVDV
FT                   LNARAKQLNLSVPLYETDCKNAVSIFKKALPIISSPCGAKIVTGTPNPQTASSTIANIE
FT                   KAVSLTLSGQALAIVTNPIAKFLLYQEKFKFPGHTEFLAELAKKNTGITFKPVMMLSGP
FT                   QLRTVPVTIHIPIADICRILSTKRIIETSDTVYNAMKKYFGINNPRIAISGLNPHAGEN
FT                   ATIGIEEKNIIIPAITYLRNDNKNIIGPLPADSMFHHSARQCYDVAICMYHDQALIPIK
FT                   TLDFNQTVNITLGLPFVRTSPDHGTAFDIAGSSLTQEESLVSALKIAAQLGYQKNLCND
FT                   HEQ"
FT   gene            299106..299960
FT                   /gene="ksgA"
FT                   /locus_tag="CLIBASIA_01415"
FT   CDS_pept        299106..299960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="CLIBASIA_01415"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56871"
FT                   /db_xref="GOA:C6XHX8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX8"
FT                   /protein_id="ACT56871.1"
FT                   /translation="MTMNNKSHSLKTILSHYKIIPKKYMGQNFLLDLNILKKIAESSGS
FT                   LDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDDA
FT                   LKVDFEKFFNISSPIRIIANLPYNIGTRLLFNWISADTWPPFWESLTLLFQKEVGERIT
FT                   AQKNSPHYGRLSVLTGWRTKATMMFDISPHVFFPSPKVTSTVIHFIPHLNPIPCCLESL
FT                   KKITQEAFGKRRKTLRQSLKRLGGENLLHQAGIETNLRAENLSIEDFCRITNILTDNQD
FT                   IAI"
FT   gene            300089..301873
FT                   /gene="mutL"
FT                   /locus_tag="CLIBASIA_01420"
FT   CDS_pept        300089..301873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="CLIBASIA_01420"
FT                   /product="DNA mismatch repair protein"
FT                   /note="COG0323 DNA mismatch repair enzyme (predicted
FT                   ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56872"
FT                   /db_xref="GOA:C6XHX9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHX9"
FT                   /protein_id="ACT56872.1"
FT                   /translation="MKIRKLSEKIINQIAAGEIIERPSIAIKELIENSLDAESSRVETV
FT                   IAGGGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTFGFRGEALPSIGAVS
FT                   HLTLMSRPPQNNTGAQIAISGEKISSVRPVAMNPGTIVEVRDLFFTIPARLNFLKSEQV
FT                   ETNLITDVIRRMAIAYPKVSFTFSTIKSNRYKMNFQSTNGNFPERISQVIGEDFINNAV
FT                   ELNEKSNEITLQGYTGIPTFNRGNANQFYVFINGRTVQDKFILSTIRTAYAETIPLGRY
FT                   PVVVLLLEIDPRQVDVNVHPAKSYIRFRNPTIIRNFIIQSIQKAINKKGISTSSVLSKK
FT                   MISSFHQDNAPKTHLPKYATSLTNTQEKLFLQENRLSTNDLLPSDDPTYSEDNDPVEES
FT                   EATHYQLGIACAQIHQNYIISQTTDGLVIVDQHAAHERLIFEKMRQDFNSTKITSQTLL
FT                   TPEIIDLLEGECALIMEHDEDLHRLGIKAERFGPNAIAIREIPAILSKKNIPQLLRDII
FT                   DEIIDSSTTYTLQDRIENILATMACYGSIRSGRKMQSIEMNRLLREMEKNPNSSQCNHG
FT                   RPTFIKLKLSDIEKLFGR"
FT   gene            301926..302141
FT                   /locus_tag="CLIBASIA_01425"
FT   CDS_pept        301926..302141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01425"
FT                   /product="hypothetical protein"
FT                   /note="COG1734 DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56873"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY0"
FT                   /protein_id="ACT56873.1"
FT                   /translation="MYNKVDENEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCYW
FT                   SVDRQVPYANAEASFEAEKISGKIPY"
FT   gene            complement(302138..303154)
FT                   /gene="lpxK"
FT                   /locus_tag="CLIBASIA_01430"
FT   CDS_pept        complement(302138..303154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="CLIBASIA_01430"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="COG1663 Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56874"
FT                   /db_xref="GOA:C6XHY1"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY1"
FT                   /protein_id="ACT56874.1"
FT                   /translation="MMKSPLFWWKARGFYSFFLYPISWIYSFISSKLMKRGQRLHAPIP
FT                   VICVGGFVMGGTGKTPTALAIAKAVIDKNLKPGFLSRGYGRKSRISFRVDLEKHSAYDV
FT                   GDEPLLLARRAVTIVTSDRKIGVQMLLQEGVDIIIMDDGFHSADLQADFSLIVVNSHRG
FT                   LGNGLVFPAGPLRVPLSRQLSYVDAILYVGNKKNVISSIKNKSVYFAKLKPRLTFDLSG
FT                   KKVLAFSGIADTEKFFTTVRQLGALIEQCYSFGDHAHLSDKKIAYLLDQAQQKGLILVT
FT                   TAKDAMRLHKRPGRAEEIFAKSMVIEVDIVFENPDDLTNLVEMTVVSFANSNKKPCG"
FT   gene            complement(303210..304532)
FT                   /gene="kdtA"
FT                   /locus_tag="CLIBASIA_01435"
FT   CDS_pept        complement(303210..304532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="CLIBASIA_01435"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56875"
FT                   /db_xref="GOA:C6XHY2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY2"
FT                   /protein_id="ACT56875.1"
FT                   /translation="MANVLDCILLGIYRWGGIFFMPFLSVSLSLYRVFNRERGRKFGER
FT                   LGYPTALRPIGPLIWFHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLG
FT                   QYAIHQYAPLDIQPAVSRFLKYWKPDCMILSESDIWPLTVFELSKQRIPQVLVNARMSR
FT                   RSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGAQKLIVSGNLKIDTESLPCDK
FT                   ELLSLYQESIAGRYTWAAISTFEGEEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIER
FT                   RLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLE
FT                   AAMLGCAILSGPNVENFRDIYRRMVSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINA
FT                   AINEVKKMQGPLKITLRSLDSYVNPLIFQNHLLSKDPSFKQ"
FT   gene            complement(304618..304860)
FT                   /locus_tag="CLIBASIA_01440"
FT   CDS_pept        complement(304618..304860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56876"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY3"
FT                   /protein_id="ACT56876.1"
FT                   /translation="MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNA
FT                   YDVWKEKSQQMVDNALMRYFVVDISRFPHYELGKE"
FT   gene            complement(304932..305792)
FT                   /locus_tag="CLIBASIA_01445"
FT   CDS_pept        complement(304932..305792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01445"
FT                   /product="inositol monophosphatase family protein"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56877"
FT                   /db_xref="GOA:C6XHY4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY4"
FT                   /protein_id="ACT56877.1"
FT                   /translation="MSMLHGMFGGMNLLYWYKKLCLMDIDFMYEWKQDLDIVRSAVQGA
FT                   STVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQR
FT                   LNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKS
FT                   TCNGKNISVSSNQMSDSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDV
FT                   LIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRSQVNHEVLFASAKWHFPSFKQ
FT                   HLSTL"
FT   gene            complement(306139..306708)
FT                   /locus_tag="CLIBASIA_01450"
FT   CDS_pept        complement(306139..306708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01450"
FT                   /product="hypothetical protein"
FT                   /note="COG0742 N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56878"
FT                   /db_xref="GOA:C6XHY5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY5"
FT                   /protein_id="ACT56878.1"
FT                   /translation="MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPV
FT                   FLDSTRMLNIFAGTGSVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFF
FT                   RDVLRLGKIGNISPFQLVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCIS
FT                   VGAAFHFLQERKYGDTKIYFFSYNPV"
FT   gene            complement(306801..307865)
FT                   /locus_tag="CLIBASIA_01455"
FT   CDS_pept        complement(306801..307865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01455"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase B"
FT                   /note="COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56879"
FT                   /db_xref="GOA:C6XHY6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY6"
FT                   /protein_id="ACT56879.1"
FT                   /translation="MKDKNIVQENFTPQRVSKVIARAGIASRREVERMIAQQRVKVNGI
FT                   LLERAAVNVMSTDHIEVDGVPLRKAERTRLWLYHKPIGLVTTHSDPDGRSTVFDNLPSI
FT                   FSRVISVGRLDINTEGLLLLTNDGGLARVLELPSTQWLRVYRVRFHGQVDQDKLNLLKK
FT                   GIVIQGICYGDMQVTLDTQKGSNAWVTVGLREGKNREIKKVFEFFNWKVNRLIRISYGP
FT                   FQLGTLLAGSTREVSKKILREQLGPHLLEEAQVNLDAPIYSSETLVRDRPNIISEVPDD
FT                   FTRMKKNSSQKNGLSKQKKLATPVHRRNLASNVWMAKGIHSSFLSDSGQREENHRRSPS
FT                   FPSKRSLRRTSAKK"
FT   gene            complement(309206..309343)
FT                   /locus_tag="CLIBASIA_01460"
FT   CDS_pept        complement(309206..309343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56880"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY7"
FT                   /protein_id="ACT56880.1"
FT                   /translation="MDGDIDIKALIRDGGLHRTESRLIIVCSFRMPNLHSVMDYGITVA
FT                   "
FT   gene            309692..309919
FT                   /locus_tag="CLIBASIA_01465"
FT   CDS_pept        309692..309919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01465"
FT                   /product="hypothetical protein"
FT                   /note="COG5508 Uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56881"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY8"
FT                   /protein_id="ACT56881.1"
FT                   /translation="MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKD
FT                   AKLPIEIGGRKGLDPTRFGDWEKNGISIDF"
FT   gene            complement(310019..310951)
FT                   /locus_tag="CLIBASIA_01470"
FT   CDS_pept        complement(310019..310951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01470"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG0462 Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56882"
FT                   /db_xref="GOA:C6XHY9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHY9"
FT                   /protein_id="ACT56882.1"
FT                   /translation="MKIFAGNSNRNLAQEICDYLHTSLGKASVTYFSDREVFVEIGENV
FT                   RGEDVFIVQSTSCPANDYLMELLIMIDAVRRSSARRITGVIPYFGYCRQDRKPSPRTPI
FT                   SAKLVANLITQAGADRVIMLDLHAGQVQGFFDIPTDNLYALPILERDIKERNDISNLMV
FT                   VSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTG
FT                   GTLCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKMKELVITDSIQPTDLVKSSA
FT                   KIRILTIAQLMGEAINRTFEERSISSLFD"
FT   gene            complement(311278..312366)
FT                   /locus_tag="CLIBASIA_01475"
FT   CDS_pept        complement(311278..312366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01475"
FT                   /product="hypothetical protein"
FT                   /note="COG1565 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56883"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ0"
FT                   /protein_id="ACT56883.1"
FT                   /translation="MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGA
FT                   VGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK
FT                   PDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP
FT                   IKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREM
FT                   QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL
FT                   SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS
FT                   MGELFKILVVSHEKVELMPFVN"
FT   gene            complement(312356..313222)
FT                   /locus_tag="CLIBASIA_01480"
FT   CDS_pept        complement(312356..313222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01480"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="COG0682 Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56884"
FT                   /db_xref="GOA:C6XHZ1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ1"
FT                   /protein_id="ACT56884.1"
FT                   /translation="MEREYMLWSILTYPNLNPVALSLGPIAIRWYGLAYLVGMLFGIWY
FT                   IQYLLGKPALWTEKQNNENLVYKEGDCQESCFFWLAISVIVGGRIMYVLFYNWQVFWNS
FT                   PLHIFFLWEGGMSFHGGLIGAFVSLFLLSRIYCFSFLLFLDLVAASVPVGIFLGRIANF
FT                   INGELWGRVSWVPWAMVFPDGGSLPRHPSQLYEAITEGLMIFLIMQLMVYRGSFKSPGL
FT                   TAGAFAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLVGVGMVFQSMNSK
FT                   SGSSFGK"
FT   gene            313384..313668
FT                   /locus_tag="CLIBASIA_01485"
FT   CDS_pept        313384..313668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56885"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ2"
FT                   /protein_id="ACT56885.1"
FT                   /translation="MSFRSNQFFQQASRLASCASDAFKDISKEAESFAQIKIQRTLNSM
FT                   GVVRAEEIENVKRTTSHLREEITAIGKRLEKIEQQLADLELFINQKEKE"
FT   gene            complement(313848..313924)
FT                   /locus_tag="CLIBASIA_t05707"
FT   tRNA            complement(313848..313924)
FT                   /locus_tag="CLIBASIA_t05707"
FT                   /product="tRNA-His"
FT   gene            314434..316896
FT                   /locus_tag="CLIBASIA_01490"
FT   CDS_pept        314434..316896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01490"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56886"
FT                   /db_xref="GOA:C6XHZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ3"
FT                   /protein_id="ACT56886.1"
FT                   /translation="MSTDSIISNPEDILTSNCKGNTQDLSKKKIDNGFETEKSKKENPC
FT                   HDSFEQSNFTDQNQESVSNTNYLDSENTFVFDPIPRTVRFTWNIDAHGYLKEISEELPK
FT                   TIGNYAFKMIGMRLCDVSDILHIDPNNHIGDLLKRQNTWYGKTTLWPIEGTNLYVPIDL
FT                   AALPIYSRNREFSGFRGFGIVHVNRVDNDPRALGKRLDKKFSHLHEIKKGHSSVEKEKY
FT                   DIFSQQSPPPHLRMKNKVSSLTEYYAHKDDVLKTEKYPLLTSEESSLPEQEDFHTINLN
FT                   QYTKKQYFGTLQNNSKESFEYLSHRNHPSLSAYFDEGENLTPETVDKCPIPFFVYSHGN
FT                   LFYANPSFLLLTKYKSVDDIEIAGGLSTLLDAPKLSDNNAIKPVMLYRSDRTCIAASAR
FT                   LHTIQWNRENSLAMTFIPFEKANQFPENMPQNGIEPEDVDTRINKRKMEIEVMQLCSIL
FT                   EATSDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEIL
FT                   SLDLRQTLEKITLGSTKEEKLLSLRIIIKKLPFSSCYSLTMHDISEWKQEKNKLSHAKK
FT                   IAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGN
FT                   LVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFANNI
FT                   PRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYEL
FT                   EKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFPLYD
FT                   TSHPHDCI"
FT   gene            complement(317028..318590)
FT                   /gene="guaA"
FT                   /locus_tag="CLIBASIA_01495"
FT   CDS_pept        complement(317028..318590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CLIBASIA_01495"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG0518 GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56887"
FT                   /db_xref="GOA:C6XHZ4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ4"
FT                   /protein_id="ACT56887.1"
FT                   /translation="MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDY
FT                   FKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ
FT                   SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFI
FT                   ADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGN
FT                   ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR
FT                   VVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESI
FT                   SFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCP
FT                   GPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDE
FT                   RTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATI
FT                   EWE"
FT   gene            complement(318755..320326)
FT                   /locus_tag="CLIBASIA_01500"
FT   CDS_pept        complement(318755..320326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01500"
FT                   /product="integral membrane protein TerC"
FT                   /note="COG0861 Membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56888"
FT                   /db_xref="GOA:C6XHZ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ5"
FT                   /protein_id="ACT56888.2"
FT                   /translation="MFFSWIYDYYVWIGLATLIALELVLGIDNLIFITLLVEKLPLAQR
FT                   GKALVFGLTFAMVTRIALLASLSYWIVMLQQPLFFLKGLSFSGRDIVLILGGFFLLFKG
FT                   TIELHERLEGDGFDKKHKFFSPVSWQVIVLQIVILDLVFSLDSVVTAIGMVQHFSVMAI
FT                   AVAVSALMMMAVSQPMIRYISRHTTVVILCLGFLLMIGFLLIIEGLHFDIPKGYLYASI
FT                   GFSGIIEFFNQVARRNREQLMSPSRLRARTADAVLRLLGGKPIQPQGLNVKADVLLPTQ
FT                   HEKHIISDQEKDMVQSVLTLADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRF
FT                   PVAQGSLDSFIGIVSARDLLRDLLEEGSMNFKRSIRKPLVVHENISVLKLMERLRKSSQ
FT                   TFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVRYAS
FT                   KLFGVNLVDEDDRYSTLAGFILWRLGHLPQEKEIFTEMNLKFEIIRLEGHNIDRVKVSG
FT                   LQNLSI"
FT   gene            320681..321022
FT                   /locus_tag="CLIBASIA_01505"
FT   CDS_pept        320681..321022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01505"
FT                   /product="putative ferredoxin protein"
FT                   /note="COG1146 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56889"
FT                   /db_xref="GOA:C6XHZ6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ6"
FT                   /protein_id="ACT56889.1"
FT                   /translation="MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGV
FT                   CEPECPVDAIKPDTEPGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYF
FT                   SPNPGGKNT"
FT   gene            321338..321904
FT                   /locus_tag="CLIBASIA_01510"
FT   CDS_pept        321338..321904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01510"
FT                   /product="transcriptional regulator CarD family protein"
FT                   /note="COG1329 Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56890"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ7"
FT                   /protein_id="ACT56890.1"
FT                   /translation="MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEF
FT                   FVIAFDKDKMCLKVPVGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYD
FT                   AKINSGDLIAIAEVVRDLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAIN
FT                   LIEVNLSSKSSKTEKSTSENQDKAA"
FT   gene            322246..322821
FT                   /locus_tag="CLIBASIA_01515"
FT   CDS_pept        322246..322821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01515"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /note="COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56891"
FT                   /db_xref="GOA:C6XHZ8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ8"
FT                   /protein_id="ACT56891.1"
FT                   /translation="MDQKECKLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIA
FT                   LSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTV
FT                   TVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHME
FT                   DIRLPEKTSSMSQLNITIATIVAPISGS"
FT   gene            complement(322902..324770)
FT                   /gene="aspS"
FT                   /locus_tag="CLIBASIA_01520"
FT   CDS_pept        complement(322902..324770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="CLIBASIA_01520"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0173 Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56892"
FT                   /db_xref="GOA:C6XHZ9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C6XHZ9"
FT                   /protein_id="ACT56892.1"
FT                   /translation="MHRYRTHSCGDLGVSDVGSFVRLSGWVHRVRPHGGIIFLDIRDHY
FT                   GITQVVANPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELSAQKIEIL
FT                   SVAEELPLPVFGEREYPESIRFKYRFLDLRRDTLHKNIVKRTRIINSMRCRMIAENFIE
FT                   CSTPILTASSPEGARDFLVPSRVNQGSFYALPQAPQQYKQLLMASGFDRYFQIAPCFRD
FT                   EDPRSDRLPGEFYQLDMEMSFVEQDDILNTMENVLRGVFEEFSNGNTVSNNFLRICYDD
FT                   AIRRYGTDKPDLRNPIIMHNVTEHFVHSEFRVFSKILSVNPGYEVWAIPAKGGGGNRAF
FT                   CDRMNEWARSQGQPGLAYIFWRLDESGNVAGMGPVAKHLNIVNTEAIRVRLDMQDGDSC
FT                   FFIAGDPLKFCSFAADARNHIAQELGIINCNCFEFCWIMDFPFYEWNEEEKKIDFAHNP
FT                   FTMPQGGMESLKGNDLLSIKAFQYDLVCNGFEIASGGIRNHMSEVMLQAFSNVGISKEV
FT                   VENRFGGLYRAFQCGMPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQNFCDLLMGSP
FT                   STVSVEQLRELGLRIVENPKKILKISVTTILRNVYGLKIIHSITLL"
FT   gene            complement(325252..326442)
FT                   /gene="carA"
FT                   /locus_tag="CLIBASIA_01525"
FT   CDS_pept        complement(325252..326442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="CLIBASIA_01525"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0505 Carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56893"
FT                   /db_xref="GOA:C6XI00"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI00"
FT                   /protein_id="ACT56893.1"
FT                   /translation="MTVTLPWTIKKPTAVLVLADGSVIEGMGCGATGSIQAEICFNTSL
FT                   TGYQEILTDPSYLGQIVNFTFPHIGNVGVNSEDFESISRKNFKGAVGLVIKAEITEPSN
FT                   YRANMHFDAWLKSCGIIGLSGIDTRALTVWIRDYGVSNSVIAHHPDGQFDLEDLKERAK
FT                   NWSGLKGAELAKHVTVSQRRDWSEKIWKWGEETSFLKSSDAKYHVVCIDYGIRSNLLRV
FT                   LSSLGCRITIVGAETSYKDIMSLQPDGVLLSNGPGDPAVTSVYSSPIICKLVDSGMPMF
FT                   GICLGHQLLGLALGAQTVKMYQGHHGVNHPVKNISNGTVEIVSMNHGFAIDASSLPAGL
FT                   EETHISLFDSSNCGFRLIDQPVFSVQYHPESSPGPQDSYYLFSTFIDFMHKRKTMC"
FT   gene            326801..327457
FT                   /locus_tag="CLIBASIA_01530"
FT   CDS_pept        326801..327457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01530"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56894"
FT                   /db_xref="GOA:C6XI01"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI01"
FT                   /protein_id="ACT56894.1"
FT                   /translation="MESNNDANSYKGKCKMGKCCYKWIAPLLILMILSLAIWFYLFDGS
FT                   HEKKKNIVGENFAQALELFNSNKLDDARSSFEKILSQDNKLYNPLSNMYIASILVAKGD
FT                   TKNAAEIFLKVANDDLAPLAVRYAATLQAASILVDTSSYEEISKILQKLSEPSNPMHQF
FT                   ANEILGISALKFGKVQKAKTIFEELAKDNNSPFGISTRSQMILANIIASDQRNKK"
FT   gene            327468..328880
FT                   /gene="engA"
FT                   /locus_tag="CLIBASIA_01535"
FT   CDS_pept        327468..328880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="CLIBASIA_01535"
FT                   /product="GTP-binding protein EngA"
FT                   /note="COG1160 Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56895"
FT                   /db_xref="GOA:C6XI02"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI02"
FT                   /protein_id="ACT56895.2"
FT                   /translation="MIYTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQA
FT                   IINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAIT
FT                   SFLRKKNIPIIIVSNKMDTRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIF
FT                   KQKYPNHPLEMIENNKRNEESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINR
FT                   LLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQ
FT                   SVRTCETTIVLLDATIPFEKQDLRIVDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTK
FT                   AIKNLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNP
FT                   PPTIFNRYNRLKYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIRM
FT                   CFQSSKNPYIKK"
FT   gene            complement(329734..330975)
FT                   /gene="metK"
FT                   /locus_tag="CLIBASIA_01540"
FT   CDS_pept        complement(329734..330975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="CLIBASIA_01540"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG0192 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56896"
FT                   /db_xref="GOA:C6XI03"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI03"
FT                   /protein_id="ACT56896.1"
FT                   /translation="MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNS
FT                   VRVACEVLVTKNKVIVAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQE
FT                   GFHWETVDVEVLLHSQSSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIY
FT                   YAHRILRTLADARKNSGGDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDR
FT                   GKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGAS
FT                   PHGGGAFSGKDITKVDRAAAYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDL
FT                   HDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWE
FT                   ALDLIEPLKKAIGF"
FT   gene            complement(331060..331494)
FT                   /locus_tag="CLIBASIA_01545"
FT   CDS_pept        complement(331060..331494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01545"
FT                   /product="transcriptional regulator protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56897"
FT                   /db_xref="GOA:C6XI04"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI04"
FT                   /protein_id="ACT56897.1"
FT                   /translation="MVGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQ
FT                   KYEKGVNRVGASRLQHISEVLESPISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLN
FT                   RYFIQIDDVKVRQKIIELVRSIVSSEKKYRTIEEECMVEQ"
FT   gene            complement(331628..333184)
FT                   /gene="lnt"
FT                   /locus_tag="CLIBASIA_01550"
FT   CDS_pept        complement(331628..333184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="CLIBASIA_01550"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="COG0815 Apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56898"
FT                   /db_xref="GOA:C6XI05"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI05"
FT                   /protein_id="ACT56898.1"
FT                   /translation="MGNIAGKVMLLSGFRRCFIAILAGVIGSFSMPSSDLFLSSFVSFT
FT                   LLIWLLDGISSNLGRMSAISRVGSSFFVGWLFGVGYFLAGLWWVREGIVDQIGSRFPFW
FT                   GVVLFFVMISFLLAIFYGVATSLASLLWSTGMGRICVFACAVGFCEWLRSVLGIGTWNA
FT                   IGYAAMPIPVMMQSVHWIGLFGMNALSVFCFASPALFGTRRDVNIGIILSSTLLILHIA
FT                   YGWWILTEDSKSSLKFEKISPVIRIVQPGINPAIKEDREKILERYLSLTALPVSAGELE
FT                   PVIIVWAYLPFPFSIVDQPSILKKIASVLKINQLLIVGSMRKELVDGRSHFYKSIYIIN
FT                   SKGEILASSNAKHLVPFAEYLPYRNILKKLNLDFYMFPLDYSSSDISPLLGLSEKLRLY
FT                   PLLFSDALFHQDINNLENVSAILNIIDDSGFMGSGTDHSFRYAQIQAVEIGLPLIRATN
FT                   NGVSAFLDERGQIISSVYADRGASIDMHFQPKVRDSFRSSIQMRVFWIIEFILLILAVI
FT                   V"
FT   gene            complement(333266..334228)
FT                   /locus_tag="CLIBASIA_01555"
FT   CDS_pept        complement(333266..334228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01555"
FT                   /product="hemolysin protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56899"
FT                   /db_xref="GOA:C6XI06"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI06"
FT                   /protein_id="ACT56899.1"
FT                   /translation="MMSDFKINSSEHPKEKNEGIDLSPSISKTSVPAFWTRTIRALCKT
FT                   WKLMKLSHHKGIRLPRIDASLEGIFSETEKEIFNNILRFRKIRIDDIMISRVSINAVED
FT                   KATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLS
FT                   ESNLIKNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDIT
FT                   SEHHSKKSMISAVSDNTFIVDARTDLEELAKIIGTDCNCLKGEQDVDSLGGLIFSVLDR
FT                   IPARGEVVLEIPGFEIVILDADVRCVRRVRIRRLVHFKN"
FT   gene            complement(334246..334761)
FT                   /locus_tag="CLIBASIA_01560"
FT   CDS_pept        complement(334246..334761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01560"
FT                   /product="hypothetical protein"
FT                   /note="COG0319 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56900"
FT                   /db_xref="GOA:C6XI07"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI07"
FT                   /protein_id="ACT56900.1"
FT                   /translation="MSVKKVNLPRLDLQIAVENALWGDEIHLRTLCEVVFAKAVSNLIS
FT                   KGYFVKENIVELSLVFTDSHRIETLNFEYRGIDKPTNVLSFPTAFASSDGCSSLMLGDI
FT                   VLAYEIIEIEANVLGKEFENHLVHLIIHGFLHLLGYDHVDDKDACVMEGLERSILEDLG
FT                   INDPYEVD"
FT   gene            complement(335013..336422)
FT                   /gene="miaB"
FT                   /locus_tag="CLIBASIA_01565"
FT   CDS_pept        complement(335013..336422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="CLIBASIA_01565"
FT                   /product="2-methylthioadenine synthetase (miaB-like)
FT                   protein"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56901"
FT                   /db_xref="GOA:C6XI08"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI08"
FT                   /protein_id="ACT56901.2"
FT                   /translation="MGLFIKLIGVAHMVSQIVDQCIVPQRFFVKSYGCQMNVYDSLRME
FT                   DMFFSQGYERVNSMDDADLIVLNTCHIREKAAEKVYSFLGRIRNLKNSRIKEGGDLLVV
FT                   VAGCVAQAEGEEILRRSPIVNVVVGPQTYYRLPELLERARFGKRVVDTDYSVEDKFERL
FT                   SIVDGGYNRKRGVTAFLTIQEGCDKFCTFCVVPYTRGIEISRSLSQVVDEARKLIDNGV
FT                   CEITLLGQNVNAWRGKGLDGEKCTFSDLLYSLSEIKGLVRLRYTTSHPRDMSDCLIKAH
FT                   GDLDVLMPYLHLPVQSGSDRILKSMNRRHTAYEYRQIIDRIRSVRPDIAISSDFIVGFP
FT                   GETDDDFRATMDLVDKIGYAQAFSFKYSPRLGTPGSNMLEQVDENVKAERLLCLQKKLR
FT                   EQQVSFNDACVGQIIEVLIEKHGKEKGKLVGRSPWLQSVVLNSKNHNIGDIIKVRITDV
FT                   KISTLYGELVV"
FT   gene            complement(336568..337188)
FT                   /locus_tag="CLIBASIA_01570"
FT   CDS_pept        complement(336568..337188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01570"
FT                   /product="hypothetical protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56902"
FT                   /db_xref="GOA:C6XI09"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI09"
FT                   /protein_id="ACT56902.1"
FT                   /translation="MIVLALDTTGADCSVAIYDSHAGRILGSYFKNLGRGHAEHLMPAI
FT                   DYALKDSRLEVSQVDRVVTALGPGSFTGVRVSIAVARGISLVLKQPALGVGNLEVLARA
FT                   HLDSHVGRPIMVLVSLFHQKVCCQKFSLDGVSCSDPVLLNYEQTRSEVDNFEGEIVGSG
FT                   LSAIRGIENDIDHLPMDVLSRLGITKSSPFPSPIYLRSPCFLV"
FT   gene            complement(337204..337773)
FT                   /locus_tag="CLIBASIA_01575"
FT   CDS_pept        complement(337204..337773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01575"
FT                   /product="nitrogen fixation protein"
FT                   /note="COG0694 Thioredoxin-like proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56903"
FT                   /db_xref="GOA:C6XI10"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI10"
FT                   /protein_id="ACT56903.1"
FT                   /translation="MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRI
FT                   FSIPGIASVYFGYDFITVGKDQYDWEHLRPPVLGMIMEHFISGDPIIHNGGLGDMKLDD
FT                   MGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPS
FT                   ASETLKYGVANILNHFVPEVKDIRTV"
FT   gene            complement(337920..338456)
FT                   /locus_tag="CLIBASIA_01580"
FT   CDS_pept        complement(337920..338456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56904"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C6XI11"
FT                   /protein_id="ACT56904.1"
FT                   /translation="MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFL
FT                   SNRVKVNENKQSDGNRKNVTLGSTSPKTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEK
FT                   NNTISSGIVLPISRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLA
FT                   YQRVNDRRKVQANSE"
FT   gene            338777..339955
FT                   /gene="argD"
FT                   /locus_tag="CLIBASIA_01585"
FT   CDS_pept        338777..339955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="CLIBASIA_01585"
FT                   /product="acetylornithine transaminase protein"
FT                   /EC_number="2.6.1.11"
FT                   /note="COG4992 Ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56905"
FT                   /db_xref="GOA:C6XEV3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV3"
FT                   /protein_id="ACT56905.1"
FT                   /translation="MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNS
FT                   LGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVEC
FT                   AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF
FT                   CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY
FT                   GRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLA
FT                   MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS
FT                   PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH"
FT   gene            340008..340928
FT                   /gene="argF"
FT                   /locus_tag="CLIBASIA_01590"
FT   CDS_pept        340008..340928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="CLIBASIA_01590"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COG0078 Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56906"
FT                   /db_xref="GOA:C6XEV4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV4"
FT                   /protein_id="ACT56906.2"
FT                   /translation="MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGK
FT                   VLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIV
FT                   MRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGN
FT                   NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVF
FT                   TDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQ
FT                   SVVFDEAENRLHTQKAILLWCFGII"
FT   gene            341066..342154
FT                   /gene="pyrD"
FT                   /locus_tag="CLIBASIA_01595"
FT   CDS_pept        341066..342154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="CLIBASIA_01595"
FT                   /product="dihydroorotate dehydrogenase 2"
FT                   /EC_number="1.3.98.1"
FT                   /note="COG0167 Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56907"
FT                   /db_xref="GOA:C6XEV5"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV5"
FT                   /protein_id="ACT56907.1"
FT                   /translation="MLSILHKLALRGLTHLDPEIAHHLSIVALKSGLLSFFPVHSDPRL
FT                   NTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLT
FT                   KDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTI
FT                   ASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSE
FT                   EELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIR
FT                   QRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNK
FT                   ENEVNFENIRGSYTEYWAKKEV"
FT   gene            342347..343357
FT                   /locus_tag="CLIBASIA_01600"
FT   CDS_pept        342347..343357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01600"
FT                   /product="peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56908"
FT                   /db_xref="GOA:C6XEV6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV6"
FT                   /protein_id="ACT56908.1"
FT                   /translation="MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAEN
FT                   YPDHPWNPASLTKLMTAYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTL
FT                   DNALKLLIVKSANDIAVAIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGH
FT                   YTTARDMAILSWRIKTDFPQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTC
FT                   ASGFNIVASAIQGDQSLIAVILGALDRNTRNKVSASLLSMGFYNKTDRKKINYIIKDFY
FT                   QQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHFIDFEKITLLKNKITKK"
FT   gene            complement(343577..344473)
FT                   /locus_tag="CLIBASIA_01605"
FT   CDS_pept        complement(343577..344473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01605"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56909"
FT                   /db_xref="GOA:C6XEV7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV7"
FT                   /protein_id="ACT56909.1"
FT                   /translation="MYLPSWISDKFGCGFLRSSKRRGYYSLLSVLVVSVILLIEGCSSL
FT                   FPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYK
FT                   VYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFD
FT                   RAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATK
FT                   NYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNG
FT                   ILRISQDLSSTVNEVNE"
FT   gene            complement(344500..344787)
FT                   /gene="rpsU"
FT                   /locus_tag="CLIBASIA_01610"
FT   CDS_pept        complement(344500..344787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="CLIBASIA_01610"
FT                   /product="30S ribosomal protein S21"
FT                   /note="COG0828 Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56910"
FT                   /db_xref="GOA:C6XEV8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV8"
FT                   /protein_id="ACT56910.1"
FT                   /translation="MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGV
FT                   LRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR"
FT   gene            345013..345798
FT                   /gene="pdxJ"
FT                   /locus_tag="CLIBASIA_01615"
FT   CDS_pept        345013..345798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="CLIBASIA_01615"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /note="COG0854 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56911"
FT                   /db_xref="GOA:C6XEV9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEV9"
FT                   /protein_id="ACT56911.1"
FT                   /translation="MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHP
FT                   RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQ
FT                   LTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTG
FT                   PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISV
FT                   GHAFAATALECGVKEAVFCFRRACGQHLDNTMRLTHPVK"
FT   gene            346164..349652
FT                   /gene="carB"
FT                   /locus_tag="CLIBASIA_01620"
FT   CDS_pept        346164..349652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="CLIBASIA_01620"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="COG0458 Carbamoylphosphate synthase large subunit
FT                   (split gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56912"
FT                   /db_xref="GOA:C6XEW0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW0"
FT                   /protein_id="ACT56912.1"
FT                   /translation="MPKRQDLKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGYRII
FT                   LVNSNPATIMTDPDLADATYTEPITPEVVAKIIEKERPDAILPTTGGQTALNTALSLKR
FT                   MGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLATPKSILANATDIKEHDRKLHE
FT                   EERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQALDEIGLPLIIR
FT                   PSFTLGGTGGGIAYNRSEFLEIVENGLHASPTTEVLIEESVLGWKEYELEMMRDIKGNC
FT                   IVVCSIENLDPMGVHTGDSITVAPALTLTDKEYQLMRNAAIAVLKEIGVESGGANVQFA
FT                   VNPKNGKMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELGNDITGGKTPA
FT                   SFEPSIDYIVTKIPRFTFEKFPGSDVTLTTSMKSVGEVMAIGRTFAESLQKALRGLETG
FT                   LTGLDEIHIPSMESDNDPNALRSAISIPCPDRLRTVAQALRLGVSVEETHQSSNIDPWF
FT                   IQQIKMIVDVEHRIREHGLPKDFQNLQAIKAMGFSDARLSILSGIPCNEIRKIRHQMGL
FT                   HPVFKCVDTCAGEFSSPTSYMYSTYETNFINKPVSEDKVSDRKKIVILGGGPNRIGQGI
FT                   EFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDIADRLYFESLTEEDILEILRVEQQ
FT                   KGELVGIIVQFGGQTPLKLSKILEKNQIPILGTQPDSIDLAEDRDRFQKLLMELDLNQP
FT                   RNGISHSVEHARLIACEIGFPLLIRPSYVLGGRAMQIVYSENMLQDYLLDTLPGLVSEE
FT                   IKRQYPNDKTGQINTLLGTHPLLFDSYLSDAMEIDVDALCQNDQVIVVGIIEHIEEAGI
FT                   HSGDSACSLPSRSLSQQLKDELISQTKALAGALNVIGLINVQYAIKDGKIYILEVNPRA
FT                   SRTVPFIAKAIGFPVAKVAARIIAGESLDASIAAYGKRPDLSQIKHFAVKESVFPFNKF
FT                   PGVDILLGPEMRSTGEVIGIDQDFPLAFAKSQLGIGVDLPHEGTVFVSVRDADKKRIVP
FT                   IIQNFKKLGFKIMATEGTARFLESHGLETQKINKVLEGRPHIEDAISNRQVHLVINTTE
FT                   GKKAIEDSKSLRRATLIRKIPYYTTIAGADAVFQAIQALKAGNLEVHSLQSYRYN"
FT   gene            349818..350294
FT                   /gene="greA"
FT                   /locus_tag="CLIBASIA_01625"
FT   CDS_pept        349818..350294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="CLIBASIA_01625"
FT                   /product="transcription elongation factor GreA"
FT                   /note="COG0782 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56913"
FT                   /db_xref="GOA:C6XEW1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW1"
FT                   /protein_id="ACT56913.1"
FT                   /translation="MVDKIPVTSKGFDKIQQELRWRQQEERPRIIKAISEARAYGDLSE
FT                   NAEYQAAKELQNLNEGRMAELENIITRAEVIDISTMSGDRIAFGATVSLVEKNSGDKKN
FT                   YQIVGDQEADVQSGLVSISSPIARALIGKELGDIISVNAPGGEKTYEILQVLWI"
FT   gene            350327..351385
FT                   /locus_tag="CLIBASIA_01630"
FT   CDS_pept        350327..351385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01630"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56914"
FT                   /db_xref="GOA:C6XEW2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW2"
FT                   /protein_id="ACT56914.2"
FT                   /translation="MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCL
FT                   PKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQR
FT                   NHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKIS
FT                   EDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIY
FT                   ANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFS
FT                   ELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASD
FT                   IGKVYDRLLRTA"
FT   gene            complement(351433..352875)
FT                   /gene="pykA"
FT                   /locus_tag="CLIBASIA_01635"
FT   CDS_pept        complement(351433..352875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="CLIBASIA_01635"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COG0469 Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56915"
FT                   /db_xref="GOA:C6XEW3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW3"
FT                   /protein_id="ACT56915.1"
FT                   /translation="MVNLRRIKIISTLGPSSFSEDVINRLHEEGTDVFRINMSHTSHDK
FT                   MCELIKKIRAVELRSRRPIGILIDLQGPKFRVGKFANSKVDLTEGQIFTLDNKDSLGSS
FT                   DRVMLPHPEIFASIKIGDRLLIDDGRVKLCVQEKGIGFIKCKVIAGISIADRKGISFPD
FT                   TFLTTQALTQKDREDLHAALQTCEVDWVALSFIQSADDLLEIRKIISQNKIGLMSKIEK
FT                   PRAIEYASEIIQLSDAVMVARGDLGVEMALELIPGIQKKLIRIARQLGKPVVIATQMLE
FT                   SMVTSPFPTRAEVSDVATAVFEEADAIMLSAETASGSYPVDAVRTMSLVASSAERDSSW
FT                   LEMRSLRRIEPNETGADVISSAARQIAETLRLSAIFCYTASGATGLRAARERPKLEIIA
FT                   LSPMIQTARRLALVWGIHCVVTEDASDSDDMVNRACRIVVEQGFGKPGDRIIISAGLPL
FT                   GTPGSTNMLRIAYIGADGLSGM"
FT   gene            complement(352878..353303)
FT                   /locus_tag="CLIBASIA_01640"
FT   CDS_pept        complement(352878..353303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01640"
FT                   /product="hypothetical protein"
FT                   /note="COG5480 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56916"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW4"
FT                   /protein_id="ACT56916.1"
FT                   /translation="MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVK
FT                   GGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVD
FT                   IKNCYTRGYLRVGFTEYDTGQHENWTVQLTEPAQDRR"
FT   gene            354092..354763
FT                   /locus_tag="CLIBASIA_01645"
FT   CDS_pept        354092..354763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01645"
FT                   /product="bacteriophage repressor protein C1"
FT                   /note="COG1158 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56917"
FT                   /db_xref="GOA:C6XEW5"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW5"
FT                   /protein_id="ACT56917.1"
FT                   /translation="MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG
FT                   IEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF
FT                   DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI
FT                   QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS
FT                   Q"
FT   gene            354946..357837
FT                   /gene="ileS"
FT                   /locus_tag="CLIBASIA_01650"
FT   CDS_pept        354946..357837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="CLIBASIA_01650"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG0060 Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56918"
FT                   /db_xref="GOA:C6XEW6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW6"
FT                   /protein_id="ACT56918.1"
FT                   /translation="MNSESKANYSGTLYLPRTDFPMRAKLPQKESELITYWQKIRLFDK
FT                   IRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHG
FT                   LPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDFENPYT
FT                   TMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLAEAEIEYHDVDSDSILVGF
FT                   PVKSSADYLIKSQIVIWTTTPWTIPGNRAIAFSSNHQYGLYDVISCSGQHTFDTGKKLI
FT                   ISKNLAQSIANQTNVKIALVCDVKAEDLSKTMCSHPLKKLGYTFSVPLIDAEYVANDCG
FT                   TGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSPVDGRGFYTTEAPGFSGARVLDD
FT                   AGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGD
FT                   GSTLRSRALSEVEKIRFFPSSGKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEIL
FT                   LDKAINDRIIKTFKDQGSDAWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTIL
FT                   LGKDPKLAWPADVYLEGSDQHRGWFQHSLLESCATRGSTPFTSLITHGFSVDENGEKMS
FT                   KSKGNVVFPEEIISESGADVLRYWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRWML
FT                   GMLAHDTGNEPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELS
FT                   SFYFDIRKDSLYCDSPSSLKRLSSIAVIRILCRHLIIWIAPILPFTAEEAWLSLNPEAV
FT                   SVHLELFPIIPLEWQNACLSKKWGKILQLRKVVTSALEIERKAKHIGSSLETAPTLYIT
FT                   DSSLISNIEGENLAEICITSDITIVHSNGPTDAFRLSDVPNVSVQCLKAEGKKCARSWR
FT                   VTKDVGLDASYPDVSARDAAVLHELGYPKNSNV"
FT   gene            complement(358257..358772)
FT                   /locus_tag="CLIBASIA_01655"
FT   CDS_pept        complement(358257..358772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56919"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW7"
FT                   /protein_id="ACT56919.1"
FT                   /translation="MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDG
FT                   LVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTK
FT                   EILNEKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEI
FT                   QNNWIRCY"
FT   gene            complement(359267..359410)
FT                   /locus_tag="CLIBASIA_01660"
FT   CDS_pept        complement(359267..359410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56920"
FT                   /db_xref="GOA:C6XEW8"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW8"
FT                   /protein_id="ACT56920.1"
FT                   /translation="MLMHASLMHVNVLWEGWLSIGVTTDLLSKFAAGSFLFILLLRAFS
FT                   DF"
FT   gene            359409..360344
FT                   /locus_tag="CLIBASIA_01665"
FT   CDS_pept        359409..360344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56921"
FT                   /db_xref="GOA:C6XEW9"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEW9"
FT                   /protein_id="ACT56921.1"
FT                   /translation="MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLV
FT                   RGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGA
FT                   KELISASQNSQTVTQTGNISDATKASSTIKDAQSIDRSQAIFQKMPLEEYPRLQKIGIN
FT                   YFRDFKLLGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLI
FT                   SSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLN
FT                   GSLHRNYGIKAEGILSRNAPPELHFSSYVN"
FT   gene            360594..361973
FT                   /locus_tag="CLIBASIA_01670"
FT   CDS_pept        360594..361973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56922"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX0"
FT                   /protein_id="ACT56922.1"
FT                   /translation="MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQV
FT                   RELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAAL
FT                   LIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGIT
FT                   SIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISK
FT                   INSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKI
FT                   PFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKL
FT                   ARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSA
FT                   SKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYL
FT                   K"
FT   gene            362702..365113
FT                   /locus_tag="CLIBASIA_01675"
FT   CDS_pept        362702..365113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01675"
FT                   /product="two-component sensor histidine kinase/response
FT                   regulator hybrid protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56923"
FT                   /db_xref="GOA:C6XEX1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX1"
FT                   /protein_id="ACT56923.1"
FT                   /translation="MLAIVGILLLLLLAIGSIEMTIKPKIPLETIFMDSEPEGILITNE
FT                   RGHIIYANNAYNALTNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRL
FT                   MQSLNNYSQNSEPHWYRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAI
FT                   DYLDHSPVGFMSADHQGKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAI
FT                   RTEPSHQKITTLDLDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDP
FT                   SGTIANMRFNRFFNNIPMAIASIDKKGRILRTNAHFLKLFPNCTEGDGTSNDIFSIVHK
FT                   NEKRKIIAALYDANDQKSDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTV
FT                   EITEQKALEARMAQTQKLNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFAD
FT                   LMEIKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTV
FT                   DYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDL
FT                   PTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILP
FT                   ESEVGKGTIFRIFLPRYVQEHTQESHYSHDIAIIPQEEPADLTGNSAIVLLVEDEDSVR
FT                   RGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTY
FT                   PSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQSDS"
FT   gene            complement(365407..368097)
FT                   /gene="acnA"
FT                   /locus_tag="CLIBASIA_01680"
FT   CDS_pept        complement(365407..368097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="CLIBASIA_01680"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1048 Aconitase A"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56924"
FT                   /db_xref="GOA:C6XEX2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX2"
FT                   /protein_id="ACT56924.1"
FT                   /translation="MSRSLNSFNCRSILSVGGIDYVYYSLPKAEANGLQGISRLPCSMK
FT                   VLLENLLRFEDGCTVTKEQIHAFVKWLDNKGTVESEVSYRFSRVLMQDFTGVPAVVDLA
FT                   AMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTRNKDLEYQRNEERYRFL
FT                   KWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENGENIAYPDTCVGTDSHTTMIN
FT                   ALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSLQEGVTATDLVLTITQMLRKE
FT                   GVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFPVDRGTIDYLRLSGRSNSRV
FT                   DLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAGPRRPESRLSLSEVPSSFV
FT                   TEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNTFNPSVMIGAGLLARNAV
FT                   RAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVGFGCTTCIGNSGALKKE
FT                   ISEVIHQKSLVVAGVLSGNRNFEGRISPDVEANYLLSPPLVVAYALAGNVRKNLIKDPI
FT                   GEDQQGSPVYLRDIWPKDSEIQSFVNKYVTCDLYKKKYSDVFKGDSSWWNIEVPESETY
FT                   MWDEKSTYVRNPPYFETISKHIPEIVDICGARILCLLGDKITTDHISPAGSIPLQSAAA
FT                   SYLRQRGVKEKDFNQFGTRRGNHEVMMRGTFSNIRICNYMLGEEGKKGGYTIHYPSKEE
FT                   LFIYDAAMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNL
FT                   IGMGVIPFAFGKGISWKNLNIKGDEIINIRKLKTISPRQESTLEIHYSDGTFKCVPIIC
FT                   CIDTLDEINHLKNGGILQAVLRQLS"
FT   gene            complement(368330..369109)
FT                   /locus_tag="CLIBASIA_01685"
FT   CDS_pept        complement(368330..369109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01685"
FT                   /product="hypothetical protein"
FT                   /note="COG0670 Integral membrane protein, interacts with
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56925"
FT                   /db_xref="GOA:C6XEX3"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX3"
FT                   /protein_id="ACT56925.1"
FT                   /translation="MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGI
FT                   MSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLH
FT                   SLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDL
FT                   GPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR
FT                   YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD"
FT   gene            complement(369502..370218)
FT                   /gene="pyrE"
FT                   /locus_tag="CLIBASIA_01690"
FT   CDS_pept        complement(369502..370218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CLIBASIA_01690"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="COG0284 Orotidine-5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56926"
FT                   /db_xref="GOA:C6XEX4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX4"
FT                   /protein_id="ACT56926.1"
FT                   /translation="MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGY
FT                   HLSFSGGLELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMR
FT                   SAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSP
FT                   QEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAAD
FT                   PVSAAQEFQRAISLIS"
FT   gene            complement(370373..371530)
FT                   /gene="dnaA"
FT                   /locus_tag="CLIBASIA_01695"
FT   CDS_pept        complement(370373..371530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CLIBASIA_01695"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56927"
FT                   /db_xref="GOA:C6XEX5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX5"
FT                   /protein_id="ACT56927.1"
FT                   /translation="MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIK
FT                   ASGPEIEITGAIPASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHG
FT                   DSNFYLQSFPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH
FT                   INEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVS
FT                   LSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSV
FT                   RIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDE
FT                   VVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI"
FT   gene            371850..373106
FT                   /locus_tag="CLIBASIA_01700"
FT   CDS_pept        371850..373106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01700"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COG1488 Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56928"
FT                   /db_xref="GOA:C6XEX6"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX6"
FT                   /protein_id="ACT56928.1"
FT                   /translation="MKEYFSTSDPIISSLLDTDFYKILMLQLIWKFYPDIKVTFSLFNR
FT                   QTQLHLSDKIDESELRTQLDHVRSLRITEKERKWLVENSFYGKKQLFEPKFLSWLSDFQ
FT                   LPEYDLSHKKGQYVLNFHGLWKDVTLWEIPSLIIISTLYSRITVRSMNPFSVDLLYAQA
FT                   KKKLWSKIIKLKNFSGLKIVDFGTRRRHSLTWQKWCIEALQEGIKDSFLGTSNALLAMN
FT                   YKINAIGTSAHELPMVAAAITRTDIETQNAPYQMMQQWNRLYDDNLLIVLPDSFGTDFF
FT                   LEHAPSWMTQWKGFRHDSASPIEGGEKIIAWWKKMNCNPQNKFLVFSDNLDVDSIIYTY
FT                   KHFENRVQMIFGWGTNLTNDFDGCTPYQNLQTEKLQIVCKVTKANDKHAVKLSDDPAKT
FT                   TGDISEIKRYLKIFKIKKS"
FT   gene            complement(373283..373374)
FT                   /locus_tag="CLIBASIA_t05709"
FT   tRNA            complement(373283..373374)
FT                   /locus_tag="CLIBASIA_t05709"
FT                   /product="tRNA-Ser"
FT   gene            complement(373449..375179)
FT                   /gene="rpsA"
FT                   /locus_tag="CLIBASIA_01705"
FT   CDS_pept        complement(373449..375179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="CLIBASIA_01705"
FT                   /product="30S ribosomal protein S1"
FT                   /note="COG0539 Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56929"
FT                   /db_xref="GOA:C6XEX7"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX7"
FT                   /protein_id="ACT56929.1"
FT                   /translation="MSFTNPSREDFATLLEESFTKKDLAENCVTKGIVVGLEKDTVVVD
FT                   VGLKFEGRIPRREFMGKGQYTPIKVGDEVEVYVERTENSFGEAVFSRDKALREGVWEKI
FT                   EAKFRAGERIEGVIFNQVKGGMTVDLNGEVAFLPRSQIDIRPVRDVTPLMHEPQLFEIL
FT                   KMDKRRGNIVVSRRAVLEESRAEQRSEIVQKLEEGQVIEGTVKNITDYGVFVDLSGVDG
FT                   LLHVTDIAWHRILHPSKVLSIGQQVKVKIIRINQETHRISLGMKQLEKNPWDDVQDKYV
FT                   EGSKVSGVVTNLTDYGVFVELQSGIEGLAHISQISWTKKNIHPSKILSVGQQVEVVILE
FT                   VNPARKRISLGLKQALINPWEEFSKSHPPGTEVEGEVKNKTDFGLFIGLDEHLDGMIHL
FT                   SDLDWNRPGEKVIAEYAKGDIVKAVVLDIDVGKERISLGVKQLSGSAPDVVDSVSSLRK
FT                   NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVN
FT                   VSKKDGKVSLSIKALEIAEEKGAVAQFGSSDSGASLGDILGMALKNRGNDAGDSNDNQG
FT                   "
FT   gene            complement(375319..375972)
FT                   /gene="cmk"
FT                   /locus_tag="CLIBASIA_01710"
FT   CDS_pept        complement(375319..375972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="CLIBASIA_01710"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56930"
FT                   /db_xref="GOA:C6XEX8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX8"
FT                   /protein_id="ACT56930.1"
FT                   /translation="MGRLESQSIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRA
FT                   VAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANVASQVASIDSVRDALID
FT                   IQRSFAQNKLGVILDGRDIGTIIFPDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVK
FT                   ILEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLIDTKLDNS"
FT   gene            complement(375960..377309)
FT                   /gene="aroA"
FT                   /locus_tag="CLIBASIA_01715"
FT   CDS_pept        complement(375960..377309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="CLIBASIA_01715"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COG0128 5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56931"
FT                   /db_xref="GOA:C6XEX9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEX9"
FT                   /protein_id="ACT56931.1"
FT                   /translation="MSFVCKKSTIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGET
FT                   QIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPEYPLDFKGFDMGYG
FT                   LMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPN
FT                   PIVYKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEIILKEFGVDLLIKSDTIE
FT                   DYSVRIEGRKRISGCNLKIPGDSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDIL
FT                   REMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIVDEYPILLVISAFAEG
FT                   ETIIKGLAEVMTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSK
FT                   FGYRVAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGARIEWVD"
FT   gene            377508..377897
FT                   /locus_tag="CLIBASIA_01720"
FT   CDS_pept        377508..377897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56932"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY0"
FT                   /protein_id="ACT56932.1"
FT                   /translation="MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPT
FT                   SPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFL
FT                   EQNDTDTDTDVVDMDISIPDDADEN"
FT   gene            378004..378079
FT                   /locus_tag="CLIBASIA_t05711"
FT   tRNA            378004..378079
FT                   /locus_tag="CLIBASIA_t05711"
FT                   /product="tRNA-Ala"
FT   gene            378564..379082
FT                   /gene="fabA"
FT                   /locus_tag="CLIBASIA_01725"
FT   CDS_pept        378564..379082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="CLIBASIA_01725"
FT                   /product="3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56933"
FT                   /db_xref="GOA:C6XEY1"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY1"
FT                   /protein_id="ACT56933.1"
FT                   /translation="MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISE
FT                   TGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKG
FT                   RAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRV
FT                   CLTIDRGVT"
FT   gene            379126..380346
FT                   /gene="fabB"
FT                   /locus_tag="CLIBASIA_01730"
FT   CDS_pept        379126..380346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="CLIBASIA_01730"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0304 3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56934"
FT                   /db_xref="GOA:C6XEY2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY2"
FT                   /protein_id="ACT56934.1"
FT                   /translation="MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFR
FT                   CQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGS
FT                   GGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACA
FT                   TSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYD
FT                   SRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMR
FT                   QALSSVEEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQ
FT                   EAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATL
FT                   VFRRYKG"
FT   gene            380351..381154
FT                   /gene="fabI"
FT                   /locus_tag="CLIBASIA_01735"
FT   CDS_pept        380351..381154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="CLIBASIA_01735"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="COG0623 Enoyl-[acyl-carrier-protein] reductase
FT                   (NADH)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56935"
FT                   /db_xref="GOA:C6XEY3"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY3"
FT                   /protein_id="ACT56935.1"
FT                   /translation="MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESI
FT                   GKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGP
FT                   YYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAK
FT                   SALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSL
FT                   EDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN"
FT   gene            381619..383640
FT                   /locus_tag="CLIBASIA_01740"
FT   CDS_pept        381619..383640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01740"
FT                   /product="putative peptidoglycan binding protein"
FT                   /note="COG0556 Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56936"
FT                   /db_xref="GOA:C6XEY4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY4"
FT                   /protein_id="ACT56936.1"
FT                   /translation="MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEK
FT                   NKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNL
FT                   LRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSK
FT                   SITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNL
FT                   HEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKG
FT                   VLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAK
FT                   PRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLK
FT                   DNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVH
FT                   AEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCS
FT                   DNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSP
FT                   HDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTK
FT                   YITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS"
FT   gene            complement(383792..385066)
FT                   /locus_tag="CLIBASIA_01745"
FT   CDS_pept        complement(383792..385066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01745"
FT                   /product="M16 family peptidase"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56937"
FT                   /db_xref="GOA:C6XEY5"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY5"
FT                   /protein_id="ACT56937.1"
FT                   /translation="MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMA
FT                   HFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGD
FT                   MLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETI
FT                   SSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY
FT                   VGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLC
FT                   YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHA
FT                   KLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLA
FT                   ILGPPMDHVPTTSELIHALEGFRSM"
FT   gene            complement(385056..386465)
FT                   /gene="thrC"
FT                   /locus_tag="CLIBASIA_01750"
FT   CDS_pept        complement(385056..386465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="CLIBASIA_01750"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COG0498 Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56938"
FT                   /db_xref="GOA:C6XEY6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY6"
FT                   /protein_id="ACT56938.1"
FT                   /translation="MKYISTRNVDLSLGFCDTILSGLATDGGLYIPKYIPRLSEKEIKD
FT                   LRGLSYQEIALFIFRLFIGQEIKSSKLRDIVNRSYHCFRNAAVTPLIQLNANEFLLELF
FT                   HGPTLSFKDIAMQFIAELMDHILEERDHYITIVGATSGDTGAAAIKAFAGKKRINMYIL
FT                   FPEGRISVVQQKQMTTSEASNINVIAVQSSFDDCQKIVKNLFSDVFFCHSVNLSGINSI
FT                   NWARIMAQIVYYFVSSIALGSPNRNISFSVPTGNFGDIFAGYMAKMMGLPIEKLIIATN
FT                   ENDTLVRMFDMGMYRPEIVMETTSPAMDIQIPSNFERLLFEISGRNSLLVKEAFYSLEN
FT                   KKYFRIDSEHLQKMSLSFSAKRASMEDVNSVIKSVLEKSNYLVDPHTAVGIHAALACRK
FT                   SSSTPMVTLATAHPSKFPDTVKAASGIVPDCPISLEQMMRRPENCKVMNKNIDEIKKFI
FT                   KKRNMESKIEP"
FT   gene            386844..387971
FT                   /locus_tag="CLIBASIA_01755"
FT   CDS_pept        386844..387971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01755"
FT                   /product="putative modification methylase"
FT                   /note="COG0863 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56939"
FT                   /db_xref="GOA:C6XEY7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY7"
FT                   /protein_id="ACT56939.1"
FT                   /translation="MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFA
FT                   DPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWV
FT                   IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKG
FT                   YTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTK
FT                   PGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTG
FT                   KRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSG
FT                   SETCNGWNFWYFEKLGELHSINTLRILVRKELYNC"
FT   gene            388736..388996
FT                   /locus_tag="CLIBASIA_01760"
FT   CDS_pept        388736..388996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01760"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1722 Exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56940"
FT                   /db_xref="GOA:C6XEY8"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY8"
FT                   /protein_id="ACT56940.1"
FT                   /translation="MNDDSINLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYE
FT                   RGEALKSHCEFLLCSAEKRIEQIKLNRDNKIQSVKPFDEKN"
FT   gene            complement(389058..391949)
FT                   /locus_tag="CLIBASIA_01765"
FT   CDS_pept        complement(389058..391949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01765"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="COG2202 FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56941"
FT                   /db_xref="GOA:C6XEY9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEY9"
FT                   /protein_id="ACT56941.1"
FT                   /translation="MLLSNSLRSHFEKAFLILVLFLLWMVSPSFAIEPINISSSDRVLD
FT                   LTSITRIYVNQGEDFQVFTAADIDGISRRIEVSASSIRHRGDWAVFALANTSDSQLERL
FT                   IVVPHYRLVGSHFFSPDLGSRRIISVTPSEGFSLDRIPNSDSDVFRITINPGAVVTFIM
FT                   EISTPNLPQIYLWEPNFYKDTVNSFTLYRGIIIGVASLLAIFLTIFYMVNRSSMLIPTF
FT                   AMAWVVLGYISIDFGFLSKLVNLPSGELLIWRACSEIALSSSLIIFLFMYLHWNRWHAK
FT                   VGYITFSGIACIAILFCMSFYYPMVTASIARITLASIVLYYTYFIIYHGMKGYERAVLL
FT                   IPAWILIFIWFIGLWMAITKRLDNDIIQPALVGGLVLIVILIGFTVIQHVLATGYFSQG
FT                   IFSDGERQSLAVLGSGDIVWDWDIVRDRVTTTPDIATILGLASGSMHGPIRNWLPYIHI
FT                   NDRDNFRTILDSFVGYRRGRLQYEFRVRAADNQFHWMIIRIRPMSNSNGDILRYIGIAN
FT                   DITEQKKSLEGILCNAFQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKY
FT                   KKINDVLGIAVGDDVLVSLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAI
FT                   AMRKSIAMPINLLEREITVTASIGFASWTSSKITSSEMLKNAELAMYHAKHRGGNHVES
FT                   FRVSSFRSDRVMIKEDLCLAVENSELYLVYHPIIRLMDEEIVGLEALIQWDHPKWGNIS
FT                   SSEFMLIAEELCMIKAINLFMLERIARDIISWRDQANMPPIFILINIASKDLLDNELCE
FT                   GMQALISKTLYSPSRIKLSFSESVVMGNPERSRLLLGRLRKIGISLTLDDFGTKCSLLS
FT                   YLGYIPFDTVKFNGSLMTGSTEKRIAILRSIIPMAKNIETTIIAKDIYGEIDIKELTRM
FT                   GCDYIQDSHVASPLGFNSILKLLKERFPLVKNT"
FT   gene            complement(392454..392530)
FT                   /locus_tag="CLIBASIA_t05713"
FT   tRNA            complement(392454..392530)
FT                   /locus_tag="CLIBASIA_t05713"
FT                   /product="tRNA-Phe"
FT   gene            complement(392578..392769)
FT                   /locus_tag="CLIBASIA_01770"
FT   CDS_pept        complement(392578..392769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01770"
FT                   /product="zinc-binding protein"
FT                   /note="COG3024 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56942"
FT                   /db_xref="GOA:C6XEZ0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ0"
FT                   /protein_id="ACT56942.1"
FT                   /translation="MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEY
FT                   VIAAVEDEKSEEEVKDIL"
FT   gene            complement(392922..393254)
FT                   /gene="infA"
FT                   /locus_tag="CLIBASIA_01775"
FT   CDS_pept        complement(392922..393254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CLIBASIA_01775"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG0361 Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56943"
FT                   /db_xref="GOA:C6XEZ1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ1"
FT                   /protein_id="ACT56943.1"
FT                   /translation="MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKS
FT                   NFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRAR
FT                   ITYRFK"
FT   gene            complement(393583..393942)
FT                   /gene="cyoD"
FT                   /locus_tag="CLIBASIA_01780"
FT   CDS_pept        complement(393583..393942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="CLIBASIA_01780"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="COG3125 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56944"
FT                   /db_xref="GOA:C6XEZ2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ2"
FT                   /protein_id="ACT56944.1"
FT                   /translation="MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLD
FT                   KNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYH
FT                   LNNNMMSMEGMRSIH"
FT   gene            complement(393968..394600)
FT                   /gene="cyoC"
FT                   /locus_tag="CLIBASIA_01785"
FT   CDS_pept        complement(393968..394600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="CLIBASIA_01785"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56945"
FT                   /db_xref="GOA:C6XEZ3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ3"
FT                   /protein_id="ACT56945.1"
FT                   /translation="MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMF
FT                   AVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKT
FT                   VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL
FT                   FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV"
FT   gene            complement(394602..396617)
FT                   /gene="cyoB"
FT                   /locus_tag="CLIBASIA_01790"
FT   CDS_pept        complement(394602..396617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="CLIBASIA_01790"
FT                   /product="cytochrome O ubiquinol oxidase subunit I"
FT                   /note="COG0843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56946"
FT                   /db_xref="GOA:C6XEZ4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ4"
FT                   /protein_id="ACT56946.1"
FT                   /translation="MLQNIDFHKFIFGRLTINSIPYNIPIVLGTFFVVALVGVSIIFAI
FT                   TYYRLWGYLWKEWFTSVDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYL
FT                   DAHHYDQIFTAHGVIMIFFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGA
FT                   VVIMCSLFIGEFASVGWLAYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTI
FT                   IKMRCPGMTMMKMPVFVWTAFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGN
FT                   PMMYINLIWIWGHPEVYILVLPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTV
FT                   WLHHFFTMGSGANVNAFFGIMTMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMI
FT                   TFLIGGMTGVLLAVPPADFTLHNSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQL
FT                   NSFWGKVSFWCWFVGFYLAFMPLYALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGI
FT                   GVFSFVLSFIVSFLNRSKLQDTIGDPWDGRTLEWSISSPSPQYNFAFTPIVSTIDAWEH
FT                   MKNRGYRYPSEGFMPIHMPSNTATGIILAALSIVFSFAMVWYMWWLALLSFISIVFYTI
FT                   FHTFNYNDGYEVSAKDVAFSEEVHRKMNMPKDREHC"
FT   gene            complement(396737..397735)
FT                   /gene="cyoA"
FT                   /locus_tag="CLIBASIA_01795"
FT   CDS_pept        complement(396737..397735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="CLIBASIA_01795"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56947"
FT                   /db_xref="GOA:C6XEZ5"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ5"
FT                   /protein_id="ACT56947.1"
FT                   /translation="MSDCLNWMGVSVGKSLKFFFLFFSSVMLSGFEFIVMDPYGDIALQ
FT                   QASLIRIAVALMLLIVVPVFFSILFFAWKYRSTNKKARYDPKWCHSTLLELFVWLVPLV
FT                   IVGFLAVITWDATHRMDPYAPLERISESKSIAKNSKPLVVEVVALDWKWLFLLPEQQVA
FT                   IINELVVPIDRPLEFRITASSVMNSFYIPGLAGQIYAMAGMETKLHAVMNKKGAYSGFS
FT                   ANYSGRGFSHMRFKFYGKSEKGFEDWISKVKRQGTFLNRQEYLLLKKPSERDSVRYFSP
FT                   IEKGLYYSILNLCVHPGKICMDEMMRIDALGGGGMRGIDRHSLIYDEGYRQ"
FT   gene            398023..398190
FT                   /gene="rpmG"
FT                   /locus_tag="CLIBASIA_01800"
FT   CDS_pept        398023..398190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="CLIBASIA_01800"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56948"
FT                   /db_xref="GOA:C6XEZ6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ6"
FT                   /protein_id="ACT56948.1"
FT                   /translation="MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRK
FT                   HVEFKEGKIK"
FT   gene            complement(398455..398826)
FT                   /locus_tag="CLIBASIA_01805"
FT   CDS_pept        complement(398455..398826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01805"
FT                   /product="two component response regulator"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56949"
FT                   /db_xref="GOA:C6XEZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ7"
FT                   /protein_id="ACT56949.1"
FT                   /translation="MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH
FT                   KPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYIS
FT                   KPISLSIFMETIKKYIGEA"
FT   gene            complement(399166..399864)
FT                   /locus_tag="CLIBASIA_01810"
FT   CDS_pept        complement(399166..399864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01810"
FT                   /product="DSBA oxidoreductase"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56950"
FT                   /db_xref="GOA:C6XEZ8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ8"
FT                   /protein_id="ACT56950.1"
FT                   /translation="MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFR
FT                   ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI
FT                   LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA
FT                   GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII
FT                   DSMIQDSTRR"
FT   gene            complement(399950..400435)
FT                   /locus_tag="CLIBASIA_01815"
FT   CDS_pept        complement(399950..400435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56951"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:C6XEZ9"
FT                   /protein_id="ACT56951.1"
FT                   /translation="MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPE
FT                   KIIWPNRTSIERQDISSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIR
FT                   FLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL"
FT   gene            400659..401729
FT                   /gene="mutY"
FT                   /locus_tag="CLIBASIA_01820"
FT   CDS_pept        400659..401729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="CLIBASIA_01820"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="COG1194 A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56952"
FT                   /db_xref="GOA:C6XF00"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF00"
FT                   /protein_id="ACT56952.1"
FT                   /translation="MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWIS
FT                   EIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADI
FT                   IVKKYEGNFPHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP
FT                   APLYHKTIKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGK
FT                   SHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGN
FT                   IDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALP
FT                   TVMKKALSAGGIKVPQ"
FT   gene            complement(401817..402920)
FT                   /locus_tag="CLIBASIA_01825"
FT   CDS_pept        complement(401817..402920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01825"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG0717 Deoxycytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56953"
FT                   /db_xref="GOA:C6XF01"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF01"
FT                   /protein_id="ACT56953.1"
FT                   /translation="MNKGVLPDKAIATLAERGDIVSEHPLEKNQIQPASIDLRLSSKAY
FT                   RVRASFLPNIDGLVSDKIKHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYAN
FT                   PKSSIGRIDVFARVIGDRSQEFDSISPNYSGPLYLEILPRTFPIVVRVGSRLSQIRFVK
FT                   ERKFCSQEELSALHELSPLVQDGLRDFSGKGVALSVDLKGNEIGKKSIIGYRAKRHTAA
FT                   IDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDH
FT                   SIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEP
FT                   ERLYGEARGSHYQSQALKLSKHFHQTQ"
FT   gene            403128..403262
FT                   /gene="rpmH"
FT                   /locus_tag="CLIBASIA_01830"
FT   CDS_pept        403128..403262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="CLIBASIA_01830"
FT                   /product="50S ribosomal protein L34"
FT                   /note="COG0230 Ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56954"
FT                   /db_xref="GOA:C6XF02"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF02"
FT                   /protein_id="ACT56954.1"
FT                   /translation="MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA"
FT   gene            403349..403720
FT                   /gene="rnpA"
FT                   /locus_tag="CLIBASIA_01835"
FT   CDS_pept        403349..403720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="CLIBASIA_01835"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /note="COG0594 RNase P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56955"
FT                   /db_xref="GOA:C6XF03"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF03"
FT                   /protein_id="ACT56955.1"
FT                   /translation="MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGF
FT                   TVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVE
FT                   RVRRNKRSYYSGKNFSRKS"
FT   gene            403720..405465
FT                   /locus_tag="CLIBASIA_01840"
FT   CDS_pept        403720..405465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01840"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="COG0706 Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56956"
FT                   /db_xref="GOA:C6XF04"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF04"
FT                   /protein_id="ACT56956.1"
FT                   /translation="MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ
FT                   PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN
FT                   SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA
FT                   NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA
FT                   VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG
FT                   HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY
FT                   FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL
FT                   REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF
FT                   WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA
FT                   MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK
FT                   NYNSQ"
FT   gene            405517..406155
FT                   /gene="engB"
FT                   /locus_tag="CLIBASIA_01845"
FT   CDS_pept        405517..406155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="CLIBASIA_01845"
FT                   /product="GTPase EngB"
FT                   /note="COG0218 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56957"
FT                   /db_xref="GOA:C6XF05"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF05"
FT                   /protein_id="ACT56957.1"
FT                   /translation="MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSL
FT                   INILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNV
FT                   DSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS
FT                   PTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY"
FT   gene            407548..408534
FT                   /locus_tag="CLIBASIA_01860"
FT   CDS_pept        407548..408534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01860"
FT                   /product="biotin synthase"
FT                   /note="COG0502 Biotin synthase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56958"
FT                   /db_xref="GOA:C6XF06"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF06"
FT                   /protein_id="ACT56958.1"
FT                   /translation="MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRK
FT                   NFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG
FT                   ATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYN
FT                   HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLA
FT                   NLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMS
FT                   DELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA"
FT   gene            408531..409676
FT                   /locus_tag="CLIBASIA_01865"
FT   CDS_pept        408531..409676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01865"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56959"
FT                   /db_xref="GOA:C6XF07"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF07"
FT                   /protein_id="ACT56959.1"
FT                   /translation="MKNIQMSFYEERLQKIKSKGRHRQLLRRQDIWDFTSHDYLALSSS
FT                   TLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEEEAADFFGFEKMLYFGSGYAANM
FT                   AILSTLPQATDLIVYDKLVHASIREGINSGKAQAIAIPHNNINSFAENINKWRKSGGKG
FT                   FPWIVVESIYSMDGDKAPLDDLVKIANDYDGFIVVDEAHATGVCGPLGKGLTHIIEERN
FT                   NVIVMHSCSKALGSSGALVGSNKIIYDYLINYAKPFIYTTSPSPILAVVACEALKLIKR
FT                   KPALHKSLLQLINITDKIANKKIGFSSQSHIQSIVIGDNKSCLNIAKNLQKKGFDIRAI
FT                   RPPTVPINTARLRISITLNVDEPTIVKLFDILPQIISEGNS"
FT   gene            409673..410326
FT                   /gene="bioD"
FT                   /locus_tag="CLIBASIA_01870"
FT   CDS_pept        409673..410326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="CLIBASIA_01870"
FT                   /product="dithiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /note="COG0132 Dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56960"
FT                   /db_xref="GOA:C6XF08"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF08"
FT                   /protein_id="ACT56960.1"
FT                   /translation="MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDS
FT                   KTIHRIGRIPKSHIIPEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGG
FT                   LLVPLTTEYLFIDLIERWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDS
FT                   MPKVEETIVKIGRIPHLGRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF"
FT   gene            410307..411578
FT                   /locus_tag="CLIBASIA_01875"
FT   CDS_pept        410307..411578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01875"
FT                   /product="adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase"
FT                   /EC_number="2.6.1.62"
FT                   /note="COG0161 Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56961"
FT                   /db_xref="GOA:C6XF09"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF09"
FT                   /protein_id="ACT56961.1"
FT                   /translation="MNHLHSNYPIWHPFVQHFCNPTFKKIIKTEGSYLIDENHDKIIDA
FT                   ISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAEQLARLLIKIAPLGLQYVF
FT                   FSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSYEP
FT                   LLFDVETIPFPHHNEEQKTLDDLEKHCSTQKIAAFLVEPLILGAGGMQTYRPYILKEFM
FT                   RITKKYDTLLIADEVMTGWGRTGKIFACNHADITPDILCLSKGITGGALPLAATLCSEE
FT                   IFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWEKEPVIERIKNLERMHADRLSL
FT                   LKSNKKFVNIRQMGTIVALDFNVQNKGYFFDKNAKLKNFFREKKILIRPLGHIMYLMPP
FT                   YCITATDLDHIYNTINEAVDFLEL"
FT   gene            411579..412556
FT                   /locus_tag="CLIBASIA_01880"
FT   CDS_pept        411579..412556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01880"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56962"
FT                   /db_xref="GOA:C6XF10"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF10"
FT                   /protein_id="ACT56962.1"
FT                   /translation="MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYR
FT                   YWAEKHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLM
FT                   QSGAIDLTGACAGFLYALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAA
FT                   GAVVLAPSPLKDKSGILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADI
FT                   FYNAVKIMAQSAKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKD
FT                   FGNSSSASIPLSLSLENQRKPFQKGEKILTISCRRGNDRGIYCL"
FT   gene            412606..412809
FT                   /gene="xerC"
FT                   /locus_tag="CLIBASIA_01885"
FT   CDS_pept        412606..412809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="CLIBASIA_01885"
FT                   /product="site-specific tyrosine recombinase XerC"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56963"
FT                   /db_xref="GOA:C6XF11"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF11"
FT                   /protein_id="ACT56963.1"
FT                   /translation="MSTTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVN
FT                   SKRMMEIYDQTHPSITQKDKKN"
FT   gene            complement(412806..413111)
FT                   /locus_tag="CLIBASIA_01890"
FT   CDS_pept        complement(412806..413111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01890"
FT                   /product="Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56964"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF12"
FT                   /protein_id="ACT56964.1"
FT                   /translation="MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSI
FT                   TVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA"
FT   gene            complement(413135..413211)
FT                   /locus_tag="CLIBASIA_t05715"
FT   tRNA            complement(413135..413211)
FT                   /locus_tag="CLIBASIA_t05715"
FT                   /product="tRNA-Met"
FT   gene            complement(413257..413371)
FT                   /locus_tag="CLIBASIA_r05775"
FT   rRNA            complement(413257..413371)
FT                   /locus_tag="CLIBASIA_r05775"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(413432..415641)
FT                   /locus_tag="CLIBASIA_r05778"
FT   rRNA            complement(413432..415641)
FT                   /locus_tag="CLIBASIA_r05778"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(416120..416242)
FT                   /locus_tag="CLIBASIA_01895"
FT   CDS_pept        complement(416120..416242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_01895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ACT56965"
FT                   /db_xref="UniProtKB/TrEMBL:C6XF13"
FT                   /protein_id="ACT56965.1"
FT                   /translation="MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH"
FT   gene            complement(416467..416542)
FT                   /locus_tag="CLIBASIA_t05717"
FT   tRNA            complement(416467..416542)
FT                   /locus_tag="CLIBASIA_t05717"
FT                   /product="tRNA-Ala"
FT   gene            complement(416555..416631)
FT                   /locus_tag="CLIBASIA_t05719"
FT   tRNA            complement(416555..416631)
FT                   /locus_tag="CLIBASIA_t05719"
FT                   /product="tRNA-Ile"
FT   gene            complement(416812..418322)
FT                   /locus_tag="CLIBASIA_r05781"
FT   rRNA            complement(416812..418322)
FT                   /locus_tag="CLIBASIA_r05781"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(418594..419907)
FT                   /gene="hslU"
FT                   /locus_tag="CLIBASIA_03610"
FT   CDS_pept        complement(418594..419907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="CLIBASIA_03610"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /note="COG1220 ATP-dependent protease HslVU (ClpYQ), ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57302"
FT                   /db_xref="GOA:C6XFZ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ9"
FT                   /protein_id="ACT57302.1"
FT                   /translation="MKLTFNFSPREIVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPA
FT                   DLRDELMPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIR
FT                   DLVDVAINIVRESRRDEVREQASINAEERILDALVGKTATSNTREVFRKKLRDGEISDK
FT                   EIDIEVADTSSDISNFDIPGGASVGILNLSELFSKVMGSGRKKKIRMSVQKCYPELMRD
FT                   ESDRLIDMDTVHRDSIQMVENYGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVEG
FT                   SSVSTKYGSINTDHILFIASGAFHVSRPADLLPEIQGRFPVRVHLKSLNKSDFRLILTD
FT                   TESNLILQYKELMKTEGIILDFTEDSIDALADVAVNLNSTVGDIGARRLQTVMERVLED
FT                   ISFSASDLQEKTVVIDAEYVRLHIGDFPSETDMYHFIL"
FT   gene            complement(419913..420485)
FT                   /locus_tag="CLIBASIA_03605"
FT   CDS_pept        complement(419913..420485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03605"
FT                   /product="ATP-dependent protease peptidase subunit"
FT                   /EC_number="3.4.25.-"
FT                   /note="COG5405 ATP-dependent protease HslVU (ClpYQ),
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57301"
FT                   /db_xref="GOA:C6XFZ8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ8"
FT                   /protein_id="ACT57301.1"
FT                   /translation="MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKAN
FT                   ARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLR
FT                   NLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIAR
FT                   KAMSIAADICVYTNHNIVLETLKVGDE"
FT   gene            420756..421691
FT                   /locus_tag="CLIBASIA_03600"
FT   CDS_pept        420756..421691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03600"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG1072 Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57300"
FT                   /db_xref="GOA:C6XFZ7"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ7"
FT                   /protein_id="ACT57300.1"
FT                   /translation="MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEI
FT                   YKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILC
FT                   ILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKK
FT                   VAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIY
FT                   IDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQ
FT                   HNILPTRKRADLILSKGEDHSVKTIKIKKI"
FT   gene            complement(421864..423393)
FT                   /gene="pckA"
FT                   /locus_tag="CLIBASIA_03595"
FT   CDS_pept        complement(421864..423393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="CLIBASIA_03595"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="COG1866 Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57299"
FT                   /db_xref="GOA:C6XFZ6"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ6"
FT                   /protein_id="ACT57299.1"
FT                   /translation="MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQ
FT                   HTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACP
FT                   HTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCS
FT                   ETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVAL
FT                   FFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSAS
FT                   CRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAAD
FT                   AFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYG
FT                   NILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDEN
FT                   FGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI"
FT   gene            complement(423932..424111)
FT                   /locus_tag="CLIBASIA_03592"
FT   CDS_pept        complement(423932..424111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT66817"
FT                   /db_xref="GOA:C6XH47"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH47"
FT                   /protein_id="ACT66817.1"
FT                   /translation="MVKSIPAIVPNTAILQENNVQISIPFPMPIVAMPAIILWLIITLL
FT                   RGYCREYIIFLSRL"
FT   gene            424002..426380
FT                   /locus_tag="CLIBASIA_03590"
FT   CDS_pept        424002..426380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03590"
FT                   /product="two-component sensor histidine kinase protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57298"
FT                   /db_xref="GOA:C6XFZ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ5"
FT                   /protein_id="ACT57298.2"
FT                   /translation="MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLI
FT                   RQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRID
FT                   IPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSC
FT                   AFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISY
FT                   KKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVR
FT                   VLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWE
FT                   IDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQT
FT                   LHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKL
FT                   SNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGT
FT                   LELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHV
FT                   SYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDA
FT                   GIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKI
FT                   LSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRG
FT                   VGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE"
FT   gene            426394..426882
FT                   /locus_tag="CLIBASIA_03585"
FT   CDS_pept        426394..426882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03585"
FT                   /product="hypothetical protein"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57297"
FT                   /db_xref="GOA:C6XFZ4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ4"
FT                   /protein_id="ACT57297.1"
FT                   /translation="MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSG
FT                   KSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEI
FT                   LNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ"
FT   gene            426908..430030
FT                   /locus_tag="CLIBASIA_03580"
FT   CDS_pept        426908..430030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03580"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="COG3893 Inactivated superfamily I helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57296"
FT                   /db_xref="GOA:C6XFZ3"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ3"
FT                   /protein_id="ACT57296.1"
FT                   /translation="MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLA
FT                   SVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVS
FT                   NIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEE
FT                   KKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHL
FT                   MKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNI
FT                   TSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMR
FT                   NTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLA
FT                   RRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFG
FT                   FPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDK
FT                   ELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLW
FT                   FEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLE
FT                   SRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGT
FT                   RHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPH
FT                   YKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLF
FT                   HNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHE
FT                   EKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQ
FT                   KLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEK
FT                   SLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS"
FT   gene            433634..433957
FT                   /gene="trxA"
FT                   /locus_tag="CLIBASIA_03565"
FT   CDS_pept        433634..433957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="CLIBASIA_03565"
FT                   /product="thioredoxin"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57295"
FT                   /db_xref="GOA:C6XFZ2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ2"
FT                   /protein_id="ACT57295.1"
FT                   /translation="MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIA
FT                   DELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL
FT                   SRV"
FT   gene            complement(434017..435306)
FT                   /gene="folC"
FT                   /locus_tag="CLIBASIA_03560"
FT   CDS_pept        complement(434017..435306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="CLIBASIA_03560"
FT                   /product="FolC bifunctional protein"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57294"
FT                   /db_xref="GOA:C6XFZ1"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFZ1"
FT                   /protein_id="ACT57294.1"
FT                   /translation="MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRL
FT                   LETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIF
FT                   ELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVS
FT                   AIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVY
FT                   QDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKIT
FT                   EGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYL
FT                   EAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKI
FT                   NEELPPPLILIAGSLYLAGEALRENGVRIN"
FT   gene            complement(435350..436204)
FT                   /gene="accD"
FT                   /locus_tag="CLIBASIA_03555"
FT   CDS_pept        complement(435350..436204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="CLIBASIA_03555"
FT                   /product="acetyl-CoA carboxylase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0777 Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57293"
FT                   /db_xref="GOA:C6XFZ0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6XFZ0"
FT                   /protein_id="ACT57293.1"
FT                   /translation="MNWITNFVRPRINSVFGRRAIPENLWVKCPETGAMVYHKDLKENQ
FT                   WVISSSDFHMKIPAKERLKFLFDNAKYCLLDQPQVCQDPLKFRDNKKYIDRLKENRSKT
FT                   GLIDSIVSAVGNVRDFKLVAVVHEFSFIGGSIGIAAGEAIVKSCERAIAEKCPLVMFTA
FT                   SGGARMQEGILSLMQLPRTTIAINMLKDAGLPYIVVLTNPTTGGVTASYAMLGDIHLAE
FT                   PGAEIGFAGRRVIEQTVREKLPDGFQRSEYLVEHGMIDRIVHRHDIPEVVSSLCKILTK
FT                   SVQ"
FT   gene            436594..437193
FT                   /gene="coaE"
FT                   /locus_tag="CLIBASIA_03550"
FT   CDS_pept        436594..437193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="CLIBASIA_03550"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG0237 Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57292"
FT                   /db_xref="GOA:C6XFY9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY9"
FT                   /protein_id="ACT57292.2"
FT                   /translation="MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVD
FT                   IIKKTFPRSIQNNKVNKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEK
FT                   IVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDK
FT                   ISRADYVINTEGTIEAIEKETQKMLKYILKINDSKK"
FT   gene            437177..437914
FT                   /gene="dnaQ"
FT                   /locus_tag="CLIBASIA_03545"
FT   CDS_pept        437177..437914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="CLIBASIA_03545"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="COG0847 DNA polymerase III, epsilon subunit and
FT                   related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57291"
FT                   /db_xref="GOA:C6XFY8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY8"
FT                   /protein_id="ACT57291.1"
FT                   /translation="MIRKNKMRKIVFDIETTGLDSKNDRIIEIGAVELLDYSKTNRTFQ
FT                   VFLCPNGRKNSPEALKLHGITDEFLKDKPSFSSIFSEFWDFFNEQNAEWIAHNAKFDVG
FT                   FINAELQRINKDPLDPSRIIDTLSIARRKHPSSRNDLNSLCKRYGITISHRSKHGALLD
FT                   SHLLSDVYIKMMVGGSQINFGFKTNEDRFFKEEKKTVPNISLLKRDKPLFTRITKEELD
FT                   EHDKTIQTLGKNAIWDRYISSNQ"
FT   gene            complement(437917..438375)
FT                   /gene="secB"
FT                   /locus_tag="CLIBASIA_03540"
FT   CDS_pept        complement(437917..438375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="CLIBASIA_03540"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="COG1952 Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57290"
FT                   /db_xref="GOA:C6XFY7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY7"
FT                   /protein_id="ACT57290.1"
FT                   /translation="MEKKQKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQ
FT                   VNANTISGADFDVILSFDIEAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQ
FT                   LLFPFVRQIISNTIRDGGFPPLVIDTIDFLKLFQQEKSLIKNKEGLMK"
FT   gene            complement(438339..438530)
FT                   /locus_tag="CLIBASIA_03535"
FT   CDS_pept        complement(438339..438530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57289"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY6"
FT                   /protein_id="ACT57289.1"
FT                   /translation="MFEIFEIHVYFQRKSIFNLFKISIATIPVYISIGKACMIQIQILE
FT                   TEQKDQRWKKNKSKHLLF"
FT   gene            438634..439332
FT                   /locus_tag="CLIBASIA_03530"
FT   CDS_pept        438634..439332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03530"
FT                   /product="hypothetical protein"
FT                   /note="COG4395 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57288"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY5"
FT                   /protein_id="ACT57288.1"
FT                   /translation="MVFIKMDSGDFLILLFAFITFFVFLQLRGVLGKKTGNEKPFSGFF
FT                   SGKYVFSKRDERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFL
FT                   NEARNSYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLSTRKSNEKNVKSSLVGIDDMK
FT                   IINASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNPN
FT                   WVLISTKLGE"
FT   gene            439394..441805
FT                   /gene="gyrB"
FT                   /locus_tag="CLIBASIA_03525"
FT   CDS_pept        439394..441805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CLIBASIA_03525"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57287"
FT                   /db_xref="GOA:C6XFY4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY4"
FT                   /protein_id="ACT57287.1"
FT                   /translation="MSDNIQNSSYDADSIQILKGLDAVKKRPSMYIGDTDGESGLHHMI
FT                   YEVLDNAIDESLEGYADIITVTLNMDGSCTVSDNGRGIPTDLHKEEGISAAEVIMTRLH
FT                   AGGKFNQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVVTG
FT                   SAGNDTGTEVTFLPSSDIFSVQDFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPREIT
FT                   MFYKGGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIP
FT                   QKDGGTHLSGLRSALTRQITSYVEKSFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFS
FT                   SQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDASMVRDAARRARDLT
FT                   RRKGVLDIASLPGKLADCSERDPKKSELFLVEGDSAGGSAKQGRSRENQAILPLRGKIL
FT                   NVERARFDKMLSSQEIGTLITALGTGIGQDSFDINKLRYHKIIIMTDADVDGAHIRTLL
FT                   LTFFFRQMPSLIHNGFLYIIKPPLYGITRGKSLQYVKDEESLEDYLINQSLSEEIELFC
FT                   DSKGVISKNDLRNFIDDALKIDKLIKDFYPNHDKTFIEQAVISGVFNCESDQEINVSLA
FT                   SKLANRLNFIAEKSEKSWHGSINNSDILVKRIARGVQEQFVLEGSSIFSFGSKYKRIFS
FT                   NRIEENYLTILSLICNGDKIKITGPCSLLDTIFSIGRKGISMQRYKGLGEMNASQLWET
FT                   TLNPDTRSLLRVKITDASQADDLFSRLMGDEVEPRREFIQENSLPSALDI"
FT   gene            complement(441888..442487)
FT                   /locus_tag="CLIBASIA_03520"
FT   CDS_pept        complement(441888..442487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03520"
FT                   /product="Maf-like protein"
FT                   /note="COG0424 Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57286"
FT                   /db_xref="GOA:C6XFY3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY3"
FT                   /protein_id="ACT57286.1"
FT                   /translation="MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSE
FT                   RKRPEKIALILAEKKALEVSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRIS
FT                   GKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQID
FT                   KEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKVID"
FT   gene            442927..443967
FT                   /gene="hemE"
FT                   /locus_tag="CLIBASIA_03515"
FT   CDS_pept        442927..443967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="CLIBASIA_03515"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="COG0407 Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57285"
FT                   /db_xref="GOA:C6XFY2"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY2"
FT                   /protein_id="ACT57285.1"
FT                   /translation="MNERKQKILEVLQGNVINPPPIWLMRQAGRYLPEYRQIRKKFKNF
FT                   LDMCYTPEYTVELTLQPIRRYNFDAAILFSDILVIADALGRNVRFVENEGPRMDPITTQ
FT                   EIYLLNPNIDLFLNYLLPIFQSISILRKKLPNHITLIGFCGAPWTVASYMISGGFIKDH
FT                   GQNRVFAYQNSRAFNWLLDFLSDVSAEYLIAQIHAGVDVIQIFDTHAGCLGEHEFENYA
FT                   ARSVGRIISAVRRKYPNAKFISFAKGAGYMLKNYRRLTDSNAIGLDWSVPLSFALELQK
FT                   EGPVQGNLDPMRLVVGNQVMIDGVNAILDVLGSGPFIFNLGHGITPQVDPKNVLDLVKT
FT                   VRSEKI"
FT   gene            443967..444503
FT                   /locus_tag="CLIBASIA_03510"
FT   CDS_pept        443967..444503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03510"
FT                   /product="hypothetical protein"
FT                   /note="COG1981 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57284"
FT                   /db_xref="GOA:C6XFY1"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY1"
FT                   /protein_id="ACT57284.1"
FT                   /translation="MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKS
FT                   IHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCG
FT                   LYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPT
FT                   LIMIIIVFLSVIKPF"
FT   gene            444702..445973
FT                   /gene="rho"
FT                   /locus_tag="CLIBASIA_03505"
FT   CDS_pept        444702..445973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CLIBASIA_03505"
FT                   /product="transcription termination factor Rho"
FT                   /note="COG1158 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57283"
FT                   /db_xref="GOA:C6XFY0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFY0"
FT                   /protein_id="ACT57283.1"
FT                   /translation="MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVL
FT                   SGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSI
FT                   RAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSR
FT                   VIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDM
FT                   QRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLM
FT                   PSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKG
FT                   TGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAI
FT                   EFLIDKLKQTKDNKDFFYSMNKQN"
FT   gene            445994..447316
FT                   /gene="trmE"
FT                   /locus_tag="CLIBASIA_03500"
FT   CDS_pept        445994..447316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="CLIBASIA_03500"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="COG0486 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57282"
FT                   /db_xref="GOA:C6XFX9"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX9"
FT                   /protein_id="ACT57282.1"
FT                   /translation="MNHEKETIFAVSTGALPSAISIIRLSGPSCFQVCEFICKKKKPFP
FT                   RKASLRYFFGLDGRILDKGLLIVFPSPESFTGEDSAEFHVHGGIAVVNGILEELAKMPN
FT                   LRLANPGEFSRRAFENGKIDLLEAESLADLISSETEMQRRLSMEGMSGELSSLYGQWID
FT                   KLTHIRSFIEADLDFSEEEDVQNFSSKEVLNDILFLKNDISSHISQGKLGEIIRNGYKI
FT                   VILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETD
FT                   DIVEKEGIKRTFLEVENADLILLLKEINSKKEISFPKNIDFIFIGTKSDLYSTYTEEYD
FT                   HLISSFTGEGLEELINKIKSILSNKFKKLPFSIPSHKRHLYHLSQTVRYLEMASLNEKD
FT                   CGLDIIAENLRLASVSLGKITGCVDVEQLLDIIFSKFCIGK"
FT   gene            447340..449220
FT                   /locus_tag="CLIBASIA_03495"
FT   CDS_pept        447340..449220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03495"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="COG0445 NAD/FAD-utilizing enzyme apparently involved
FT                   in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57281"
FT                   /db_xref="GOA:C6XFX8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX8"
FT                   /protein_id="ACT57281.1"
FT                   /translation="MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMS
FT                   CNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYR
FT                   LAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIH
FT                   IGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADER
FT                   LIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDK
FT                   IVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYA
FT                   IEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCI
FT                   CFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGE
FT                   RRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQN
FT                   LFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPAL
FT                   SNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV"
FT   gene            449217..449723
FT                   /gene="gidB"
FT                   /locus_tag="CLIBASIA_03490"
FT   CDS_pept        449217..449723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="CLIBASIA_03490"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="COG0357 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57280"
FT                   /db_xref="GOA:C6XFX7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX7"
FT                   /protein_id="ACT57280.1"
FT                   /translation="MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINL
FT                   VSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLI
FT                   ESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPW
FT                   LYQKK"
FT   gene            449900..450697
FT                   /gene="parA"
FT                   /locus_tag="CLIBASIA_03485"
FT   CDS_pept        449900..450697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="CLIBASIA_03485"
FT                   /product="chromosome partitioning protein A"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57279"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX6"
FT                   /protein_id="ACT57279.1"
FT                   /translation="MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDP
FT                   QGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGG
FT                   EKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGL
FT                   SQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNV
FT                   RISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA"
FT   gene            450712..451614
FT                   /gene="parB"
FT                   /locus_tag="CLIBASIA_03480"
FT   CDS_pept        450712..451614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="CLIBASIA_03480"
FT                   /product="chromosome partitioning protein B"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57278"
FT                   /db_xref="GOA:C6XFX5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX5"
FT                   /protein_id="ACT57278.1"
FT                   /translation="MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIH
FT                   SIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMA
FT                   SLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVG
FT                   KSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDT
FT                   EELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYE
FT                   TNEQLKIICSLLGENDFEY"
FT   gene            complement(451620..452678)
FT                   /gene="holA"
FT                   /locus_tag="CLIBASIA_03475"
FT   CDS_pept        complement(451620..452678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="CLIBASIA_03475"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57277"
FT                   /db_xref="GOA:C6XFX4"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX4"
FT                   /protein_id="ACT57277.1"
FT                   /translation="MATIESHKFIQKSTKNLFLSHFVFIFYGSDKGLIFELINQFKKNI
FT                   SITYHDPFSLVVLNALEIQKNISTFWNEINSTSLFSKKKIILIENLSTEKKVLDCLEEI
FT                   IIKNICNHIIIIKSNEIKKNNTLRKIAEKFTSVLAISCYPDNKIHLMDLIEESLLIGQK
FT                   SISKEAKQILLANLGGDRIASRNELQKLSSYCLEDILITEQHVKDIICDTHVLYIEEII
FT                   NATIQGKIYNAIMLADFFLASKMPSHALLHGFLQKFQLLEKIHIIKECSNISFEKIIQK
FT                   TEKNIIPMKRNILQESLRIWNKNLVRETLHKIDHRIHLARKKKYLEKNIIFQTILYIAQ
FT                   TACKNNNFYKRT"
FT   gene            complement(452684..453181)
FT                   /locus_tag="CLIBASIA_03470"
FT   CDS_pept        complement(452684..453181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57276"
FT                   /db_xref="GOA:C6XFX3"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX3"
FT                   /protein_id="ACT57276.1"
FT                   /translation="MLYKRILRILVVFNFFLLINSCSVYPFYYLKNQDRTEYIHPIKVL
FT                   VVSKNNKNEIYRSINFLTSTVRTKNLYQLEVNIDSFTDHAISNAFFKNIGRITLKAKYY
FT                   FKEISGKNILYENNTDVTSLFDFSDQQFSQLRSHKSSEEKAIQELSENIYIDIISFIRT
FT                   IE"
FT   gene            complement(453171..455780)
FT                   /gene="leuS"
FT                   /locus_tag="CLIBASIA_03465"
FT   CDS_pept        complement(453171..455780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="CLIBASIA_03465"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COG0495 Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57275"
FT                   /db_xref="GOA:C6XFX2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX2"
FT                   /protein_id="ACT57275.1"
FT                   /translation="METRSYSPQETDSIWQSAWYDSNIFKAENGKNKKKYFVLEMFPYP
FT                   SGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQ
FT                   NIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVE
FT                   QTVLANEQVINGRGWRSDAPVEQRSLPQWFFKISDLSQELLDSIETLSEWPEKVKIMQK
FT                   NWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFGASFIAIAVDHSISEKLSCDNT
FT                   DIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGA
FT                   IFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIEEGKAFSGDGIMINSSFLDGMTN
FT                   TEALQAVMSHLEKQNIKNSPIGKRKINFRLRDWCISRQRSWGCPIPVIHCQKCGIVELP
FT                   KEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCGSEALRETDTMDTFVDSSWYYMRY
FT                   MTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHILKKIGYIEIDEPFKRL
FT                   FTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLSDNSKVVIGPLEKMSKSK
FT                   KNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTYQFIQQIWRLIYNAKDE
FT                   LQTSSTKKDISLISKSTKFLERIEENYQNLSFNKAVANIHELVNVISKPLMEIAKKKSN
FT                   ADRISTIRYILEKLIIMMSPMIPHLAEECWQLLGNAGLVAQQKWPKLDPILEVNTDIIL
FT                   PIQVNGKKRACITVSMNTDDDFIKKTVLELNVIKNILQGKSPKKIIIISKRIVNIVV"
FT   gene            455896..456564
FT                   /locus_tag="CLIBASIA_03460"
FT   CDS_pept        455896..456564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03460"
FT                   /product="hypothetical protein"
FT                   /note="COG0325 Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57274"
FT                   /db_xref="GOA:C6XFX1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX1"
FT                   /protein_id="ACT57274.1"
FT                   /translation="MSLGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVA
FT                   LSCGQVIFAENKLQEAKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIETVSREK
FT                   TASLLSLEMIKQSRFLPVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMCI
FT                   PPAMGNPKPHFYLLSEIARECKLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQT
FT                   "
FT   gene            complement(456637..457215)
FT                   /locus_tag="CLIBASIA_03455"
FT   CDS_pept        complement(456637..457215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03455"
FT                   /product="hypothetical protein"
FT                   /note="COG3820 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57273"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFX0"
FT                   /protein_id="ACT57273.1"
FT                   /translation="MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGES
FT                   LQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDR
FT                   PNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVTLGLCAQID
FT                   LDREIEKCSKNTEAKYNKAVDDISTPFSS"
FT   gene            457508..459928
FT                   /gene="ftsK"
FT                   /locus_tag="CLIBASIA_03450"
FT   CDS_pept        457508..459928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="CLIBASIA_03450"
FT                   /product="DNA translocase FtsK"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57272"
FT                   /db_xref="GOA:C6XFW9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW9"
FT                   /protein_id="ACT57272.1"
FT                   /translation="MSENMSFIISNKNENFLLSDWSKKKMKIVAGLILLCTVFAITLAL
FT                   GTWDVYDPSFSYITLRSPKNFLGYGGAIFADVAIQFFGIASVFFLPPPTMWALSLLFDK
FT                   KIYCFSKRATAWLINILVSATFFASFSPSQSWPIQNGFGGIIGDLIIRLPFLFFESYPR
FT                   KLGILFFQMILFLAMSWLLIYSSSAIFQGKRRVPYNMADCLISDESKTQLEDVMASSLL
FT                   KYLCNMFRVWIGRFLGFAFFISFVKKCLGDSNISVDDYRKKIEPTLDVSFHDAIDINSI
FT                   TEYQLNADIVQNISQSNLINHGTGTFVLPSKEILSTSQSPVNQMTFSPKVMQNNACTLK
FT                   SVLSDFGIQGEIVNVRPGPVITLYELEPAPGIKSSRIIGLSDDIARSMSAISARVAVIP
FT                   RRNAIGIELPNDIRETVMLRDLIVSRVFEKNQCDLAINLGKSIEGKPIIADLARMPHLL
FT                   IAGTTGSGKSVAINTMILSLLYRMTPAQCRLIMIDPKMLELSVYDGIPNLLTPVVTNPQ
FT                   KAVTVLKWLVCEMEERYQKMSKIGVRNIDGFNLKVAQYHNTGKKFNRTVQTGFDRKTGE
FT                   AIYETEHFDFQHMPYIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRP
FT                   SVDVITGTIKANFPTRISFQVSSKIDSRTILGEQGAEQLLGQGDMLYMTGGGRVQRIHG
FT                   PFVSDIEVEKVVSHLKTQGEAKYIDIKDKILLNEEMRFSENSSVADDLYKQAVDIVLRD
FT                   NKASISYIQRRLGIGYNRAASIIENMEEKGVIGPASSTGKREILISSMEECHE"
FT   gene            460883..461497
FT                   /locus_tag="CLIBASIA_03445"
FT   CDS_pept        460883..461497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03445"
FT                   /product="possible lolA type protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57271"
FT                   /db_xref="GOA:C6XFW8"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW8"
FT                   /protein_id="ACT57271.1"
FT                   /translation="MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLS
FT                   IQTMQGTFLQEDAGYVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWS
FT                   VYPLRYMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLL
FT                   NWKIMDSSRRYSIIKILKYKENTVLDPKVFEIPYDKIHNIN"
FT   gene            complement(461744..462439)
FT                   /locus_tag="CLIBASIA_03440"
FT   CDS_pept        complement(461744..462439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03440"
FT                   /product="hypothetical protein"
FT                   /note="COG0708 Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57270"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW7"
FT                   /protein_id="ACT57270.1"
FT                   /translation="MILAQRIRIASWNINNLSEKSGVALFKNSVIREDNDYALLQKYAE
FT                   QLDADIVCLQEIGSYEAIKRVFPNDKWDILYSGSNTDKHAMHTAIVIRKGAIHLLQKSY
FT                   LPMDTEGLDSKAGKRRAVEILFEVDGRKIWLLDIHLKSFCFLDSIEDSYISSCYMLNLQ
FT                   ATWLKQWVDQKNNLNMPFIIAGDFNRKINHSHSGIKDELWQKINQDNTLMRLPHKKNHN
FT                   AIRTKILKI"
FT   gene            complement(462587..463045)
FT                   /gene="rnhA"
FT                   /locus_tag="CLIBASIA_03435"
FT   CDS_pept        complement(462587..463045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="CLIBASIA_03435"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57269"
FT                   /db_xref="GOA:C6XFW6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW6"
FT                   /protein_id="ACT57269.1"
FT                   /translation="MDSKHLREVHAYTDGACSGNPGPGGWGVLLRYKGKEKIISGGEKE
FT                   TTNNRMELMAAIKALTALKYPCKVLLYTDSSYVHKGFSQWIKKWQQNGWKTSDKKTVKN
FT                   IDLWMKFVEASAQHKVDLYWIKGHAGNQENEKVDRIARNAAVSFKNKI"
FT   gene            complement(463035..463985)
FT                   /locus_tag="CLIBASIA_03430"
FT   CDS_pept        complement(463035..463985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03430"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="COG2334 Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57268"
FT                   /db_xref="GOA:C6XFW5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW5"
FT                   /protein_id="ACT57268.1"
FT                   /translation="MAVYTHPPQKEIQSFVQEYAIGQLNSVQPIIHGVENSNFVIQTSK
FT                   GTFILTIYEKRMNEKDLPVFIELLHYISRNKLPCPIPIPRNDGKLYGFLCKKPANIFSF
FT                   IKGSPLNHISDIHCEEIGSMLASMHQKTKNFHLYRKNTLSPLNLKFLWAKCFDKVDEDL
FT                   KKEIDHEFCFLKESWPKNLPTGIIHADLFPDNVLFYNNKIMGLIDFYFSCNDFLMYDLS
FT                   ICINAWCFDENNTYNPSRGFSILNGYNKVRKISENELQSLPTLLRGAALRFFLTRLYDS
FT                   QNMPCNALTITKDPMEYILKTRFHKQISSISEYGF"
FT   gene            complement(464211..465278)
FT                   /gene="trpS"
FT                   /locus_tag="CLIBASIA_03425"
FT   CDS_pept        complement(464211..465278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CLIBASIA_03425"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COG0180 Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57267"
FT                   /db_xref="GOA:C6XFW4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW4"
FT                   /protein_id="ACT57267.1"
FT                   /translation="MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFI
FT                   ADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVAR
FT                   MGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITR
FT                   LIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKS
FT                   DSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKI
FT                   EEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRA
FT                   QETMKYVNEIVGLSH"
FT   gene            complement(465354..466910)
FT                   /gene="mviN"
FT                   /locus_tag="CLIBASIA_03420"
FT   CDS_pept        complement(465354..466910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="CLIBASIA_03420"
FT                   /product="integral membrane protein MviN"
FT                   /note="COG0728 Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57266"
FT                   /db_xref="GOA:C6XFW3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW3"
FT                   /protein_id="ACT57266.1"
FT                   /translation="MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAF
FT                   YLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVEL
FT                   ILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASI
FT                   APIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQ
FT                   YPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGV
FT                   IGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLY
FT                   ERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLT
FT                   IAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLM
FT                   GFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIR
FT                   K"
FT   gene            467198..468454
FT                   /locus_tag="CLIBASIA_03415"
FT   CDS_pept        467198..468454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03415"
FT                   /product="aminopeptidase protein"
FT                   /note="COG2309 Leucyl aminopeptidase (aminopeptidase T)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57265"
FT                   /db_xref="GOA:C6XFW2"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW2"
FT                   /protein_id="ACT57265.2"
FT                   /translation="MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSAL
FT                   PLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNT
FT                   ALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEI
FT                   VYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSG
FT                   PNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQ
FT                   GMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTL
FT                   FYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVD
FT                   GLTKNGVLVPIMRGGEWAF"
FT   gene            complement(468451..470040)
FT                   /gene="xseA"
FT                   /locus_tag="CLIBASIA_03410"
FT   CDS_pept        complement(468451..470040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="CLIBASIA_03410"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1570 Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57264"
FT                   /db_xref="GOA:C6XFW1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW1"
FT                   /protein_id="ACT57264.1"
FT                   /translation="MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYR
FT                   GIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQII
FT                   IESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDIL
FT                   QRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIE
FT                   DLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHL
FT                   QSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLE
FT                   IIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKI
FT                   AILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTL
FT                   KRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNN
FT                   KREKQGTQGELF"
FT   gene            470431..470820
FT                   /locus_tag="CLIBASIA_03405"
FT   CDS_pept        470431..470820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57263"
FT                   /db_xref="GOA:C6XFW0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFW0"
FT                   /protein_id="ACT57263.1"
FT                   /translation="MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFL
FT                   VTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLS
FT                   AVSSMLFVFLLYIRFMTRRVYFIKK"
FT   gene            471064..471642
FT                   /locus_tag="CLIBASIA_03400"
FT   CDS_pept        471064..471642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03400"
FT                   /product="hypothetical protein"
FT                   /note="COG0779 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57262"
FT                   /db_xref="GOA:C6XFV9"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV9"
FT                   /protein_id="ACT57262.1"
FT                   /translation="MESTHFLHSKYEPRIFGDMGLAGDISSVIQPVIEEMSFRSVQISL
FT                   LEEKNLLLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPMV
FT                   RKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIAIS
FT                   FDSLLSARLIVTDELLRASLNNYGSYAGL"
FT   gene            471664..473244
FT                   /gene="nusA"
FT                   /locus_tag="CLIBASIA_03395"
FT   CDS_pept        471664..473244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="CLIBASIA_03395"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57261"
FT                   /db_xref="GOA:C6XFV8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV8"
FT                   /protein_id="ACT57261.1"
FT                   /translation="MVSANRLELLQIADAVAYEKSIDRDVVLSVMADSIQKAARSLYGT
FT                   MSDIRVEINPETGDISLFRLLEVVEEVENYTCQISLKVARDRDPSIDIGGVVSDPLPPM
FT                   DFGRVAVQSAKQVIIQKVREAERDRQYLEFKDKVGEIISGTVKRVEYGNVIVDLGNSDG
FT                   VIRRDETISRENLRPGDRVKSYIYDVRREQRGPQVLLSRTHPQFMVKLFHMEVPEIYNG
FT                   IVQVKAVSRDPGSRAKLAVFSSDSSIDPVGACVGMRGSRVQAVVTELRDEKIDIVVWSP
FT                   DSATFVINALRPAIVTKVVLDEDVGRIEVIVPKEQLSLAIGRRGQNVRLASQLTGWTID
FT                   IITEEEDSINRQKDFNERTQFFMQAINVDEIIAHLLVAEGFADVEELACVKISEIASIE
FT                   GFDEETAVEIQGRAREYLEGIDITLQKKIRELGVSEELCSIPGIDSKIKVALGENGIKT
FT                   MEDLAGCSVDDLLGWSENKGGNIEKFDGFLSSLGTPKDQVESMIIHARYKMGWIEKEKV
FT                   ADEEVQDAS"
FT   gene            473524..476178
FT                   /gene="infB"
FT                   /locus_tag="CLIBASIA_03390"
FT   CDS_pept        473524..476178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CLIBASIA_03390"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57260"
FT                   /db_xref="GOA:C6XFV7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV7"
FT                   /protein_id="ACT57260.1"
FT                   /translation="MTDNKDNKKSNVVEKKTLTLKTSSLGVGHSSFQNQGANQGRARSV
FT                   VVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQK
FT                   NDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQV
FT                   PEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNR
FT                   GKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRR
FT                   RQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDV
FT                   IDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSL
FT                   LDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAV
FT                   LVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMG
FT                   GDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTV
FT                   LVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQGMPMAGDKFGV
FT                   VDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQG
FT                   SVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASGAVIFGFNVRASSQARVLA
FT                   IKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKV
FT                   SEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDM
FT                   IECFSIEHIKRSL"
FT   gene            476229..476615
FT                   /gene="rbfA"
FT                   /locus_tag="CLIBASIA_03385"
FT   CDS_pept        476229..476615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CLIBASIA_03385"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57259"
FT                   /db_xref="GOA:C6XFV6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV6"
FT                   /protein_id="ACT57259.1"
FT                   /translation="MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISIS
FT                   EVCMSVDLRVATVYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYD
FT                   TSLQSYWKLNALMCLPKIPVALEK"
FT   gene            476758..477027
FT                   /gene="rpsO"
FT                   /locus_tag="CLIBASIA_03380"
FT   CDS_pept        476758..477027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="CLIBASIA_03380"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57258"
FT                   /db_xref="GOA:C6XFV5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV5"
FT                   /protein_id="ACT57258.1"
FT                   /translation="MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKS
FT                   AKKDVNSKIGLGRLISLRSSLLKYLERKDVERYKRLVQSLKLRR"
FT   gene            477223..479322
FT                   /gene="pnp"
FT                   /locus_tag="CLIBASIA_03375"
FT   CDS_pept        477223..479322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="CLIBASIA_03375"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /note="COG1185 Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57257"
FT                   /db_xref="GOA:C6XFV4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV4"
FT                   /protein_id="ACT57257.1"
FT                   /translation="MFDVHTVEIEWAGRPLKLETGRIARQSDGAVLATYGETVVLATVV
FT                   YDRSLKDGQDFFPLTVNYQERTYAVGKIPGGYLRRESRPTENEILISRMIDRSIRPLFS
FT                   KCYKNETQVIINVMQHDLESSPHVVSMVAASAALMLSGLPFEGPVVGAQVDYINGQYVL
FT                   NPRLDEDQGSLDLFVSGTQDAVLMVELEANQLSEDVVLDAIIFGHNECKPVIEAISKLA
FT                   KMCAKEPIVIDSKDFSKLEEEMSQMIKEDLRVSCFIPEKYVRCKQIDDLKKKMVSYFSS
FT                   EHSSWNEGEIVSVFEDIQAKVVRTVMLDKKVRMDGRDSETVRDISAQVGLLQRTHGSSL
FT                   FIRGDTQAIVVVTLGTREDEQYVDSLSGTQRNDFMMHYNFLPCATGEVSRMGAPSRREI
FT                   GHGRLARRAIHPVLPQTAQFPYTLRIVSEITESDGSSSMATVCGSSLALMDAGVPISKP
FT                   VAGIAMGLVKDGDDFIILSDISGDEDHLGHMDFKVAGTDSGITAMQMDMKIGGISENIM
FT                   VMALQQAKRGRLHILNEMSKVLSESRLQLGEFTPRVEIMAIPPDQIRNVIGMGGKVIRG
FT                   IVEQTGAKVNIDDDGTVKIASSSLAEIEAAREMIRSITDVPEVNKIYKGQVVKVMDFGA
FT                   FVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDRGKIKLSMKVVDQNT
FT                   GKPIV"
FT   gene            479917..480366
FT                   /locus_tag="CLIBASIA_03370"
FT   CDS_pept        479917..480366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03370"
FT                   /product="transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57256"
FT                   /db_xref="GOA:C6XFV3"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV3"
FT                   /protein_id="ACT57256.1"
FT                   /translation="MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSA
FT                   LQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPD
FT                   EYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV"
FT   gene            complement(480461..481630)
FT                   /gene="dapE"
FT                   /locus_tag="CLIBASIA_03365"
FT   CDS_pept        complement(480461..481630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="CLIBASIA_03365"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57255"
FT                   /db_xref="GOA:C6XFV2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV2"
FT                   /protein_id="ACT57255.1"
FT                   /translation="MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDF
FT                   QTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIV
FT                   DMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDAC
FT                   IVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNI
FT                   GFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLI
FT                   KGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARF
FT                   IKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITPSQ"
FT   gene            481548..481679
FT                   /locus_tag="CLIBASIA_03362"
FT   CDS_pept        481548..481679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT66818"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH48"
FT                   /protein_id="ACT66818.1"
FT                   /translation="MKNAPPSCGVTEGHFINCMRCSRQSGVIVAKRFDIMNNHVIVY"
FT   gene            complement(481651..482508)
FT                   /gene="dapD"
FT                   /locus_tag="CLIBASIA_03360"
FT   CDS_pept        complement(481651..482508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="CLIBASIA_03360"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="COG2171 Tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57254"
FT                   /db_xref="GOA:C6XFV1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV1"
FT                   /protein_id="ACT57254.1"
FT                   /translation="MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGI
FT                   IRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDF
FT                   EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVH
FT                   ISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIID
FT                   RNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLL
FT                   RDYS"
FT   gene            complement(482599..483066)
FT                   /locus_tag="CLIBASIA_03355"
FT   CDS_pept        complement(482599..483066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03355"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="COG0537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57253"
FT                   /db_xref="GOA:C6XFV0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFV0"
FT                   /protein_id="ACT57253.1"
FT                   /translation="MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNP
FT                   GHVLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTV
FT                   PHLHFHVIPCKNGDNASHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT"
FT   gene            483451..483624
FT                   /locus_tag="CLIBASIA_03352"
FT   CDS_pept        483451..483624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT66819"
FT                   /db_xref="UniProtKB/TrEMBL:C6XH49"
FT                   /protein_id="ACT66819.1"
FT                   /translation="MMFWHCDSRFAEDKPDIQGFLSYGSSTIYHTTALREWSTIWSSEF
FT                   FMESEDGTLHFL"
FT   gene            483518..484354
FT                   /gene="rpsB"
FT                   /locus_tag="CLIBASIA_03350"
FT   CDS_pept        483518..484354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="CLIBASIA_03350"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57252"
FT                   /db_xref="GOA:C6XFU9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU9"
FT                   /protein_id="ACT57252.1"
FT                   /translation="MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDL
FT                   SQTVPMLQKALQVISDTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMT
FT                   NWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMF
FT                   VVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAA
FT                   IDGIARQHSYMGADTKSAGETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS"
FT   gene            484385..485275
FT                   /gene="tsf"
FT                   /locus_tag="CLIBASIA_03345"
FT   CDS_pept        484385..485275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="CLIBASIA_03345"
FT                   /product="elongation factor Ts"
FT                   /note="COG0264 Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57251"
FT                   /db_xref="GOA:C6XFU8"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU8"
FT                   /protein_id="ACT57251.1"
FT                   /translation="MSKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKG
FT                   AMAASKREGRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALST
FT                   DGSLDNVLAMPFDHSGITVGDGIKQQIAITGECIKLRRSALLCVSEGVISSYLHASPSE
FT                   GLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMT
FT                   EALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKESEKSIGASIEV
FT                   VGVSHFVVGKENDDG"
FT   gene            485335..486063
FT                   /gene="pyrH"
FT                   /locus_tag="CLIBASIA_03340"
FT   CDS_pept        485335..486063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="CLIBASIA_03340"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57250"
FT                   /db_xref="GOA:C6XFU7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU7"
FT                   /protein_id="ACT57250.1"
FT                   /translation="MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKG
FT                   IEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVI
FT                   LSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILK
FT                   GTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHS
FT                   PGGIWGGLSGIGRSTIISGE"
FT   gene            486103..486663
FT                   /gene="frr"
FT                   /locus_tag="CLIBASIA_03335"
FT   CDS_pept        486103..486663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="CLIBASIA_03335"
FT                   /product="ribosome recycling factor"
FT                   /note="COG0233 Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57249"
FT                   /db_xref="GOA:C6XFU6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU6"
FT                   /protein_id="ACT57249.1"
FT                   /translation="MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEA
FT                   YGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVP
FT                   ETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQK
FT                   ITDSTIKNIDSFFEEKKKEIMHF"
FT   gene            486687..487418
FT                   /gene="uppS"
FT                   /locus_tag="CLIBASIA_03330"
FT   CDS_pept        486687..487418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="CLIBASIA_03330"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /note="COG0020 Undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57248"
FT                   /db_xref="GOA:C6XFU5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU5"
FT                   /protein_id="ACT57248.1"
FT                   /translation="MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNE
FT                   IVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIG
FT                   NRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSH
FT                   DVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELF
FT                   FHALNQYNLRDRRFGGLSKKG"
FT   gene            487430..488239
FT                   /gene="cdsA"
FT                   /locus_tag="CLIBASIA_03325"
FT   CDS_pept        487430..488239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="CLIBASIA_03325"
FT                   /product="phosphatidate cytidylyltransferase protein"
FT                   /note="COG0575 CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57247"
FT                   /db_xref="GOA:C6XFU4"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU4"
FT                   /protein_id="ACT57247.1"
FT                   /translation="MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEW
FT                   KIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFW
FT                   RALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKI
FT                   SPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRY
FT                   FGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK"
FT   gene            488309..489358
FT                   /locus_tag="CLIBASIA_03320"
FT   CDS_pept        488309..489358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03320"
FT                   /product="zinc metallopeptidase"
FT                   /note="COG0750 Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57246"
FT                   /db_xref="GOA:C6XFU3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU3"
FT                   /protein_id="ACT57246.1"
FT                   /translation="MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGP
FT                   ELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA
FT                   ILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN
FT                   PLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ
FT                   SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA
FT                   MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI
FT                   RNDIYGLMQ"
FT   gene            489425..491770
FT                   /gene="omp"
FT                   /locus_tag="CLIBASIA_03315"
FT   CDS_pept        489425..491770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp"
FT                   /locus_tag="CLIBASIA_03315"
FT                   /product="surface antigen (D15)"
FT                   /note="COG4775 Outer membrane protein/protective antigen
FT                   OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57245"
FT                   /db_xref="GOA:C6XFU2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU2"
FT                   /protein_id="ACT57245.1"
FT                   /translation="MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNT
FT                   SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS
FT                   VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASI
FT                   GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG
FT                   YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGE
FT                   IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV
FT                   KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSM
FT                   IERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV
FT                   EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
FT                   LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS
FT                   ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS
FT                   LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAV
FT                   SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGM
FT                   MGVYYGIPLRHREGDKIQQFGFRIGNRM"
FT   gene            491800..492843
FT                   /gene="lpxD"
FT                   /locus_tag="CLIBASIA_03310"
FT   CDS_pept        491800..492843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="CLIBASIA_03310"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1044 UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57244"
FT                   /db_xref="GOA:C6XFU1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU1"
FT                   /protein_id="ACT57244.1"
FT                   /translation="MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARA
FT                   STGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY
FT                   PQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGA
FT                   GVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQ
FT                   DKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGD
FT                   NVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKP
FT                   SKYKIKR"
FT   gene            492845..493330
FT                   /gene="fabZ"
FT                   /locus_tag="CLIBASIA_03305"
FT   CDS_pept        492845..493330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="CLIBASIA_03305"
FT                   /product="(3R)-hydroxymyristoyl-ACP dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57243"
FT                   /db_xref="GOA:C6XFU0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:4ZW0"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFU0"
FT                   /protein_id="ACT57243.1"
FT                   /translation="MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIK
FT                   NVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFR
FT                   KPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG"
FT   gene            493314..494129
FT                   /gene="lpxA"
FT                   /locus_tag="CLIBASIA_03300"
FT   CDS_pept        493314..494129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="CLIBASIA_03300"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COG1043 Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57242"
FT                   /db_xref="GOA:C6XFT9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT9"
FT                   /protein_id="ACT57242.2"
FT                   /translation="MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVE
FT                   LISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGT
FT                   VEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQ
FT                   FTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYK
FT                   QIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK"
FT   gene            494138..494983
FT                   /locus_tag="CLIBASIA_03295"
FT   CDS_pept        494138..494983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03295"
FT                   /product="hypothetical protein"
FT                   /note="COG3494 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57241"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT8"
FT                   /protein_id="ACT57241.1"
FT                   /translation="MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE
FT                   CRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG
FT                   GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEA
FT                   LSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQD
FT                   MRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
FT                   "
FT   gene            494980..496131
FT                   /gene="lpxB"
FT                   /locus_tag="CLIBASIA_03290"
FT   CDS_pept        494980..496131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="CLIBASIA_03290"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="COG0763 Lipid A disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57240"
FT                   /db_xref="GOA:C6XFT7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT7"
FT                   /protein_id="ACT57240.1"
FT                   /translation="MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQ
FT                   KEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRV
FT                   AKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTT
FT                   FVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVK
FT                   RNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILE
FT                   LALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWI
FT                   ERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG"
FT   gene            496231..497358
FT                   /gene="recF"
FT                   /locus_tag="CLIBASIA_03285"
FT   CDS_pept        496231..497358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CLIBASIA_03285"
FT                   /product="recombination protein F"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57239"
FT                   /db_xref="GOA:C6XFT6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT6"
FT                   /protein_id="ACT57239.1"
FT                   /translation="MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILE
FT                   AISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQ
FT                   INDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFE
FT                   RLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP
FT                   HIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKA
FT                   ITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD
FT                   IGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI"
FT   gene            complement(497362..498168)
FT                   /gene="kdsB"
FT                   /locus_tag="CLIBASIA_03280"
FT   CDS_pept        complement(497362..498168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="CLIBASIA_03280"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="COG1212 CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57238"
FT                   /db_xref="GOA:C6XFT5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT5"
FT                   /protein_id="ACT57238.1"
FT                   /translation="MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRAR
FT                   KANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVN
FT                   MQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCF
FT                   RALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMR
FT                   IDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS"
FT   gene            complement(498335..498919)
FT                   /locus_tag="CLIBASIA_03275"
FT   CDS_pept        complement(498335..498919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03275"
FT                   /product="hypothetical protein"
FT                   /note="COG3807 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57237"
FT                   /db_xref="GOA:C6XFT4"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT4"
FT                   /protein_id="ACT57237.1"
FT                   /translation="MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHE
FT                   KEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFD
FT                   GTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIREC
FT                   SGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK"
FT   gene            501182..501505
FT                   /locus_tag="CLIBASIA_03260"
FT   CDS_pept        501182..501505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03260"
FT                   /product="hypothetical protein"
FT                   /note="COG0718 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57236"
FT                   /db_xref="GOA:C6XFT3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT3"
FT                   /protein_id="ACT57236.1"
FT                   /translation="MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRING
FT                   KNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLK
FT                   FPF"
FT   gene            501676..502281
FT                   /gene="recR"
FT                   /locus_tag="CLIBASIA_03255"
FT   CDS_pept        501676..502281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CLIBASIA_03255"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57235"
FT                   /db_xref="GOA:C6XFT2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT2"
FT                   /protein_id="ACT57235.1"
FT                   /translation="MQKKITGKEIENLIKILARIPGFGPRSARRATLHLVKKKEQLLGP
FT                   LAEAMANIYNKVCLCSICGNVDTTDPCAICIDQQRDASVIIVVEDVADLWALERSKAVN
FT                   ALYHVLGGSLSPLDRIGPEDIGIQSLIERIEVKKIRELIFAISATIEGQTTAHYIMDKL
FT                   KGIDVKITRLAYGIPMGSELDYLDDGTIFEAIRSRTVL"
FT   gene            complement(504260..505681)
FT                   /locus_tag="CLIBASIA_03240"
FT   CDS_pept        complement(504260..505681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03240"
FT                   /product="probable FAD-dependent oxidoreductase protein"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57234"
FT                   /db_xref="GOA:C6XFT1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT1"
FT                   /protein_id="ACT57234.1"
FT                   /translation="MNQLSLDLIQRFISIVGSEGILDDQKLISPYLTEERKIYHGTSPL
FT                   VLLPSCTHEVSQILKLATETNTSITPQGGNTGLVGGQIPRKNRKDIILSIKRMNRIRDI
FT                   DLRSNTIAVDAGINLFNVQKIAEKNHRLFPLSLPSEKYCHIGGNLATNAGGTAVLSYGN
FT                   IRHLCLGIEAVLPTGDIWNGMHKLIKDNSRYDIRDLLIGSEGTLGIITGAVLRLLPYRT
FT                   GKQVAFIAVNSLEQALQLLQLSQKTAGSMLTAFELISNFILKLVVKHIPNTFSPLSDTS
FT                   PWYILLEISSTETLERAQNIANTILATGFNKKILTEWILPSLDEEKNAIWCLRNNIPLA
FT                   QKREGRSIKHDISVPIGQIPSFLQEVKKSVSSIFPKTRIGLFGHIGDGNIHFNVFPPTD
FT                   ENQDEFLSLHWNTINNIVYSVVLSYGGSIAAEHGIGQLHKKRLEGILEPTEIKIMKKIK
FT                   EIFDPAGIMNPGKFL"
FT   gene            complement(505678..506670)
FT                   /locus_tag="CLIBASIA_03235"
FT   CDS_pept        complement(505678..506670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03235"
FT                   /product="hypothetical protein"
FT                   /note="COG0009 Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57233"
FT                   /db_xref="GOA:C6XFT0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFT0"
FT                   /protein_id="ACT57233.1"
FT                   /translation="MQIMSITDSNALRKACEFLDAGLPIAIPTETVYGLAVDSRNPTAI
FT                   RRLYEIKKRPAMNPLICHVSDISMVKKHASVDPLSLHLAKLFWPGPLTLVLDLLSTTDI
FT                   HPLSTANLKTACFRVPCGFTKKLIETYGHPLAIPSANRSGQISITNVKHILSSSICKEI
FT                   PLIIDGGISKIGLESTIVNVQCEKKVRILRPGGLEIETLKRAISVELEYCVDETSTPQS
FT                   PGMLKSHYAPRSQVRLRAIHVNPREALIRFGNVPIKNIENAIISLNLSKTGKLKEAAFN
FT                   LFNYMKIADDSGASSIAFSSIPNHGLGIAINNRLERAAAPRNQSQRIVP"
FT   gene            complement(506971..507459)
FT                   /locus_tag="CLIBASIA_03230"
FT   CDS_pept        complement(506971..507459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57232"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS9"
FT                   /protein_id="ACT57232.1"
FT                   /translation="MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHD
FT                   KEGSKHTMNAEFSVPKNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNA
FT                   EFSVPKNDEKYTISACASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP"
FT   gene            complement(508231..508307)
FT                   /locus_tag="CLIBASIA_t05743"
FT   tRNA            complement(508231..508307)
FT                   /locus_tag="CLIBASIA_t05743"
FT                   /product="tRNA-Arg"
FT   gene            complement(508500..509150)
FT                   /locus_tag="CLIBASIA_03225"
FT   CDS_pept        complement(508500..509150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03225"
FT                   /product="hypothetical protein"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57231"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS8"
FT                   /protein_id="ACT57231.1"
FT                   /translation="MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVI
FT                   QSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRM
FT                   NARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIG
FT                   RTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI"
FT   gene            complement(509284..510207)
FT                   /gene="glyQ"
FT                   /locus_tag="CLIBASIA_03220"
FT   CDS_pept        complement(509284..510207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="CLIBASIA_03220"
FT                   /product="glycyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG0752 Glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57230"
FT                   /db_xref="GOA:C6XFS7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS7"
FT                   /protein_id="ACT57230.1"
FT                   /translation="MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFH
FT                   PSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIE
FT                   SLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPI
FT                   SGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEI
FT                   LHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTER
FT                   QRYILRIRSLAKACGEAFLMTPNGGH"
FT   gene            complement(510535..511212)
FT                   /locus_tag="CLIBASIA_03215"
FT   CDS_pept        complement(510535..511212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03215"
FT                   /product="methyltransferase protein"
FT                   /note="COG4123 Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57229"
FT                   /db_xref="GOA:C6XFS6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS6"
FT                   /protein_id="ACT57229.2"
FT                   /translation="MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSP
FT                   LMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI
FT                   GTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGS
FT                   LEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL
FT                   TRL"
FT   gene            511504..512472
FT                   /gene="ispB"
FT                   /locus_tag="CLIBASIA_03210"
FT   CDS_pept        511504..512472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="CLIBASIA_03210"
FT                   /product="octaprenyl-diphosphate synthase protein"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57228"
FT                   /db_xref="GOA:C6XFS5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS5"
FT                   /protein_id="ACT57228.1"
FT                   /translation="MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRL
FT                   RPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQ
FT                   TSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLH
FT                   VIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMG
FT                   KNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALV
FT                   DTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN"
FT   gene            512719..513513
FT                   /gene="ppnK"
FT                   /locus_tag="CLIBASIA_03205"
FT   CDS_pept        512719..513513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="CLIBASIA_03205"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57227"
FT                   /db_xref="GOA:C6XFS4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS4"
FT                   /protein_id="ACT57227.1"
FT                   /translation="MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGG
FT                   DGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFD
FT                   YDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGS
FT                   TAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATA
FT                   DRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS"
FT   gene            complement(513525..514592)
FT                   /gene="prfB"
FT                   /locus_tag="CLIBASIA_03200"
FT   CDS_pept        complement(513525..514592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="CLIBASIA_03200"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57226"
FT                   /db_xref="GOA:C6XFS3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS3"
FT                   /protein_id="ACT57226.1"
FT                   /translation="MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKML
FT                   MRERQHLDNAISFIKEIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQF
FT                   ESLLSGEADSNDAYLEVHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEA
FT                   GIKSATLLIKGPNAYGWLKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIE
FT                   ISESDCRIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLR
FT                   AKLYELELQKREEIANIGESSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLD
FT                   GDLDDFMKATLAIKK"
FT   gene            complement(514686..517139)
FT                   /gene="mrcA"
FT                   /locus_tag="CLIBASIA_03195"
FT   CDS_pept        complement(514686..517139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="CLIBASIA_03195"
FT                   /product="penicillin binding peptidoglycan synthetase
FT                   protein"
FT                   /note="COG5009 Membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57225"
FT                   /db_xref="GOA:C6XFS2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS2"
FT                   /protein_id="ACT57225.1"
FT                   /translation="MYYRIVSFIGYFFGFATYSILGAILGASIYIAKISQNLPDYAALN
FT                   SYSPAVTTRIHAGNGALMAEYARENRLFLPIQIIPSHVKYAFVSAEDKNFYYHSGVDIF
FT                   GIMRAVLHNIRNISHGRRPEGASTITQQVAKNFLLTSNQTMDRKIKEILLSFRLEKAYD
FT                   KEKILEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRK
FT                   NKAAIARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHLFGSEYFAEEVRRQL
FT                   IDRYGEKALYEDGLSIRTSLDPQLQLYARKALQNGLINYDQNDGFRGPIKRIDLKKDWG
FT                   NTLASIPTLYDVPEWDIAVVLEVSNSHITIGIRPTIDSNGKVTTERKKGIIEADSMRWV
FT                   YNKEQTTEETSENRNVLSLGDVIYVEHINEGWRLRQIPKVQGGLIAMDPRTGRILATIG
FT                   GFSYSQSEFNRSTQAMRQPGSCFKPIVYAAALDSGYTPASVIMDAPIEVVSRGKIWKPE
FT                   NYSKNFSGASTLRFGLEKSRNLMTVRLAHNMGMTVVADYAENFGIYDKMLPVLPMSLGA
FT                   GETTVLRMVSAYAVFANGGKQIRPSFIDRIQNRYGKTIFNQEQRICDDCNYDTWNGQDE
FT                   PEIIDKREQVLDPMTAYQITSMLEGVIKHGTATGKVRLNRPVAGKTGTTSSYRDTWFIG
FT                   YTPTLVVGVYVGYDIPAPLNNHATGSTLTAPIFNAFMKEALKNIPSSRFVAPPGMSLIP
FT                   INKWTGMLSKKGDPDTIIEAFKPGTGPAETYTVIDEDSNVSSEEILRRSPQANQAINSG
FT                   SGGLY"
FT   gene            517904..520075
FT                   /locus_tag="CLIBASIA_03190"
FT   CDS_pept        517904..520075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03190"
FT                   /product="ribonuclease E"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57224"
FT                   /db_xref="GOA:C6XFS1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS1"
FT                   /protein_id="ACT57224.1"
FT                   /translation="MANKMLIDASHVEETRVVVLRDNRVEELDFESEHKKQIKGNIYLA
FT                   KVTRVEPSLQAAFVDYGGNRHGFLPFLEIHPDYYQIPFSDRQALLKESNIAQTDSEAVA
FT                   DDVTHGDVTIPNDHSLEEVAPIANFSQETEEESIISANNDVVSNVEDVKGGSPEDVPKK
FT                   FKRQYCIQEVIKNRQILLVQIVKEERGNKGAAVTTYLSLAGRYSVLMPNTSKGETISRK
FT                   ITNPVDRKNLKEIARGLEVPAGMGVILRTAGASRTKIEIKRDFEYLMRLWDNVRELALN
FT                   SVAPHLVYEEGNLIKRAIRDLYCKDISEIIVSGEKGYREAKDFMKLLMPSYARIVRQYE
FT                   DPHPIFFRSGIEVQLDSLHQTEVTLPSRGYVIINQTEALVSIDVNSGRSTREHCIEDTA
FT                   LQTNLEAAEEIARQLRLRDLAGLIVVDFIDMEEKKNNRSVEKKLKESLKKDRARVQVGA
FT                   ISNFGLLEMSRQRIRSSVLESTTKVCTYCKGAGYIRSQSSVALSILRSVEEYLLQYTAH
FT                   NIIVHTHSDVVLYLLNQKRATIVEYEARFGVSINVVIGIELADKLFYIEKGSPVQALVN
FT                   TGHKVGSDSQAPSYDKNIECVWQDEALLPIPKSESLEDIQDNIVSEESTGVIRKRRRRR
FT                   RRRRPATDHHDAGVVSDVSSIQNVIDDSFDMYMEPSDITNHNLLENGAHGFTENYDVSI
FT                   PPVSTPEMESSNSSSDPIVKKTRWWKRRK"
FT   gene            complement(520299..523061)
FT                   /gene="mutS"
FT                   /locus_tag="CLIBASIA_03185"
FT   CDS_pept        complement(520299..523061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="CLIBASIA_03185"
FT                   /product="DNA mismatch repair protein"
FT                   /note="COG0249 Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57223"
FT                   /db_xref="GOA:C6XFS0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFS0"
FT                   /protein_id="ACT57223.1"
FT                   /translation="MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVF
FT                   YRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHR
FT                   IAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEW
FT                   AIAWIDISTGIFKISTSNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVA
FT                   QPNVFFDHSISESRIADYYNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYP
FT                   EREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTD
FT                   STKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIR
FT                   SGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGAD
FT                   ASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDL
FT                   ESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESL
FT                   DNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFI
FT                   ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD
FT                   KLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWA
FT                   TIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADH
FT                   SYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDK
FT                   LFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKYSTDEDSEPLSSKQEN"
FT   gene            complement(523148..523474)
FT                   /gene="lspA"
FT                   /locus_tag="CLIBASIA_03180"
FT   CDS_pept        complement(523148..523474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="CLIBASIA_03180"
FT                   /product="lipoprotein signal peptidase transmembrane"
FT                   /note="COG0597 Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57222"
FT                   /db_xref="GOA:C6XFR9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR9"
FT                   /protein_id="ACT57222.1"
FT                   /translation="MLSNVSPTILVSIRILIIAFIFFIWKKNPKTKSIFDIGYILITTG
FT                   ALGNVVDHCLYGYVIDYIMIHTQTWSFAVFNLADLFISIGTCIIIYDDIILQHRQKGKI
FT                   DFPQ"
FT   gene            complement(523817..524119)
FT                   /locus_tag="CLIBASIA_03175"
FT   CDS_pept        complement(523817..524119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03175"
FT                   /product="integration host factor, beta subunit"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57221"
FT                   /db_xref="GOA:C6XFR8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR8"
FT                   /protein_id="ACT57221.1"
FT                   /translation="MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEI
FT                   RGFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS"
FT   gene            complement(524153..525034)
FT                   /locus_tag="CLIBASIA_03170"
FT   CDS_pept        complement(524153..525034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03170"
FT                   /product="putative protease IV transmembrane protein"
FT                   /note="COG0616 Periplasmic serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57220"
FT                   /db_xref="GOA:C6XFR7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR7"
FT                   /protein_id="ACT57220.1"
FT                   /translation="MEFVLKKIKTRYVMLSLVTLTVVYFSWSSHVEDNSPHVARIAIRG
FT                   QIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKVKNRKPVITEVH
FT                   EMAASAGYLISCASNIIVAAETSLVGSIGVLFQYPYVKPFLDKLGVSIKSVKSSPMKAE
FT                   PSPFSEVNPKAVQMMQDVVDSSYHWFVRLVSESRNIPYDKTLVLSDGRIWTGAEAKKVG
FT                   LIDVVGGQEEVWQSLYALGVDQSIRKIKDWNPPKNYWFCDLKNLSISSLLEDTIPLMKQ
FT                   TKVQGLWAVWNP"
FT   gene            525272..525919
FT                   /locus_tag="CLIBASIA_03165"
FT   CDS_pept        525272..525919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57219"
FT                   /db_xref="GOA:C6XFR6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR6"
FT                   /protein_id="ACT57219.1"
FT                   /translation="MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLS
FT                   SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQ
FT                   DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN
FT                   ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN"
FT   gene            525949..526494
FT                   /locus_tag="CLIBASIA_03160"
FT   CDS_pept        525949..526494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03160"
FT                   /product="OstA family protein"
FT                   /note="COG1934 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57218"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR5"
FT                   /protein_id="ACT57218.1"
FT                   /translation="MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKI
FT                   HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN
FT                   IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL
FT                   QGCESDQVQSIIRYDGRP"
FT   gene            526491..527279
FT                   /locus_tag="CLIBASIA_03155"
FT   CDS_pept        526491..527279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03155"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /note="COG1137 ABC-type (unclassified) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57217"
FT                   /db_xref="GOA:C6XFR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR4"
FT                   /protein_id="ACT57217.1"
FT                   /translation="MKSIRNYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVD
FT                   LYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISY
FT                   LPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQ
FT                   RRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEIL
FT                   TLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF"
FT   gene            complement(527692..528477)
FT                   /locus_tag="CLIBASIA_03150"
FT   CDS_pept        complement(527692..528477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03150"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /note="COG1573 Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57216"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR3"
FT                   /protein_id="ACT57216.1"
FT                   /translation="MTSKRILSQEQILTIALFYADSGVYWVFDEPNNEATYESQRKEKS
FT                   IDSAIQPITNIRHIHSPLVQQADSIAQKACSLHELKSLLRSFHDCHLCSTSLSTICATQ
FT                   TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGN
FT                   RNLSNIEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTP
FT                   HSIIPTLATVHPQELIQYPLIKKNTWHALITLKKALKNL"
FT   gene            complement(528606..529865)
FT                   /locus_tag="CLIBASIA_03145"
FT   CDS_pept        complement(528606..529865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03145"
FT                   /product="hypothetical protein"
FT                   /note="COG1748 Saccharopine dehydrogenase and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57215"
FT                   /db_xref="GOA:C6XFR2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR2"
FT                   /protein_id="ACT57215.1"
FT                   /translation="MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKII
FT                   DSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDS
FT                   NVAYIDTAIHESPLKICESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLA
FT                   QDEYFDKITDIDIIDVNAGKHDKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEIS
FT                   RTYDLPTVGQHKVYLSGHDEIHSLFKNIQGADIRFWMGFSDHYINVFTVLKNIGLLSEQ
FT                   PIRTAENIEIAPLKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDH
FT                   QNAYQEIASQGISYTAGTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGLAT
FT                   SLRTNHKEHQLQFDEKLINQ"
FT   gene            complement(529934..531037)
FT                   /gene="nspC"
FT                   /locus_tag="CLIBASIA_03140"
FT   CDS_pept        complement(529934..531037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="CLIBASIA_03140"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="COG0019 Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57214"
FT                   /db_xref="GOA:C6XFR1"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR1"
FT                   /protein_id="ACT57214.1"
FT                   /translation="MIKTPYYLIDKQKLLNNLDTALYIRKNAGVKLLLALKCFAAWGMF
FT                   DTLNQYMDGTTSSSLYEVMLGHEKFGGETHAYNVAYKDCEIDAVLSNCDTIIFNTVSQL
FT                   NKFKDKAQKLHKKIGLRINPSVSYSKFILADPNRPFSRLGEKCKDKIESEIKNVNGLMF
FT                   HNNCENKSFLCFSAMLKNIEKEFGHFITQIEWISLGGGIHFTDKDYPVKDFCQRLKEFS
FT                   EKYSVQIYLEPGEAIVTNTTTLNTTVLDISENIKNLVIVDSSVEAHVPDYLLYQESATI
FT                   YPNTGPYTAMVCGRSCLAGDIFGEFHFEKPVKIGDRISFEDVAGYNINRKNWFNGINMP
FT                   TIAVKNVDGTIKAIREFSYNDYYNNLS"
FT   gene            531385..532050
FT                   /locus_tag="CLIBASIA_03135"
FT   CDS_pept        531385..532050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03135"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COG2802 Uncharacterized protein, similar to the
FT                   N-terminal domain of Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57213"
FT                   /db_xref="GOA:C6XFR0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFR0"
FT                   /protein_id="ACT57213.1"
FT                   /translation="MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIA
FT                   MFDSVLAGDRLIGLVQPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCR
FT                   FRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIE
FT                   EASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ"
FT   gene            532065..532259
FT                   /locus_tag="CLIBASIA_03130"
FT   CDS_pept        532065..532259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03130"
FT                   /product="hypothetical protein"
FT                   /note="COG2835 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57212"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ9"
FT                   /protein_id="ACT57212.1"
FT                   /translation="MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPI
FT                   RSGVPIMLVSEARQVDDQG"
FT   gene            complement(532299..532706)
FT                   /locus_tag="CLIBASIA_03125"
FT   CDS_pept        complement(532299..532706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03125"
FT                   /product="hypothetical protein"
FT                   /note="COG4964 Flp pilus assembly protein, secretin CpaC"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57211"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ8"
FT                   /protein_id="ACT57211.2"
FT                   /translation="MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLIL
FT                   QFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFA
FT                   NEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR"
FT   gene            complement(532696..532878)
FT                   /locus_tag="CLIBASIA_03120"
FT   CDS_pept        complement(532696..532878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57210"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ7"
FT                   /protein_id="ACT57210.1"
FT                   /translation="MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHE
FT                   IQEKKTLAAFTSFAS"
FT   gene            533718..533900
FT                   /locus_tag="CLIBASIA_03115"
FT   CDS_pept        533718..533900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03115"
FT                   /product="hypothetical protein"
FT                   /note="COG3847 Flp pilus assembly protein, pilin Flp"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57209"
FT                   /db_xref="GOA:C6XFQ6"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ6"
FT                   /protein_id="ACT57209.1"
FT                   /translation="MINCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGT
FT                   FEEAANRISNVKSAK"
FT   gene            534217..534444
FT                   /locus_tag="CLIBASIA_03110"
FT   CDS_pept        534217..534444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57208"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ5"
FT                   /protein_id="ACT57208.1"
FT                   /translation="MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTT
FT                   KPPVTRPVTPTSTEMPPRSRYNTGIGYGRT"
FT   gene            535208..535396
FT                   /locus_tag="CLIBASIA_03105"
FT   CDS_pept        535208..535396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03105"
FT                   /product="Flp/Fap pilin component"
FT                   /note="COG3847 Flp pilus assembly protein, pilin Flp"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57207"
FT                   /db_xref="GOA:C6XFQ4"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ4"
FT                   /protein_id="ACT57207.1"
FT                   /translation="MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKK
FT                   AFEAIDKAIVTTSPAAS"
FT   gene            536048..536218
FT                   /locus_tag="CLIBASIA_03100"
FT   CDS_pept        536048..536218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03100"
FT                   /product="hypothetical protein"
FT                   /note="COG3847 Flp pilus assembly protein, pilin Flp"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57206"
FT                   /db_xref="GOA:C6XFQ3"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ3"
FT                   /protein_id="ACT57206.1"
FT                   /translation="MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSK
FT                   VFEDIEKGIKA"
FT   gene            536329..536505
FT                   /locus_tag="CLIBASIA_03095"
FT   CDS_pept        536329..536505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03095"
FT                   /product="hypothetical protein"
FT                   /note="COG3847 Flp pilus assembly protein, pilin Flp"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57205"
FT                   /db_xref="GOA:C6XFQ2"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ2"
FT                   /protein_id="ACT57205.1"
FT                   /translation="MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTA
FT                   VFADISSKLNPKS"
FT   gene            536747..536878
FT                   /locus_tag="CLIBASIA_03090"
FT   CDS_pept        536747..536878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57204"
FT                   /db_xref="GOA:C6XFQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ1"
FT                   /protein_id="ACT57204.2"
FT                   /translation="MQRLIEILLLSSFAVIAIIFLWADIREKSISAFFRDIPIALVK"
FT   gene            537063..537425
FT                   /locus_tag="CLIBASIA_03085"
FT   CDS_pept        537063..537425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57203"
FT                   /db_xref="GOA:C6XFQ0"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFQ0"
FT                   /protein_id="ACT57203.1"
FT                   /translation="MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKG
FT                   VYQTISTELDKGDVPPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQ
FT                   SPAKNKKSYVKPNKSS"
FT   gene            537888..538418
FT                   /locus_tag="CLIBASIA_03080"
FT   CDS_pept        537888..538418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03080"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="COG1989 Type II secretory pathway, prepilin signal
FT                   peptidase PulO and related peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57202"
FT                   /db_xref="GOA:C6XFP9"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP9"
FT                   /protein_id="ACT57202.1"
FT                   /translation="MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFL
FT                   LTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLS
FT                   FLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPD
FT                   SYLFKVALMGLSA"
FT   gene            538530..539321
FT                   /locus_tag="CLIBASIA_03075"
FT   CDS_pept        538530..539321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03075"
FT                   /product="pilus assembly protein"
FT                   /note="COG3745 Flp pilus assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57201"
FT                   /db_xref="GOA:C6XFP8"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP8"
FT                   /protein_id="ACT57201.1"
FT                   /translation="MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKF
FT                   INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK
FT                   GDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER
FT                   KPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS
FT                   IADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS"
FT   gene            539321..540745
FT                   /locus_tag="CLIBASIA_03070"
FT   CDS_pept        539321..540745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03070"
FT                   /product="putative pilus assembly protein"
FT                   /note="COG4964 Flp pilus assembly protein, secretin CpaC"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57200"
FT                   /db_xref="GOA:C6XFP7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP7"
FT                   /protein_id="ACT57200.1"
FT                   /translation="MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG
FT                   KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH
FT                   DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL
FT                   SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS
FT                   SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS
FT                   GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV
FT                   IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR
FT                   NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS
FT                   EVEGQNYKGAIGFIYK"
FT   gene            540742..541473
FT                   /locus_tag="CLIBASIA_03065"
FT   CDS_pept        540742..541473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57199"
FT                   /db_xref="GOA:C6XFP6"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP6"
FT                   /protein_id="ACT57199.2"
FT                   /translation="MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLG
FT                   QLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRG
FT                   FLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGM
FT                   DVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFS
FT                   PRMVTPPDAEQRDKSIQRYRQ"
FT   gene            541529..542812
FT                   /locus_tag="CLIBASIA_03060"
FT   CDS_pept        541529..542812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03060"
FT                   /product="response regulator receiver protein"
FT                   /note="COG4963 Flp pilus assembly protein, ATPase CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57198"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP5"
FT                   /protein_id="ACT57198.1"
FT                   /translation="MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVE
FT                   RSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCD
FT                   SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCS
FT                   ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI
FT                   YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD
FT                   VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT
FT                   PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV
FT                   LMGRVTVSKPQSAMYTKIKKIFNMKCFS"
FT   gene            542825..544276
FT                   /locus_tag="CLIBASIA_03055"
FT   CDS_pept        542825..544276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03055"
FT                   /product="component of type IV pilus"
FT                   /note="COG4962 Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57197"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP4"
FT                   /protein_id="ACT57197.1"
FT                   /translation="MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAE
FT                   GEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKIT
FT                   MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFR
FT                   DNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKD
FT                   KLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIV
FT                   TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVL
FT                   DLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT
FT                   QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWN
FT                   RAAQYGEEKNLAEVLQSLEKQSRAL"
FT   gene            544288..544701
FT                   /locus_tag="CLIBASIA_03050"
FT   CDS_pept        544288..544701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57196"
FT                   /db_xref="GOA:C6XFP3"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP3"
FT                   /protein_id="ACT57196.1"
FT                   /translation="MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRA
FT                   DRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVI
FT                   GFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF"
FT   gene            544698..545261
FT                   /locus_tag="CLIBASIA_03045"
FT   CDS_pept        544698..545261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03045"
FT                   /product="pilus assembly protein"
FT                   /note="COG4965 Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57195"
FT                   /db_xref="GOA:C6XFP2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP2"
FT                   /protein_id="ACT57195.1"
FT                   /translation="MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSS
FT                   DPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALAN
FT                   LSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHM
FT                   LLGVAAAFMLIGIMVMRLMINFDV"
FT   gene            545277..546266
FT                   /locus_tag="CLIBASIA_03040"
FT   CDS_pept        545277..546266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_03040"
FT                   /product="pilus component protein"
FT                   /note="COG2064 Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57194"
FT                   /db_xref="GOA:C6XFP1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP1"
FT                   /protein_id="ACT57194.1"
FT                   /translation="MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRM
FT                   KSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRA
FT                   AGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCA
FT                   PSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEM
FT                   LLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRS
FT                   ERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH"
FT   gene            complement(546391..546885)
FT                   /gene="ftn"
FT                   /locus_tag="CLIBASIA_03035"
FT   CDS_pept        complement(546391..546885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftn"
FT                   /locus_tag="CLIBASIA_03035"
FT                   /product="Ferroxidase"
FT                   /note="COG1528 Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57193"
FT                   /db_xref="GOA:C6XFP0"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFP0"
FT                   /protein_id="ACT57193.1"
FT                   /translation="MTNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKH
FT                   AMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAI
FT                   ETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANK
FT                   S"
FT   gene            complement(547018..547800)
FT                   /gene="znuB"
FT                   /locus_tag="CLIBASIA_03030"
FT   CDS_pept        complement(547018..547800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="CLIBASIA_03030"
FT                   /product="zinc uptake ABC transporter, permease protein"
FT                   /note="COG1108 ABC-type Mn2+/Zn2+ transport systems,
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57192"
FT                   /db_xref="GOA:C6XFN9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN9"
FT                   /protein_id="ACT57192.1"
FT                   /translation="MYNEFFIRALFSGIGIVLSTGPLGCFIIWQRIAYFGDTIAHSALL
FT                   GVALSLIFQLPLTICIFMIATLTSLVLLQIQKNEALSSDAILGVITHSTISLALVILSF
FT                   MKWVNTDLTSFLFGDILAVNTTDILLIWGIGFLNIMILFKIWKPLLATTVNYELAKAEG
FT                   MQPEKIKLIFIMITSLMISVSIKFIGITLITSLLILPTVTARRFSTSPENMAILATIIG
FT                   ILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYKK"
FT   gene            complement(547865..548587)
FT                   /gene="znuC"
FT                   /locus_tag="CLIBASIA_03025"
FT   CDS_pept        complement(547865..548587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="CLIBASIA_03025"
FT                   /product="putative high-affinity zinc uptake system
FT                   ATP-binding component of ABC transporter protein"
FT                   /note="COG1121 ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57191"
FT                   /db_xref="GOA:C6XFN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN8"
FT                   /protein_id="ACT57191.1"
FT                   /translation="MSNALSITPLISLSNTSFHKNGYKILQDINFTIKPNEIVTLIGPN
FT                   GSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQKVTIENTLPLSLMRFMTLSMPSSR
FT                   DDVLQILDRVNLIGKYNRNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGEL
FT                   SLYELITSVRQSTGCGILLISHNLHMVMASTDTVICLNNRICYQGPPQTIKDNAEYIRL
FT                   FGTRATEILAIHNHKHDH"
FT   gene            548673..549557
FT                   /gene="znuA"
FT                   /locus_tag="CLIBASIA_03020"
FT   CDS_pept        548673..549557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="CLIBASIA_03020"
FT                   /product="zinc uptake ABC transporter"
FT                   /note="COG4531 ABC-type Zn2+ transport system, periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57190"
FT                   /db_xref="GOA:C6XFN7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN7"
FT                   /protein_id="ACT57190.1"
FT                   /translation="MKNFLIILIFLFFILSSVARAGSLQVVVSIKPIHSIVSCIMQGIG
FT                   TPALLVKGASSPHEYSLRISEAMMLENADIIFWLGAEMESFLVKPLHSLNKQSNVVTLS
FT                   HSPDLHRILLRDNHSHFHDSEADDLHLWLNPLNVQYIAHVIAMELIKKDPRNKIIYEKN
FT                   EEEFKNQLSQLDKELHSILQPVEKKKIIVFHEAYRYFASHYNLSIVTFPMSHSVFMGAA
FT                   SLRNIRSKIISDKISCLFYGPEFDSKIIRSITNDTGVMSAILDPEGMLIAEGPELYFQL
FT                   MRSMSNSIAKNCS"
FT   gene            complement(549554..550981)
FT                   /gene="gnd"
FT                   /locus_tag="CLIBASIA_03015"
FT   CDS_pept        complement(549554..550981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="CLIBASIA_03015"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="COG0362 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57189"
FT                   /db_xref="GOA:C6XFN6"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN6"
FT                   /protein_id="ACT57189.1"
FT                   /translation="MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK
FT                   ISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGN
FT                   SHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISA
FT                   KYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSK
FT                   WDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTI
FT                   TETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFW
FT                   VIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKV
FT                   KKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRK
FT                   DKISEPHGPWQKVSTES"
FT   gene            complement(551191..551616)
FT                   /gene="rplS"
FT                   /locus_tag="CLIBASIA_03010"
FT   CDS_pept        complement(551191..551616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="CLIBASIA_03010"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57188"
FT                   /db_xref="GOA:C6XFN5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN5"
FT                   /protein_id="ACT57188.1"
FT                   /translation="MNIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQ
FT                   AYEGVCIARSGRGINKNFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYL
FT                   QDLRGKAARIKENTGKRAKALNEEVRRAALPEKEMSK"
FT   gene            complement(551696..552406)
FT                   /gene="trmD"
FT                   /locus_tag="CLIBASIA_03005"
FT   CDS_pept        complement(551696..552406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="CLIBASIA_03005"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57187"
FT                   /db_xref="GOA:C6XFN4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN4"
FT                   /protein_id="ACT57187.1"
FT                   /translation="MTFHASILTLYPEMFPGHLEKSVAGKALACNLWSMDAIQIRNFST
FT                   DRHHSVDDTPAGGGAGMVLRVDILGKAIDHAVSQYTHEDIPRILMSPRGKTLTQKRVRQ
FT                   LSQKLGVIIVCGRFEGIDERIIEARDLEEISVGDYILSGGEPAALILLDAVVRLLPGVL
FT                   GNQQSTIHESFENGLLEFPQYTRPQIWEGLAIPPILNSGDHERIKKWRKEQSFALTKKH
FT                   RPDLLSKKGTLNTQ"
FT   gene            complement(552403..552975)
FT                   /gene="rimM"
FT                   /locus_tag="CLIBASIA_03000"
FT   CDS_pept        complement(552403..552975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="CLIBASIA_03000"
FT                   /product="16S rRNA-processing protein"
FT                   /note="COG0806 RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57186"
FT                   /db_xref="GOA:C6XFN3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN3"
FT                   /protein_id="ACT57186.1"
FT                   /translation="MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDN
FT                   RELRILKMYRKNKRFIATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLE
FT                   EMETFDRQGKYWGQVCGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILID
FT                   PIAAGLNNTTMKNPQYDCPLDSAGKKS"
FT   gene            complement(553068..553418)
FT                   /gene="rpsP"
FT                   /locus_tag="CLIBASIA_02995"
FT   CDS_pept        complement(553068..553418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="CLIBASIA_02995"
FT                   /product="30S ribosomal protein S16"
FT                   /note="COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57185"
FT                   /db_xref="GOA:C6XFN2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN2"
FT                   /protein_id="ACT57185.1"
FT                   /translation="MTLKIRLACGGSKSRHHYRIVVANSRSPRDGKFIEKLGTWNPTLP
FT                   KENPLRFTMNFERIQHWMSKGAQPTDRILFFLDKAGLIKRSPQNNPKKSQPKKKALERL
FT                   ASKKNADEHATT"
FT   gene            complement(553806..555191)
FT                   /gene="ffh"
FT                   /locus_tag="CLIBASIA_02990"
FT   CDS_pept        complement(553806..555191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="CLIBASIA_02990"
FT                   /product="signal recognition particle protein"
FT                   /note="COG0541 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57184"
FT                   /db_xref="GOA:C6XFN1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN1"
FT                   /protein_id="ACT57184.1"
FT                   /translation="MFDNLQERLGSIFQNITGKGSLSETDISNTLREIRRTFLEADVSL
FT                   EVVQSFSKRVQEKAKGEKILRSIQPGQMVIKIVHDELVEVLGKESIELDLNAPSPLVIM
FT                   LVGLQGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVI
FT                   PEQSPEKIAIRATQSARDGGYDAVILDTAGRNHINDSLMQEISEIKSLTNPHEILLVAD
FT                   ALTGQDAVHLARNFDKIVDLTGIILTRMDGDGRGGAALSMRTVTGKPIKAIGTGEKIND
FT                   LENFFPDRIANRILGMGDVVSLVEKAARNLNEKQAALTAKKIAKGKFDLEDLAEQFRQT
FT                   QKIGGIGSILRMLPGMPSLKQNIMPSSFDDKTINHHIAIIASMTKEERANPSIIKHSRK
FT                   KRIAAGSGTNAAKINKLLKLHRQVAEMMHSTQGLGGNALTQQIMGRLKSKIGFGKNGRF
FT                   PDF"
FT   gene            555450..556340
FT                   /gene="dapF"
FT                   /locus_tag="CLIBASIA_02985"
FT   CDS_pept        555450..556340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="CLIBASIA_02985"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COG0253 Diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57183"
FT                   /db_xref="GOA:C6XFN0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFN0"
FT                   /protein_id="ACT57183.1"
FT                   /translation="MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTH
FT                   FDQIMLIHDFQDASVDAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRG
FT                   ILVAKENRDGSISVDMGEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMG
FT                   NPHAIFFVEDDLYHYDLASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLT
FT                   AACGSAACASVVASGCLHKTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDI
FT                   KTGKWIKKNEDDEAY"
FT   gene            556538..557503
FT                   /locus_tag="CLIBASIA_02980"
FT   CDS_pept        556538..557503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02980"
FT                   /product="cell division protein"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57182"
FT                   /db_xref="GOA:C6XFM9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM9"
FT                   /protein_id="ACT57182.1"
FT                   /translation="MSNQKVASESLSWIRKLTKGFASTSLKLKEGITDIISSRRLDDGV
FT                   REELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFN
FT                   WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWAD
FT                   RTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVL
FT                   KRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVT
FT                   HKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYGEEKI"
FT   gene            557500..558114
FT                   /locus_tag="CLIBASIA_02975"
FT   CDS_pept        557500..558114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02975"
FT                   /product="intracellular septation protein A"
FT                   /note="COG2917 Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57181"
FT                   /db_xref="GOA:C6XFM8"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM8"
FT                   /protein_id="ACT57181.1"
FT                   /translation="MSRSQSQSKIVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNLGG
FT                   IIFVSTLLFMVLTAVSLGMFWFFFREFRVIPVVSGVCVLVFGSLTVWLRDESLIKMKPT
FT                   FFYFVFSVVLFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCNEIVWR
FT                   NFSTETWIFFKAIGIFPIFLIFGIVQMNLINKHTILPEERK"
FT   gene            complement(558124..558200)
FT                   /locus_tag="CLIBASIA_t05741"
FT   tRNA            complement(558124..558200)
FT                   /locus_tag="CLIBASIA_t05741"
FT                   /product="tRNA-Thr"
FT   gene            558762..559802
FT                   /locus_tag="CLIBASIA_02970"
FT   CDS_pept        558762..559802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02970"
FT                   /product="putative phosphate-binding periplasmic protein"
FT                   /note="COG0226 ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57180"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM7"
FT                   /protein_id="ACT57180.1"
FT                   /translation="MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAE
FT                   NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD
FT                   IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFP
FT                   EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG
FT                   IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYP
FT                   ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI
FT                   AVGKSG"
FT   gene            559867..561348
FT                   /gene="pstC"
FT                   /locus_tag="CLIBASIA_02965"
FT   CDS_pept        559867..561348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="CLIBASIA_02965"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG0573 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57179"
FT                   /db_xref="GOA:C6XFM6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM6"
FT                   /protein_id="ACT57179.2"
FT                   /translation="MLLLSGFSIIFLGLVSYFLGCLRARFLSKKNAIRLYSKESYYGVY
FT                   VALYSIIPYIFIFLLWFLFSPYIIDFQVSNSFSHYLNSLAEGDRQFSYSILHKIVDSLS
FT                   SLDPDTKFKIQKGDGDISDLLRYQNVISGYVPSPWIIEAAFYQEILSRKSRILMNVCMF
FT                   LFSFLGCSYAILRIKPSFCARSAVEKFIVFLLRNSLLLSIVISFGIIISLFANTFKFFS
FT                   IISATDFFFGIVWDPRFPALGSSNVMGQFGLIPLLIGTFYIGFIAMLFSVPIGLLIAIY
FT                   MAEYAPKKLRAVIKPITEMLVGIPTIVYGFFALSLVGPFLRDISIYMNGLITGNYKSFI
FT                   EAQSVLTAGLVMGIMLIPYVSSLSEDVISSIPRSLRDGSLGLGATRSETMKYVIFPAAF
FT                   PGIAGAILMTASRTIGETMIVVLAAGVAARLQFNPFESMTTITVKIMNQLTGDLDFSSP
FT                   QTLVAFALGLTLFCITFFLNIYAMYIMKKYQRKYE"
FT   gene            561345..562622
FT                   /gene="pstA"
FT                   /locus_tag="CLIBASIA_02960"
FT   CDS_pept        561345..562622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="CLIBASIA_02960"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="COG0581 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57178"
FT                   /db_xref="GOA:C6XFM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM5"
FT                   /protein_id="ACT57178.1"
FT                   /translation="MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVS
FT                   KGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNH
FT                   ALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHR
FT                   MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSF
FT                   PLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALV
FT                   GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGS
FT                   TVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA
FT                   ILLLLIFLAVINTAMLWLRNRFKKRW"
FT   gene            562645..563409
FT                   /gene="pstB"
FT                   /locus_tag="CLIBASIA_02955"
FT   CDS_pept        562645..563409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="CLIBASIA_02955"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /note="COG1117 ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57177"
FT                   /db_xref="GOA:C6XFM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM4"
FT                   /protein_id="ACT57177.1"
FT                   /translation="MNQIYKMISNKVSVCYGEKRALFDINLKIPQNSVTALIGPSGCGK
FT                   STFLRCLNRMNETIDNCVFTGEIILDGKNIYQSSVDVVRLRARVGMVFQRPNPFPKSIY
FT                   DNVAYGPRIHGLGNNKADIDQIVEMSLKKASLFNEVKDRLFHDASLLSGGQQQRVCIAR
FT                   ALAVNPEVILMDEPCSALDPIATASVEELIHELRESLTIVIVTHSMQQAARVSQRAAMF
FT                   HMGHLVEEDDTDKMFTAPSDQRTQDYIMGRFG"
FT   gene            563455..564144
FT                   /gene="phoU"
FT                   /locus_tag="CLIBASIA_02950"
FT   CDS_pept        563455..564144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="CLIBASIA_02950"
FT                   /product="putative phosphate transport system protein"
FT                   /note="COG0704 Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57176"
FT                   /db_xref="GOA:C6XFM3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM3"
FT                   /protein_id="ACT57176.1"
FT                   /translation="MSCHILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVL
FT                   AHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNT
FT                   AKRVLALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAM
FT                   HTSLFRELLTYMMEDPRNITLCTHLLFCSKNIERIGDHVTNIAETIHYMTTGVQPYKER
FT                   VRKEDCE"
FT   gene            complement(564296..564955)
FT                   /gene="grpE"
FT                   /locus_tag="CLIBASIA_02945"
FT   CDS_pept        complement(564296..564955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="CLIBASIA_02945"
FT                   /product="heat shock protein"
FT                   /note="COG0576 Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57175"
FT                   /db_xref="GOA:C6XFM2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM2"
FT                   /protein_id="ACT57175.2"
FT                   /translation="METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRD
FT                   KYLRVIAEMENLRRRTDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKK
FT                   SESVLKSLIEGIEMTRREMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTI
FT                   IKVVQDGYAINERVLRPALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN"
FT   gene            565377..566864
FT                   /locus_tag="CLIBASIA_02940"
FT   CDS_pept        565377..566864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02940"
FT                   /product="putative two-component sensor histidine kinase
FT                   transcriptional regulatory protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57174"
FT                   /db_xref="GOA:C6XFM1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM1"
FT                   /protein_id="ACT57174.1"
FT                   /translation="MYRSRKNKEKDVGLLISPTGDHLGLEYPSKMDFDREIITLHVESL
FT                   FRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVY
FT                   VWRIWLLVGQIAIGLCWTLLTLVEPGTWTPEYLTIYKSATLLIALSISALSNFMLPYAV
FT                   FLSFFPVVVALSTQAIMSMHVLDISLAGMLATALSFFTYITYHLFKSNVKILSCQAEKD
FT                   DLIAELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGP
FT                   LNNETYKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQ
FT                   LRAQEKNIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGR
FT                   GQYISIKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLI
FT                   RSKLREGVEVIAILPNTRVLNFIPEDNHESTQYKCYA"
FT   gene            567333..568802
FT                   /locus_tag="CLIBASIA_02935"
FT   CDS_pept        567333..568802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02935"
FT                   /product="serine protease DO-like protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57173"
FT                   /db_xref="GOA:C6XFM0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFM0"
FT                   /protein_id="ACT57173.1"
FT                   /translation="MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIA
FT                   RVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDT
FT                   VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV
FT                   QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQID
FT                   APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD
FT                   HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS
FT                   HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQ
FT                   DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK
FT                   RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK"
FT   gene            complement(568925..569218)
FT                   /locus_tag="CLIBASIA_02930"
FT   CDS_pept        complement(568925..569218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57172"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL9"
FT                   /protein_id="ACT57172.1"
FT                   /translation="MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKS
FT                   ITKEFMEYWIAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI"
FT   gene            complement(569522..570532)
FT                   /locus_tag="CLIBASIA_02925"
FT   CDS_pept        complement(569522..570532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02925"
FT                   /product="D-alanyl-D-alanine carboxypeptidase 1
FT                   penicillin-binding protein"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57171"
FT                   /db_xref="GOA:C6XFL8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL8"
FT                   /protein_id="ACT57171.1"
FT                   /translation="MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMA
FT                   SELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQI
FT                   PVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMS
FT                   NKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNR
FT                   IITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKAL
FT                   ELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ"
FT   gene            571137..571562
FT                   /gene="mscL"
FT                   /locus_tag="CLIBASIA_02920"
FT   CDS_pept        571137..571562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="CLIBASIA_02920"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="COG1970 Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57170"
FT                   /db_xref="GOA:C6XFL7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL7"
FT                   /protein_id="ACT57170.1"
FT                   /translation="MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIM
FT                   MPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV
FT                   FVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN"
FT   gene            complement(571665..572615)
FT                   /gene="gshB"
FT                   /locus_tag="CLIBASIA_02915"
FT   CDS_pept        complement(571665..572615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="CLIBASIA_02915"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="COG0189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57169"
FT                   /db_xref="GOA:C6XFL6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL6"
FT                   /protein_id="ACT57169.1"
FT                   /translation="MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQ
FT                   LYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYL
FT                   LEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKP
FT                   LYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG
FT                   AVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYIT
FT                   EINVTSPTCIREIHRNGGENVASLFWDGIEKIKET"
FT   gene            572909..574600
FT                   /gene="fliF"
FT                   /locus_tag="CLIBASIA_02910"
FT   CDS_pept        572909..574600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="CLIBASIA_02910"
FT                   /product="flagellar MS-ring protein"
FT                   /note="COG1766 Flagellar biosynthesis/type III secretory
FT                   pathway lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57168"
FT                   /db_xref="GOA:C6XFL5"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL5"
FT                   /protein_id="ACT57168.1"
FT                   /translation="MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNS
FT                   PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPS
FT                   SSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGS
FT                   FRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM
FT                   ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPD
FT                   SKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEI
FT                   NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN
FT                   SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH
FT                   ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQS
FT                   RINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQHIS"
FT   gene            574977..575717
FT                   /locus_tag="CLIBASIA_02905"
FT   CDS_pept        574977..575717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02905"
FT                   /product="probable transcriptional regulator protein, LuxR
FT                   family"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57167"
FT                   /db_xref="GOA:C6XFL4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL4"
FT                   /protein_id="ACT57167.1"
FT                   /translation="MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSW
FT                   TMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQR
FT                   PTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG
FT                   LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA
FT                   SIMRKTATKTRSGAIAYAVRNNIV"
FT   gene            575763..576470
FT                   /locus_tag="CLIBASIA_02900"
FT   CDS_pept        575763..576470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02900"
FT                   /product="transcriptional regulator protein"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57166"
FT                   /db_xref="GOA:C6XFL3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL3"
FT                   /protein_id="ACT57166.1"
FT                   /translation="MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFP
FT                   RRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQL
FT                   SVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL
FT                   FKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI
FT                   QAIAKAIRFGYIC"
FT   gene            complement(576675..576893)
FT                   /locus_tag="CLIBASIA_02895"
FT   CDS_pept        complement(576675..576893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57165"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL2"
FT                   /protein_id="ACT57165.1"
FT                   /translation="MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEAR
FT                   HTQDENLTKACKDELKNIKSNPKEKAK"
FT   gene            complement(577115..577282)
FT                   /locus_tag="CLIBASIA_02890"
FT   CDS_pept        complement(577115..577282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57164"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL1"
FT                   /protein_id="ACT57164.1"
FT                   /translation="MEEDAEVFRTSHVRGVHDILLRSSFFLKLQNMKNIGLQRYYKRVK
FT                   TVIRAKKYQE"
FT   gene            complement(577425..578489)
FT                   /gene="flhB"
FT                   /locus_tag="CLIBASIA_02885"
FT   CDS_pept        complement(577425..578489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="CLIBASIA_02885"
FT                   /product="flagellar biosynthesis protein FlhB"
FT                   /note="COG1377 Flagellar biosynthesis pathway, component
FT                   FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57163"
FT                   /db_xref="GOA:C6XFL0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFL0"
FT                   /protein_id="ACT57163.1"
FT                   /translation="MSENDAPDNKTEAPSSKKIEDALNEGNAPISREASLFSSILACLI
FT                   YLLFFFSPGIYSVTSDLHVLLASATQRKLEDISHIVFLLTHLSLSASRLVIPGLLLFMM
FT                   FGIGSYLIQRIPVLNLNHVKPSFKRVSLREGIKRIYSINNLVNFMKSFVKIILVGTIIT
FT                   ISLTENYFTMLDFISANPHSILYHAFFTVRKVLIMILLFIATLTVLDIGWSYHQWYSKL
FT                   KMSKQEIKDEIKQSYGNPIIKNRQKSIARSRIRHKMMEATSRATIIITNPTHYALALRY
FT                   IQTENDAPVLVAKGQNLIAKKMRKIAYEHNIPIFEEPSLARSLFKQVPINSAIPPVFYK
FT                   AVAQLIYKIYHKKI"
FT   gene            complement(578555..579592)
FT                   /gene="fliG"
FT                   /locus_tag="CLIBASIA_02880"
FT   CDS_pept        complement(578555..579592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="CLIBASIA_02880"
FT                   /product="flagellar motor switch protein G"
FT                   /note="COG1536 Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57162"
FT                   /db_xref="GOA:C6XFK9"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK9"
FT                   /protein_id="ACT57162.1"
FT                   /translation="MNKTTDTVSFKNLYKEISPVSLTQKDKATAILLAMEKQVSGKLLR
FT                   HFTHAELKEIVASAKLLPEISPEELEDIIDEFESQFIAGIGLTENSKNIESILEEGLEQ
FT                   NELEKLLNKSDISQENNNSIWDHLKETDPGVIADFLSKEHPQTTAYVLSMMPPSIGASV
FT                   LLRFPNKIHADIMKRTVNLPKISPYIQKTIEKCIVEMLPQSNSNTSTGPEKVANLINEL
FT                   EKPQVDKLLTSLQEVSKEAFDKVRPKVFLFDDLITLSSHDLSIVFNNISLEVLGKALHG
FT                   TSIETQNAILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIEL
FT                   SNPIK"
FT   gene            complement(579665..580108)
FT                   /gene="fliN"
FT                   /locus_tag="CLIBASIA_02875"
FT   CDS_pept        complement(579665..580108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CLIBASIA_02875"
FT                   /product="putative flagellar motor switch protein"
FT                   /note="COG1886 Flagellar motor switch/type III secretory
FT                   pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57161"
FT                   /db_xref="GOA:C6XFK8"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK8"
FT                   /protein_id="ACT57161.1"
FT                   /translation="MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKN
FT                   DVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITL
FT                   DKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ"
FT   gene            complement(580068..581024)
FT                   /gene="fliM"
FT                   /locus_tag="CLIBASIA_02870"
FT   CDS_pept        complement(580068..581024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="CLIBASIA_02870"
FT                   /product="flagellar C-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57160"
FT                   /db_xref="GOA:C6XFK7"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK7"
FT                   /protein_id="ACT57160.1"
FT                   /translation="MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKF
FT                   LPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLV
FT                   ITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDF
FT                   YDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSEN
FT                   QSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANG
FT                   KEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR"
FT   gene            complement(581028..581900)
FT                   /gene="motA"
FT                   /locus_tag="CLIBASIA_02865"
FT   CDS_pept        complement(581028..581900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="CLIBASIA_02865"
FT                   /product="flagellar motor protein MotA"
FT                   /note="COG1291 Flagellar motor component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57159"
FT                   /db_xref="GOA:C6XFK6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK6"
FT                   /protein_id="ACT57159.2"
FT                   /translation="MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGF
FT                   VMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDP
FT                   YNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYH
FT                   AISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNP
FT                   LTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL
FT                   QYNHNKKAS"
FT   gene            582061..582792
FT                   /gene="flgF"
FT                   /locus_tag="CLIBASIA_02860"
FT   CDS_pept        582061..582792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="CLIBASIA_02860"
FT                   /product="flagellar basal body rod protein FlgF"
FT                   /note="COG4786 Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57158"
FT                   /db_xref="GOA:C6XFK5"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK5"
FT                   /protein_id="ACT57158.1"
FT                   /translation="MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVV
FT                   GAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDG
FT                   RFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSV
FT                   DMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNS
FT                   ITTLIDENEKSMLEAIRNIAS"
FT   gene            582824..584140
FT                   /gene="fliI"
FT                   /locus_tag="CLIBASIA_02855"
FT   CDS_pept        582824..584140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="CLIBASIA_02855"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG1157 Flagellar biosynthesis/type III secretory
FT                   pathway ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57157"
FT                   /db_xref="GOA:C6XFK4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK4"
FT                   /protein_id="ACT57157.1"
FT                   /translation="MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCL
FT                   GDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGR
FT                   VINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQR
FT                   IGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVA
FT                   TSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARG
FT                   YPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR
FT                   SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV
FT                   DLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ"
FT   gene            complement(585069..585323)
FT                   /locus_tag="CLIBASIA_02850"
FT   CDS_pept        complement(585069..585323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02850"
FT                   /product="lipoprotein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57156"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK3"
FT                   /protein_id="ACT57156.1"
FT                   /translation="MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRG
FT                   HTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP"
FT   gene            complement(585492..586091)
FT                   /locus_tag="CLIBASIA_02845"
FT   CDS_pept        complement(585492..586091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57155"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK2"
FT                   /protein_id="ACT57155.1"
FT                   /translation="MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHK
FT                   ALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNK
FT                   QESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPR
FT                   KNINNLKDTNHRLKIKNNQEIKNIHHKKNKPRLHCQ"
FT   gene            complement(586298..587050)
FT                   /gene="surE"
FT                   /locus_tag="CLIBASIA_02840"
FT   CDS_pept        complement(586298..587050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="CLIBASIA_02840"
FT                   /product="stationary phase survival protein SurE"
FT                   /EC_number="3.6.1.11"
FT                   /note="COG0496 Predicted acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57154"
FT                   /db_xref="GOA:C6XFK1"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK1"
FT                   /protein_id="ACT57154.2"
FT                   /translation="MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANS
FT                   LTMSRNIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYS
FT                   GTLAAAFEGSLQGIRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNIN
FT                   FPRCSPEEVQKTVVTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQ
FT                   HNMISVTPITTDLTDYNSQQYISLSLET"
FT   gene            complement(587054..588346)
FT                   /gene="serS"
FT                   /locus_tag="CLIBASIA_02835"
FT   CDS_pept        complement(587054..588346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CLIBASIA_02835"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57153"
FT                   /db_xref="GOA:C6XFK0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFK0"
FT                   /protein_id="ACT57153.1"
FT                   /translation="MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIE
FT                   DIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISC
FT                   IPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGAR
FT                   FSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT
FT                   TDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQF
FT                   WKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVW
FT                   LAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILEN
FT                   YLNADGSVTIPTVLRPYMNNLAVIKKEHILE"
FT   gene            complement(588688..589077)
FT                   /locus_tag="CLIBASIA_02830"
FT   CDS_pept        complement(588688..589077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57152"
FT                   /db_xref="GOA:C6XFJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ9"
FT                   /protein_id="ACT57152.1"
FT                   /translation="MSYLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFS
FT                   NIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLREKKQPQRK
FT                   PITKQKKNPIPLASRSNPMQNNNDR"
FT   gene            complement(589390..589716)
FT                   /locus_tag="CLIBASIA_02825"
FT   CDS_pept        complement(589390..589716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57151"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ8"
FT                   /protein_id="ACT57151.1"
FT                   /translation="MISAPPLLITNKKLLEPDKRKKNTHRKRGKHNDRKILFNHIPFPL
FT                   RTAILALRITLTSISFSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIPSGRT
FT                   QYAL"
FT   gene            complement(589899..590357)
FT                   /locus_tag="CLIBASIA_02820"
FT   CDS_pept        complement(589899..590357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02820"
FT                   /product="hypothetical protein"
FT                   /note="COG2867 Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57150"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ7"
FT                   /protein_id="ACT57150.1"
FT                   /translation="MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNY
FT                   GENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESK
FT                   CKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL"
FT   gene            complement(590378..591367)
FT                   /locus_tag="CLIBASIA_02815"
FT   CDS_pept        complement(590378..591367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02815"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.8"
FT                   /note="COG0320 Lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57149"
FT                   /db_xref="GOA:C6XFJ6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ6"
FT                   /protein_id="ACT57149.1"
FT                   /translation="MVTVFDTINKKKHVLHATPNAERLRHPEKIHKPDTEKMQKPDWIR
FT                   VRAPVSSGYKETYNILRSRNLTTVCEEAGCPNIGECWNKNHATFMILGAICTRACTFCN
FT                   VATGKPQPLDPQEPENISWAVRSMKLSHVVITSVDRDDLDDGGAQHFAEVISAIRESAP
FT                   STTIEVLTPDFLRKPHALEKVVSAKPDVFNHNLETVASNYLMVRPGARYFHSLRLLQRV
FT                   KELDPLIFTKSGIMLGLGETRNEILQLMDDLRTADVDFLTMGQYLQPTRKHHKVESFVT
FT                   PQDFKSYETIAYSKGFLMVSASPLTRSSYHAGDDFLRLKNNRRQHLHE"
FT   gene            complement(591645..593090)
FT                   /gene="lpdA"
FT                   /locus_tag="CLIBASIA_02810"
FT   CDS_pept        complement(591645..593090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="CLIBASIA_02810"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57148"
FT                   /db_xref="GOA:C6XFJ5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ5"
FT                   /protein_id="ACT57148.1"
FT                   /translation="MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNW
FT                   GCIPTKSLLRSAEILDHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMH
FT                   KNKVDIIWGKATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPR
FT                   HIEGIEPDSHLIWTYFDALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDR
FT                   ILPVEDSEISQFVQRSLQKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKL
FT                   LLSAGVQGNIENIGLEKIGVKTSNGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHE
FT                   GIICIEKIAGKSKVYPLDKSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSAN
FT                   GKAITLGEDSGMIKTIFNNKTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVF
FT                   PHPTISETMKESILDAYGRAIHS"
FT   gene            complement(593175..594446)
FT                   /locus_tag="CLIBASIA_02805"
FT   CDS_pept        complement(593175..594446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02805"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57147"
FT                   /db_xref="GOA:C6XFJ4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ4"
FT                   /protein_id="ACT57147.1"
FT                   /translation="MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKA
FT                   IMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHS
FT                   HSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTN
FT                   VKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVS
FT                   IDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAM
FT                   IRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGT
FT                   TSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSV
FT                   DGAIASKLLAKFKEYIENPVWMLM"
FT   gene            complement(594446..595849)
FT                   /locus_tag="CLIBASIA_02800"
FT   CDS_pept        complement(594446..595849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02800"
FT                   /product="pyruvate dehydrogenase subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57146"
FT                   /db_xref="GOA:C6XFJ3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ3"
FT                   /protein_id="ACT57146.1"
FT                   /translation="MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAV
FT                   MEVESIDEGILGKILCPNGTKNVKVNTPIAAILQEGETALDIDKMLLEKPDVAISPSSK
FT                   NTTLVFSNEDNDKVDHQKSKNDIQDSSFAHAPTSSITVREALRDAIAEEMRRDKDVFIM
FT                   GEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNF
FT                   AMQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKV
FT                   VIPYTASDAKGLLKAAIRDPNPVIFLENEILYGSSFEVPMVDDLVIPIGRARIHRQGSD
FT                   VTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPMDWQTIFESVKKTGRLVTVEEG
FT                   YPQSSVGSTIANQVQRKVFDYLDAPILTITGRDVPMPYAANLEKLALPNVDEIIESVES
FT                   ICYKRKAKS"
FT   gene            complement(595867..596961)
FT                   /locus_tag="CLIBASIA_02795"
FT   CDS_pept        complement(595867..596961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02795"
FT                   /product="dehydrogenase, E1 component"
FT                   /note="COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57145"
FT                   /db_xref="GOA:C6XFJ2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ2"
FT                   /protein_id="ACT57145.2"
FT                   /translation="MYVAKQDVTVGDIKMALNPSVSAKRAATSSVDCVDIPFLEGFEVS
FT                   EFNKEQELSAYRLMLLIRRFEEKAGQLYGMGMVGGFCHLCIGQEAVIVGMKMSLTEGDQ
FT                   MITAYREHGHILACGVDASKIMAELTGRQGGISKGKGGSMHMFSTKNGFYGGHGIVGAQ
FT                   VSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQYAM
FT                   GTSVSRASAQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLT
FT                   YRYRGHSMSDPANYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKII
FT                   NNSVEFAQSDKEPDPAELYSDILI"
FT   gene            complement(597076..597393)
FT                   /locus_tag="CLIBASIA_02790"
FT   CDS_pept        complement(597076..597393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02790"
FT                   /product="putative cell division protein"
FT                   /note="COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57144"
FT                   /db_xref="GOA:C6XFJ1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ1"
FT                   /protein_id="ACT57144.1"
FT                   /translation="MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE
FT                   KSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD
FT                   F"
FT   gene            complement(597494..598768)
FT                   /gene="eno"
FT                   /locus_tag="CLIBASIA_02785"
FT   CDS_pept        complement(597494..598768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="CLIBASIA_02785"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COG0148 Enolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57143"
FT                   /db_xref="GOA:C6XFJ0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFJ0"
FT                   /protein_id="ACT57143.1"
FT                   /translation="MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIH
FT                   EAFELRDQEKRYFGKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRL
FT                   GANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEF
FT                   MIMPVGAENIREAIRMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIAN
FT                   SIEKAGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYS
FT                   IEDGMSEDDWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIG
FT                   SVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKY
FT                   NQLIRIEESLGKQAKFAGRSILIHQ"
FT   gene            complement(598831..599736)
FT                   /gene="kdsA"
FT                   /locus_tag="CLIBASIA_02780"
FT   CDS_pept        complement(598831..599736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="CLIBASIA_02780"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57142"
FT                   /db_xref="GOA:C6XFI9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI9"
FT                   /protein_id="ACT57142.1"
FT                   /translation="MHILYPQNLEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRF
FT                   VLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGR
FT                   EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINV
FT                   KKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF
FT                   DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINI
FT                   KDLPKLLSQLLAIDKIIKPL"
FT   gene            599999..600139
FT                   /locus_tag="CLIBASIA_02775"
FT   CDS_pept        599999..600139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57141"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI8"
FT                   /protein_id="ACT57141.1"
FT                   /translation="MYNLATGADLTEKFSKGKLNVAAVKCELKAEVTVTRAAIVEAKEL
FT                   H"
FT   gene            600729..600860
FT                   /locus_tag="CLIBASIA_02770"
FT   CDS_pept        600729..600860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57140"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI7"
FT                   /protein_id="ACT57140.1"
FT                   /translation="MMKGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ"
FT   gene            601032..602369
FT                   /locus_tag="CLIBASIA_02765"
FT   CDS_pept        601032..602369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02765"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="COG0144 tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57139"
FT                   /db_xref="GOA:C6XFI6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI6"
FT                   /protein_id="ACT57139.1"
FT                   /translation="MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRD
FT                   QILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVV
FT                   DLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKE
FT                   RVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV
FT                   WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRC
FT                   NLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS
FT                   ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK
FT                   SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK"
FT   gene            complement(602433..602600)
FT                   /locus_tag="CLIBASIA_02760"
FT   CDS_pept        complement(602433..602600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57138"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI5"
FT                   /protein_id="ACT57138.2"
FT                   /translation="MLLNILIVNDQIKTISLECEYGRPYNGLGKRLEKYNNQRTQQDGK
FT                   QIREKYVTQM"
FT   gene            603340..604950
FT                   /gene="purH"
FT                   /locus_tag="CLIBASIA_02755"
FT   CDS_pept        603340..604950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CLIBASIA_02755"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="COG0138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57137"
FT                   /db_xref="GOA:C6XFI4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI4"
FT                   /protein_id="ACT57137.1"
FT                   /translation="MDCFHRKDGDHGEIAVKTALISVHNKTGVVEFASRLLSRGIKIIS
FT                   TGGTCQLLEEEGIPVTSVFDITKFPEIMGGRVKTLHPKIYGGILSIRDNPAHMKFMQDH
FT                   ELESIDLVVVNLYPFEESFCREDDYYTMVENIDIGGPSMIRAAAKNHDYVTILTNPQDY
FT                   PLFLAEMDVNNGKIPYNFRKKMARQAFSRTASYDTAICRWLANAESENFPDYLNITAVK
FT                   KQEMRYGENPHQKAALYSTPEKKSGIAHAVLVQGKPLSYNNINDLDAAFELVSEFRSQD
FT                   CAACVIVKHMNPCGVATADTLVEAYRRALSCDPISAFGGIIAFNREVDQEVAKEVIKVF
FT                   TEAIIAPTLSEEAADVLAKKPSMRFLKTSSLLDFHGEEIVLKTVSGGILVQTRDNVVDN
FT                   KELTVVTKRSPTDQELRDMKFAFKVVKHVKSNAVVYAKDGRTVGIGSGQTSRVDSTRFA
FT                   AIKAHNISAQADVKSMTNGSVIASEAFYPFPDGIVEAIKAGVTAVIQPGGSVRDSEAIT
FT                   VADQHGIAMVFTGIRHFRH"
FT   gene            complement(604985..605608)
FT                   /locus_tag="CLIBASIA_02750"
FT   CDS_pept        complement(604985..605608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02750"
FT                   /product="carbonate dehydratase"
FT                   /note="COG0288 Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57136"
FT                   /db_xref="GOA:C6XFI3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI3"
FT                   /protein_id="ACT57136.1"
FT                   /translation="MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSR
FT                   VAPETIFNAKPGELFVVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGR
FT                   CGGIQAVLDSNNSSTSPGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNI
FT                   RNFPFVNKLEKEHMLQIHGAWFDISSGKLWILDPTSNEFTCDTR"
FT   gene            605893..610623
FT                   /locus_tag="CLIBASIA_02745"
FT   CDS_pept        605893..610623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02745"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="COG2902 NAD-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57135"
FT                   /db_xref="GOA:C6XFI2"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI2"
FT                   /protein_id="ACT57135.1"
FT                   /translation="MVISRDLKRSKIIGDVDIAIAILGLPSFSASAMFGEASIDDLEKY
FT                   TPQMLALTSVVSYDIFAGWDHSSACCIDIREVEGINPSGISISIITVIVDNIPFLYQSI
FT                   IGEIVARCRNLTMAVHPVFTKDKNCDWQLYSPESCGIAQKQISLIQIHCLKITPEEAIE
FT                   IKKQLIFIIEQLKLVSQDSREMLASLEKMQKSFCHLTGIKEYAVEALTFLNWLNEDNFQ
FT                   FMGMRYHPLVAGQKQVKLDHDMPTELGILRDSSIVVLGFDRVTPATRSFPEGNDFLIIT
FT                   KSNVISVIYRRTYMDHIGIKHFDERGNLIGELHVVGFFTRLVYSQRASKIPLLREKIVK
FT                   VQNLLNFHPNSHSSRMLQNTLEFYPRDELFQIDSTLLASFCEQIIDIMDRPRVRVLPRI
FT                   DRFNHFFSSLIYIPREYFDSFVREKIGNYLSEVCEGHVAFYSSILEEGLVRIHFVIVRS
FT                   GGEISHPSQESLEEGVRSIVACWEDKFYKSAGDGVPRFIFSQTFRDVFSPEKAVEDLPY
FT                   IISCAEGKEKLRVCFENKEDGKVQIKIFHARGPFSLSKRVPLLENLGFTVISEDTFEIK
FT                   MLADDEEHLVVLYQMDLSPATIARFDLVDRRDALVEAFKYIFHERVDNDSFNHLIMLTD
FT                   LRVYEISVLRSYARYLRQASVTWSQNFIARVLSKNPTISQLLFSLFRYRFDPSLSDQER
FT                   GENTKRILGEIDSALLKVPSLDDDTVLRSYVNLISGTLRTNYFQKNQDDIALVFKFDSR
FT                   KINSVGTDELHREIFVYGVEVEGVHLRCGKIARGGLRWSDRAADYRTEVLGLVRAQKVK
FT                   NAVIVPVGAKGGFYPKRLPSEGRRDEIIKIGREAYKTYVRALLSITDNFEGQEIIHPDN
FT                   TVCLDGNDPYFVVAADKGTATFSDTANILAQEAKFWLDDAFASGGSMGYDHKKMGITAR
FT                   GAWETVKRHFREMDIDIQSTPFTVAGVGDMSGDVFGNGMLLSRKIQLVAAFDHSDIFID
FT                   PDPNSETTFDERKRLFDSPSSSWQDFDRKVLSKGGMIISRKEKAVQLTPEAVAVIGISK
FT                   QIATPSEIISAILMASVDLLWFGGIGTYIRAPRENNADIGDKGNNILRVTADKVRAKVI
FT                   GEGANLGLTQQARVVYSLNGGRINSDAIDNSGGVNCSDLEVNIKIALASAMRDGRLTLE
FT                   NRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDREL
FT                   EHLPSVVSFEERIREEVSLSRPEIAILLAYAKLKLSEQLLDSTLIDDPFFFSILLSYFP
FT                   RQLSELYSEDIMNHQLRRAIVATVLANEIINKGGSCFVVSLAKETGSSTEDVIRSAVIA
FT                   YAGYELESLWQEVDKLDNQISGELQNKIYEEIRLIFINLTRLLIKNGKFIGDIGNAVKR
FT                   LVTAFHKLNSLLQEKIPVEWLERFNNWVTNLTNKGFPPDLADRIVRMQFLMVVPDLIDI
FT                   SETCDTSLLVVLDMWSAISVGLGVDRLLSVAHNVVVDDHYENLALSAGLDWMYSARREM
FT                   IVKAITTGSSVATIMQNEKWKEVKDQVFDILSVEKEVTVAHITVATHLLSGFLLKI"
FT   gene            610788..612203
FT                   /gene="sbcB"
FT                   /locus_tag="CLIBASIA_02740"
FT   CDS_pept        610788..612203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcB"
FT                   /locus_tag="CLIBASIA_02740"
FT                   /product="exonuclease I"
FT                   /EC_number="3.1.11.1"
FT                   /note="COG2925 Exonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57134"
FT                   /db_xref="GOA:C6XFI1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI1"
FT                   /protein_id="ACT57134.1"
FT                   /translation="MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFC
FT                   KPADDYLPDPEAVFITGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDY
FT                   YSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDL
FT                   ALANGIEHVNAHDAKADVYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTP
FT                   LVHVSGMFGASRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSH
FT                   DELKGLVPVPIKEVHLNKCPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDR
FT                   FKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPEL
FT                   FFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLIN
FT                   ALYEYLQWVIPKE"
FT   gene            612312..612399
FT                   /locus_tag="CLIBASIA_t05739"
FT   tRNA            612312..612399
FT                   /locus_tag="CLIBASIA_t05739"
FT                   /product="tRNA-Ser"
FT   gene            complement(612774..613508)
FT                   /locus_tag="CLIBASIA_02735"
FT   CDS_pept        complement(612774..613508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02735"
FT                   /product="hypothetical protein"
FT                   /note="COG0217 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57133"
FT                   /db_xref="GOA:C6XFI0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFI0"
FT                   /protein_id="ACT57133.1"
FT                   /translation="MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLE
FT                   NPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDN
FT                   RNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV
FT                   LFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIE
FT                   NLEDDDDVQSVYSNLEIADDII"
FT   gene            complement(613560..614384)
FT                   /locus_tag="CLIBASIA_02730"
FT   CDS_pept        complement(613560..614384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02730"
FT                   /product="hypothetical protein"
FT                   /note="COG1692 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57132"
FT                   /db_xref="GOA:C6XFH9"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH9"
FT                   /protein_id="ACT57132.1"
FT                   /translation="MRLLFLGDIVGKTGRSIVYEMLPRLIRDFQLDFVIANGENSAGGF
FT                   GITEKIFCEMMETGIDVITTGNHVWDKREALVFSQRHCKFLRPANYPPNTPGNGSGLYC
FT                   AKNGSNVLVANIMGRVFMNPLLDDPFRTADKILATCPLKEQADVIVFDFHAETTSEKQC
FT                   FAHFVDSRASLVVGTHTHIPTADAQILDGGTGYITDLGMCGDYNSSIGLDKEEPINRFI
FT                   TQIPRNRFVIANGPATLCGICAEISDVTGLAEKIAPIRIGPRLSETRPDFWT"
FT   gene            complement(614381..614722)
FT                   /locus_tag="CLIBASIA_02725"
FT   CDS_pept        complement(614381..614722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02725"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57131"
FT                   /db_xref="GOA:C6XFH8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH8"
FT                   /protein_id="ACT57131.1"
FT                   /translation="MIFRQYENPTDLVKSAVGTLSPPSYAKEMSPDLILMPLIAFDLKG
FT                   NRIGYGRGYYDRAIADIRLEGKNPYLLGIAFDMQETSCIQAEATDIRLHAILTESRFSQ
FT                   FSTEHIEKV"
FT   gene            complement(614791..614976)
FT                   /locus_tag="CLIBASIA_02720"
FT   CDS_pept        complement(614791..614976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57130"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH7"
FT                   /protein_id="ACT57130.1"
FT                   /translation="MTPREHKNLIRKKKMIARNLLSPAYRHMKSISLADLGAKKIPLEK
FT                   KKPKSQLFILCNRKSM"
FT   gene            complement(615050..615220)
FT                   /locus_tag="CLIBASIA_02715"
FT   CDS_pept        complement(615050..615220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57129"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH6"
FT                   /protein_id="ACT57129.2"
FT                   /translation="MLIQNNLTSCTGDKIKSTVDELNSISSRRQNIPPSSVISDLVVHP
FT                   HEKKEPKKHHE"
FT   gene            615511..617532
FT                   /gene="tkt"
FT                   /locus_tag="CLIBASIA_02710"
FT   CDS_pept        615511..617532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="CLIBASIA_02710"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021 Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57128"
FT                   /db_xref="GOA:C6XFH5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH5"
FT                   /protein_id="ACT57128.1"
FT                   /translation="MGHPVGGRNVVLMKYDDDYKKMADAIRFLSMDAIENVNSGHPGLP
FT                   MGMADVVTALFTQCMVFDPQCPYWPNRDRFVLSAGHGSMLYYALLYLLGYQDVTIEDIK
FT                   NFRTIGSKTAGHPEYGSCAGIEATTGPLGQGIANAVGMAIAERKLREEFGDVLIDHYTY
FT                   VLVGDGCLMEGISQEAISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFRASG
FT                   WNTLSVNGHDHHAITSTLRKAQLSDKPTMIACETVIGFGSPNRAGTNKVHGSALGQEEI
FT                   KATRKALNWDLDPFFIPDDIMKKWRLAGLRSSQTRADWQERLSSMKSSIRKEFERRFSD
FT                   ALPDCFDNAFINLKKKFEHSKPMIATRKSSELVLEVVNDCLPELIGGSADLTGSNGTKT
FT                   SQMKAISKSDFSGRYLHYGVREHAMAAAMNGIALHKGLAPYSGTFMVFSDYSRPAIRLA
FT                   SLMGIRVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPDLLVLRPADSIETLECWQVAL
FT                   KEKNRPSVLSLSRQNLPFLRTQYESNNLCALGAYDYISTPNAQVTIFSSGSELKIAVEA
FT                   CEILSSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIEAGLRQGWDAFIGSDG
FT                   SFIGMQGFGASGSCDLLYQHFGINAIAIVDMVERKLSV"
FT   gene            617585..618586
FT                   /locus_tag="CLIBASIA_02705"
FT   CDS_pept        617585..618586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02705"
FT                   /product="Glyceraldehyde 3-Phosphate Dehydrogenase"
FT                   /note="COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57127"
FT                   /db_xref="GOA:C6XFH4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH4"
FT                   /protein_id="ACT57127.1"
FT                   /translation="MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAH
FT                   LLRYDSVHGRFPGEVKIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQE
FT                   KASLHLSNGSQRVLVSAPCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVL
FT                   DKMFGIEKGYMTTVHSYTGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNL
FT                   KGKLDGSSIRVPTPNVSMVDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVS
FT                   VDFNHTSYSSIFAADQTKVVSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS"
FT   gene            618649..619851
FT                   /gene="pgk"
FT                   /locus_tag="CLIBASIA_02700"
FT   CDS_pept        618649..619851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="CLIBASIA_02700"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COG0126 3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57126"
FT                   /db_xref="GOA:C6XFH3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH3"
FT                   /protein_id="ACT57126.1"
FT                   /translation="MSRLRTMNDLRDIRGLRCLLRVDWNVPFIDGKVADVTRIERVVPT
FT                   ILELVEKKAKVVIFSHLGRPQSKSDKDCSLFKVVSIAESILHKNILFVNDCIGSTLSQS
FT                   IASLSEGGIILAENVRFYSEEERNDPDFVRMLSRNGDFYINDAFSVSHRAHASITGLSH
FT                   LLPSYIGRAMQKELSMLESCFSESKKPLVAIVGGSKVSTKITLLINLVKKVDKLVIGGG
FT                   MANSFLVAQGMGVGRSLCQRDFSDNVHQIAWEAKRSACEIIVPRDVVVAREMKTGIPTQ
FT                   VVSAQSVPLDSIILDVGFKTVEYIKQVIAQARTVMWNGPLGVFEIEPFDRATVEVAHYV
FT                   AKLTKERRIISIAGGGDTITALAHAGISNEFTYVSTAGGAFLEWLEGKDLPGIVALSGH
FT                   C"
FT   gene            619963..620982
FT                   /locus_tag="CLIBASIA_02695"
FT   CDS_pept        619963..620982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02695"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /note="COG3588 Fructose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57125"
FT                   /db_xref="GOA:C6XFH2"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH2"
FT                   /protein_id="ACT57125.1"
FT                   /translation="MMQDLENSVAMMLQAGKGILAADESNATIQKRFKAIHLESTENSR
FT                   RDYREMLFRAKDAMQYISSILLYEETLYQNAQDGTSFVDLISSSGVLVGIKVDRGLKPY
FT                   PLYPGEHITVGLDDLDVRLKQYKDAGARVAKWRVVLSVSDVLPSMTVVKANMHILARYA
FT                   VLCQNAGLVPIVEPEVLMEGDHTIERCAEVTEFVLRTLFNELYTMRVCFEGLVLKSNMI
FT                   LPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGIAFLSGGQSEQDATARLSAMNSMGDCP
FT                   WRLSFSYGRALQESVLRAWNGKQDNVVVAQRVLSHRAHMNSLATKGCWKKSLENSNGR"
FT   gene            620972..621064
FT                   /locus_tag="CLIBASIA_02690"
FT   CDS_pept        620972..621064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57124"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH1"
FT                   /protein_id="ACT57124.1"
FT                   /translation="MADSFGKRIKGYLKIMESGLVLRNGSFYRF"
FT   gene            621139..621651
FT                   /locus_tag="CLIBASIA_02685"
FT   CDS_pept        621139..621651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57123"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFH0"
FT                   /protein_id="ACT57123.1"
FT                   /translation="MSNRVSGSISCLNRRLFSMRLKVLYKESIALVEETSCYFDREGHL
FT                   LSKTLPRAISKLYTSESVLLTTRLMQMVSWLFLQRALEDGNMTLEQVMSEKEKIKFDYS
FT                   GLDSTVPGWTELPCFFKNLVERSSQLQRRIVLLDQEIYRADFDEISRGPNHVQTQIKLL
FT                   EACFENF"
FT   gene            622242..622318
FT                   /locus_tag="CLIBASIA_t05737"
FT   tRNA            622242..622318
FT                   /locus_tag="CLIBASIA_t05737"
FT                   /product="tRNA-Arg"
FT   gene            complement(622804..623454)
FT                   /gene="nadD"
FT                   /locus_tag="CLIBASIA_02680"
FT   CDS_pept        complement(622804..623454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="CLIBASIA_02680"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57122"
FT                   /db_xref="GOA:C6XFG9"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG9"
FT                   /protein_id="ACT57122.1"
FT                   /translation="MQQSQSLQDIMRMPKVEPGMKIGLFGGNFNPPHHGHIEIAQIAIK
FT                   KLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQSLIKNPRIRITAFEAYLNHTETFHT
FT                   ILQVKKHNKSVNFVWIMGADNIKSFHQWHHWKRIVTTVPIAIIDRFDVTFNYISSPMAK
FT                   TFEYARLDESLSHILCTTSPPSWLFIHDRHHIISSTAIRKKIIEQDNTRTLGI"
FT   gene            complement(623661..624668)
FT                   /gene="obgE"
FT                   /locus_tag="CLIBASIA_02675"
FT   CDS_pept        complement(623661..624668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="CLIBASIA_02675"
FT                   /product="GTPase ObgE"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57121"
FT                   /db_xref="GOA:C6XFG8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG8"
FT                   /protein_id="ACT57121.1"
FT                   /translation="MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDV
FT                   WIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISL
FT                   ICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIG
FT                   IIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQ
FT                   GAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQI
FT                   DTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF"
FT   gene            complement(624887..625159)
FT                   /gene="rpmA"
FT                   /locus_tag="CLIBASIA_02670"
FT   CDS_pept        complement(624887..625159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="CLIBASIA_02670"
FT                   /product="50S ribosomal protein L27"
FT                   /note="COG0211 Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57120"
FT                   /db_xref="GOA:C6XFG7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG7"
FT                   /protein_id="ACT57120.1"
FT                   /translation="MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRY
FT                   HPGLNVGLGKDHTIYALVDGHVRFFKKFSKGRAYVSVIPKIEDTQ"
FT   gene            complement(625207..625518)
FT                   /gene="rplU"
FT                   /locus_tag="CLIBASIA_02665"
FT   CDS_pept        complement(625207..625518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="CLIBASIA_02665"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57119"
FT                   /db_xref="GOA:C6XFG6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG6"
FT                   /protein_id="ACT57119.1"
FT                   /translation="MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDE
FT                   HLSVGTPRVEGAYVEAEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSIVT"
FT   gene            625743..625830
FT                   /locus_tag="CLIBASIA_t05735"
FT   tRNA            625743..625830
FT                   /locus_tag="CLIBASIA_t05735"
FT                   /product="tRNA-Ser"
FT   gene            complement(626219..626494)
FT                   /locus_tag="CLIBASIA_02660"
FT   CDS_pept        complement(626219..626494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57118"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG5"
FT                   /protein_id="ACT57118.1"
FT                   /translation="MHYDFTPPSKKSKGAQVKENLGLQKDLNHIRQIINEGDFKSAAVK
FT                   MRILVESFLRKLSEKESISIPGSIKARKNCWNLSTSTGAYLRIRGA"
FT   gene            complement(626580..627449)
FT                   /locus_tag="CLIBASIA_02655"
FT   CDS_pept        complement(626580..627449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57117"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG4"
FT                   /protein_id="ACT57117.1"
FT                   /translation="MIRKNEKLKEACDVATDSIRSFFMQAKPYILPALSKEEQKSLKYF
FT                   FLPENTLCQKFFNAFDRHATAGIEIKKTMNATLQFLQKVPTADPQAVEYEKPYSTVIAN
FT                   LTDSHQKYATNIATYMPIGEEFAHSLSARIASSENAQVIEALYDIVKNRNDIMLLTKYG
FT                   ESLQILRRLTQETEKHINNLQDKILQDRAKEIKHWYDTLIPHPDDSSPNSGVSFDIMEP
FT                   GHEKTNIYALSYGEQMSAPANLSECQLNCLGLAVWGSCAPLLNNHHLALSFSIIQFNRW
FT                   MITTLKVL"
FT   gene            complement(627531..627713)
FT                   /locus_tag="CLIBASIA_02650"
FT   CDS_pept        complement(627531..627713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57116"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG3"
FT                   /protein_id="ACT57116.2"
FT                   /translation="MFDSSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQRE
FT                   ALNAEILKFWKRVCN"
FT   gene            complement(627706..627906)
FT                   /locus_tag="CLIBASIA_02645"
FT   CDS_pept        complement(627706..627906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57115"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG2"
FT                   /protein_id="ACT57115.1"
FT                   /translation="MVLDNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTK
FT                   MELTELEKSLSIVLHEKKENF"
FT   gene            complement(627893..628258)
FT                   /locus_tag="CLIBASIA_02640"
FT   CDS_pept        complement(627893..628258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02640"
FT                   /product="hypothetical protein"
FT                   /note="COG1196 Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57114"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG1"
FT                   /protein_id="ACT57114.1"
FT                   /translation="MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIG
FT                   AQSLEFFYPVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKP
FT                   NMVSAAMDPLKKCVGTR"
FT   gene            complement(628237..628569)
FT                   /locus_tag="CLIBASIA_02635"
FT   CDS_pept        complement(628237..628569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02635"
FT                   /product="hypothetical protein"
FT                   /note="COG1196 Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57113"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFG0"
FT                   /protein_id="ACT57113.1"
FT                   /translation="MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQK
FT                   IEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPR
FT                   CKYQLK"
FT   gene            629161..629280
FT                   /locus_tag="CLIBASIA_02630"
FT   CDS_pept        629161..629280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57112"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF9"
FT                   /protein_id="ACT57112.1"
FT                   /translation="MGEGYGISVVMMEKTAIQDWIETFELGKEHGRKLEKTCC"
FT   gene            complement(629789..630943)
FT                   /gene="dnaJ"
FT                   /locus_tag="CLIBASIA_02625"
FT   CDS_pept        complement(629789..630943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="CLIBASIA_02625"
FT                   /product="molecular chaperone protein DnaJ"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57111"
FT                   /db_xref="GOA:C6XFF8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF8"
FT                   /protein_id="ACT57111.1"
FT                   /translation="MKKADFYQVLGIDRNATDRQLKTAFRSLAMKYHPDQNRNDPEAKE
FT                   KFAQISEAYEVLRDPQKRALYDQGGHEALEYGAQSQGAGGFGAGMYGNSDFSELFEGIF
FT                   GGIMGSGRSYKRSSSTGEAGADLRYNLEISLEEAFSGKTVQIRFPTAVKCSTCSGSGAK
FT                   PGTNPMDCNICNGSGRVYTTAQSFFSIERACSTCRGSGQIIPHPCSKCHGQGRVSEEKL
FT                   LSVNVPPGVDDGTRIRLSGEGGAGVYGGAPGDLYIFISVKKHQFFKRDGADLYCTVPIS
FT                   IVTVAMGGTFDVATLDATHSRVTIPEGTQTGKQFRLKGKGMPVINSGRKGDLYVQVQVE
FT                   TPQKLNKRQRELLEEFEQISSQDNNPQSTGFFARMKDFFDSLKN"
FT   gene            complement(631010..632968)
FT                   /gene="dnaK"
FT                   /locus_tag="CLIBASIA_02620"
FT   CDS_pept        complement(631010..632968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="CLIBASIA_02620"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57110"
FT                   /db_xref="GOA:C6XFF7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF7"
FT                   /protein_id="ACT57110.2"
FT                   /translation="MSKVIGIDLGTTNSCVAIMDGKNVRVIENAEGTRTTPSMVGFTDE
FT                   GERLVGQPAKRQAVTNPSNTIFAAKRLIGRRFNDSTVAKDASLVPFKIVEGKGGDAWIE
FT                   AQGKQYSPSQISAIVLQKMKETAESFLGETVSKAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVFEVKATNGDTFL
FT                   GGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLPFI
FT                   SANSAGAQHLNMKLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGMTR
FT                   MPKIQQSVQDFFNKSPSKGVNPDEVVAMGAAIQAGVLQGDVKDLLLLDVTPLSLGIETL
FT                   GGVFTSIIDRNSTIPTKKSQVFSTAADNQSAVSIRIGQGERKMFADNKLLGQFDLVGIP
FT                   PAPKGTPQIEVAFDIDANGIVQVSALDKGTGKAQQISIQASGGLSSEDIEKMVKDAEMN
FT                   AEMDKKRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDADP
FT                   DESKIKEATQKLMEVSMNLGKAIYEAQAKKDAAADTATADTTAKTDVKDDVVDADYEEI
FT                   KDDEKDKKKLSIFLSRT"
FT   gene            633342..633965
FT                   /locus_tag="CLIBASIA_02615"
FT   CDS_pept        633342..633965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02615"
FT                   /product="ribonuclease D"
FT                   /note="COG0349 Ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57109"
FT                   /db_xref="GOA:C6XFF6"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF6"
FT                   /protein_id="ACT57109.1"
FT                   /translation="MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLS
FT                   PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTK
FT                   IASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL
FT                   RLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVDIFSHS"
FT   gene            complement(634080..634154)
FT                   /locus_tag="CLIBASIA_t05733"
FT   tRNA            complement(634080..634154)
FT                   /locus_tag="CLIBASIA_t05733"
FT                   /product="tRNA-Gly"
FT   gene            complement(634351..635589)
FT                   /locus_tag="CLIBASIA_02610"
FT   CDS_pept        complement(634351..635589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02610"
FT                   /product="hypothetical protein"
FT                   /note="COG3487 Uncharacterized iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57108"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF5"
FT                   /protein_id="ACT57108.1"
FT                   /translation="MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDAL
FT                   MCARTLDSAIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAW
FT                   PLDEGFIDYVDSSYGKENEENNLYTANIIANSKIIVNEKEIDLSIISPDLLRKLHRANG
FT                   IDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEYLKVVSKI
FT                   LVSDLEEMMKAWGPDGQATKDLMKDINAGLNSIITGMTSLSYNELAGERMNLGLILHDP
FT                   EQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIHGASIHDLISHNNRNLAQEIN
FT                   DKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLINDLITQTESLRKIRIAL
FT                   DLIEPNRVIGNVP"
FT   gene            complement(635846..637135)
FT                   /locus_tag="CLIBASIA_02605"
FT   CDS_pept        complement(635846..637135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02605"
FT                   /product="NOL1/NOP2/SUN family signature protein"
FT                   /note="COG0144 tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57107"
FT                   /db_xref="GOA:C6XFF4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF4"
FT                   /protein_id="ACT57107.1"
FT                   /translation="MRLGGQIAAAIEILKDIRTHKKPITNSLKDWGMSHRFAGSSDRAS
FT                   ISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMKDWDIPWEKMLSMLKEDLFSPPLPKE
FT                   SVIKSFHSRQLENAPLHIQGNIPQWLQSSFQSYFKDTWLKEAKSLSMRAPLDLRTNTLK
FT                   VNRCKLFKNLCHYGVHHSSISRFGLRIPATKGKSRLPNVMNDITFQRGWFEIQDEGSQI
FT                   VSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKSRMAPIVARIKRAGI
FT                   HNVQLHSSWESLRNLQEHFTTVLVDAPCSGTGTWRRRPDIKWRLSQKNLIERTEEQKKI
FT                   LEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNPHFSIDSIIDDWNQLYDLKNHP
FT                   SLFIENGCCVLTPFLTNTDGFFFCRLKRHT"
FT   gene            637325..638128
FT                   /locus_tag="CLIBASIA_02600"
FT   CDS_pept        637325..638128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02600"
FT                   /product="creatinine amidohydrolase"
FT                   /note="COG1402 Uncharacterized protein, putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57106"
FT                   /db_xref="GOA:C6XFF3"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF3"
FT                   /protein_id="ACT57106.1"
FT                   /translation="MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTI
FT                   IAAGLAERIKSILPPRLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIR
FT                   KMGIRKIVILNAHGGNSPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGI
FT                   HGGEIETSMMLALAPHLVKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKG
FT                   VVGNAMDATVKKGEGLLSYFANCFIQLLNDINSFDVSIFDKDVQK"
FT   gene            complement(638344..638559)
FT                   /locus_tag="CLIBASIA_02595"
FT   CDS_pept        complement(638344..638559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57105"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF2"
FT                   /protein_id="ACT57105.1"
FT                   /translation="MINGPETLESLMVSFRVDMSPAVQLQCGLGSSIVAVKPVVPYITD
FT                   VARGQINVRLGDNYGVLHSVDLVTMT"
FT   gene            complement(639158..639346)
FT                   /locus_tag="CLIBASIA_02590"
FT   CDS_pept        complement(639158..639346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57104"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF1"
FT                   /protein_id="ACT57104.1"
FT                   /translation="MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQGRSSRNPCQ
FT                   GGDIKAPETVVEIKTDL"
FT   gene            640500..641228
FT                   /gene="rph"
FT                   /locus_tag="CLIBASIA_02585"
FT   CDS_pept        640500..641228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="CLIBASIA_02585"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COG0689 RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57103"
FT                   /db_xref="GOA:C6XFF0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFF0"
FT                   /protein_id="ACT57103.1"
FT                   /translation="MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEE
FT                   KVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDL
FT                   SALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAA
FT                   ISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNL
FT                   AKDRIADLIKLQKDVISNEV"
FT   gene            641234..641908
FT                   /locus_tag="CLIBASIA_02580"
FT   CDS_pept        641234..641908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02580"
FT                   /product="putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /note="COG0127 Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57102"
FT                   /db_xref="GOA:C6XFE9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE9"
FT                   /protein_id="ACT57102.1"
FT                   /translation="MRKLIENNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPE
FT                   ETGNSFEENAMIKSLTAAKNAGMPALSDDSGLVIDVLDGKPGIHSARWAESNTGERDFD
FT                   MAMQKIENALRSKFAHDPAFRSAHFISVLSLAWPDGHVENFSGKVSGIIVWPPRGQLGF
FT                   GYDPIFQPNGYDRTFGEMTEEEKNGGIDSATLFSILSTDLLSHRARAFKCFVDNCLRID
FT                   EK"
FT   gene            641905..643092
FT                   /locus_tag="CLIBASIA_02575"
FT   CDS_pept        641905..643092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02575"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="COG0635 Coproporphyrinogen III oxidase and related
FT                   Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57101"
FT                   /db_xref="GOA:C6XFE8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE8"
FT                   /protein_id="ACT57101.1"
FT                   /translation="MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYK
FT                   VGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSS
FT                   NVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHL
FT                   ARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDG
FT                   DLVLPSENVAVDLYNLTQSITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPG
FT                   AHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREG
FT                   ISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV"
FT   gene            complement(643376..644884)
FT                   /gene="dnaA"
FT                   /locus_tag="CLIBASIA_02570"
FT   CDS_pept        complement(643376..644884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CLIBASIA_02570"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57100"
FT                   /db_xref="GOA:C6XFE7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE7"
FT                   /protein_id="ACT57100.1"
FT                   /translation="MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSR
FT                   LKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRI
FT                   QGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFV
FT                   FSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIK
FT                   RQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFC
FT                   HLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRL
FT                   AISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSH
FT                   LVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFP
FT                   EIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE"
FT   gene            complement(645443..645715)
FT                   /gene="rpsT"
FT                   /locus_tag="CLIBASIA_02565"
FT   CDS_pept        complement(645443..645715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="CLIBASIA_02565"
FT                   /product="30S ribosomal protein S20"
FT                   /note="COG0268 Ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57099"
FT                   /db_xref="GOA:C6XFE6"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE6"
FT                   /protein_id="ACT57099.1"
FT                   /translation="MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIE
FT                   EATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA"
FT   gene            complement(645888..646757)
FT                   /gene="fpg"
FT                   /locus_tag="CLIBASIA_02560"
FT   CDS_pept        complement(645888..646757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="CLIBASIA_02560"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="COG0266 Formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57098"
FT                   /db_xref="GOA:C6XFE5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE5"
FT                   /protein_id="ACT57098.1"
FT                   /translation="MPELPEVEIIRRNLMMVMKNMTVTDICLHRKNLRFDFPHHFSAAT
FT                   RGKKIIDVSRRAKYLLIELEGNLSIIVHLGMSGSFIIEHTSCAKPIKNPQHNHVTISLT
FT                   NNTNTKKYRVIYNDPRRFGFMDLVETSLKYQYPPLRTLGPEPADNSFNAIYLTHQFHKK
FT                   NSNLKNALLNQKIVAGIGNIYVCEALWRAKLSPIRKTRSLIQNNGTPKDILYKLIQEIQ
FT                   KVLIDAIDAGGSSLRDYVHIDGSIGYFQNAFSVYGKTGEPCLSNCGQMIRRIVQAGRST
FT                   FYCTYCQK"
FT   gene            647012..647809
FT                   /gene="ubiE"
FT                   /locus_tag="CLIBASIA_02555"
FT   CDS_pept        647012..647809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CLIBASIA_02555"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57097"
FT                   /db_xref="GOA:C6XFE4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE4"
FT                   /protein_id="ACT57097.1"
FT                   /translation="MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMN
FT                   DLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADIN
FT                   NEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEI
FT                   YRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRF
FT                   PNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCENIGSVV"
FT   gene            647806..649359
FT                   /gene="ubiB"
FT                   /locus_tag="CLIBASIA_02550"
FT   CDS_pept        647806..649359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="CLIBASIA_02550"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="COG0661 Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57096"
FT                   /db_xref="GOA:C6XFE3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE3"
FT                   /protein_id="ACT57096.1"
FT                   /translation="MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVFGKKIASLFVRR
FT                   NIKKCQRSDRLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTA
FT                   RLSVASALKAPIEELYCEFDDPIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFF
FT                   RDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKD
FT                   QGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRD
FT                   GFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHF
FT                   EAGYVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVM
FT                   LQKTMVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQA
FT                   APQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISIMR
FT                   "
FT   gene            649367..650584
FT                   /gene="dfp"
FT                   /locus_tag="CLIBASIA_02545"
FT   CDS_pept        649367..650584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="CLIBASIA_02545"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase"
FT                   /EC_number="6.3.2.5"
FT                   /note="COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57095"
FT                   /db_xref="GOA:C6XFE2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE2"
FT                   /protein_id="ACT57095.1"
FT                   /translation="MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQK
FT                   FITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVY
FT                   DLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGY
FT                   GVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGH
FT                   AIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVS
FT                   DWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNA
FT                   REKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIV
FT                   EHLGMK"
FT   gene            650820..651293
FT                   /locus_tag="CLIBASIA_02540"
FT   CDS_pept        650820..651293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02540"
FT                   /product="small heat shock protein"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57094"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE1"
FT                   /protein_id="ACT57094.1"
FT                   /translation="MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGEN
FT                   AYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLAD
FT                   FVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA"
FT   gene            651465..651899
FT                   /gene="rirA"
FT                   /locus_tag="CLIBASIA_02535"
FT   CDS_pept        651465..651899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rirA"
FT                   /locus_tag="CLIBASIA_02535"
FT                   /product="iron-responsive transcriptional regulator"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57093"
FT                   /db_xref="GOA:C6XFE0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFE0"
FT                   /protein_id="ACT57093.1"
FT                   /translation="MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKIL
FT                   QPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGS
FT                   CGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG"
FT   gene            653006..655201
FT                   /gene="priA"
FT                   /locus_tag="CLIBASIA_02530"
FT   CDS_pept        653006..655201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="CLIBASIA_02530"
FT                   /product="primosome assembly protein PriA"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57092"
FT                   /db_xref="GOA:C6XFD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD9"
FT                   /protein_id="ACT57092.1"
FT                   /translation="MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVR
FT                   VPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMG
FT                   LVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVS
FT                   SHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSL
FT                   ISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSL
FT                   STSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARD
FT                   MSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQT
FT                   IAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEH
FT                   RSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSD
FT                   LEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSE
FT                   RTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP
FT                   PFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIH
FT                   GKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL"
FT   gene            655679..656239
FT                   /gene="atpH"
FT                   /locus_tag="CLIBASIA_02525"
FT   CDS_pept        655679..656239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="CLIBASIA_02525"
FT                   /product="F0F1 ATP synthase subunit delta"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0712 F0F1-type ATP synthase, delta subunit
FT                   (mitochondrial oligomycin sensitivity protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57091"
FT                   /db_xref="GOA:C6XFD8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD8"
FT                   /protein_id="ACT57091.1"
FT                   /translation="MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLME
FT                   SADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFR
FT                   AVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIG
FT                   AHQIDASLRTQLLKLGCILKEVD"
FT   gene            656239..657768
FT                   /gene="atpA"
FT                   /locus_tag="CLIBASIA_02520"
FT   CDS_pept        656239..657768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CLIBASIA_02520"
FT                   /product="F0F1 ATP synthase subunit alpha"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0056 F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57090"
FT                   /db_xref="GOA:C6XFD7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD7"
FT                   /protein_id="ACT57090.1"
FT                   /translation="MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLN
FT                   NIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELL
FT                   GRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQ
FT                   RELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALED
FT                   RGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQL
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPT
FT                   NVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYRE
FT                   MSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAV
FT                   SQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN"
FT   gene            657790..658674
FT                   /gene="atpG"
FT                   /locus_tag="CLIBASIA_02515"
FT   CDS_pept        657790..658674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="CLIBASIA_02515"
FT                   /product="F0F1 ATP synthase subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0224 F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57089"
FT                   /db_xref="GOA:C6XFD6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD6"
FT                   /protein_id="ACT57089.1"
FT                   /translation="MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSY
FT                   QFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARD
FT                   RIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITS
FT                   LFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSV
FT                   LDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRIT
FT                   TELIEIIAGAEVV"
FT   gene            658712..660148
FT                   /gene="atpD"
FT                   /locus_tag="CLIBASIA_02510"
FT   CDS_pept        658712..660148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CLIBASIA_02510"
FT                   /product="F0F1 ATP synthase subunit beta"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0055 F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57088"
FT                   /db_xref="GOA:C6XFD5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD5"
FT                   /protein_id="ACT57088.1"
FT                   /translation="MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRI
FT                   VFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDD
FT                   QGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKT
FT                   VLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCS
FT                   LLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIP
FT                   SAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVL
FT                   SRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMD
FT                   ELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLP
FT                   ELAFYMVGSIDEAVKKAEVI"
FT   gene            660178..660585
FT                   /gene="atpC"
FT                   /locus_tag="CLIBASIA_02505"
FT   CDS_pept        660178..660585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CLIBASIA_02505"
FT                   /product="F0F1 ATP synthase subunit epsilon"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0355 F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57087"
FT                   /db_xref="GOA:C6XFD4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD4"
FT                   /protein_id="ACT57087.1"
FT                   /translation="MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVL
FT                   TTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEV
FT                   CSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ"
FT   gene            complement(661017..661103)
FT                   /locus_tag="CLIBASIA_t05731"
FT   tRNA            complement(661017..661103)
FT                   /locus_tag="CLIBASIA_t05731"
FT                   /product="tRNA-Leu"
FT   gene            661457..662755
FT                   /locus_tag="CLIBASIA_02500"
FT   CDS_pept        661457..662755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02500"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG0104 Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57086"
FT                   /db_xref="GOA:C6XFD3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD3"
FT                   /protein_id="ACT57086.1"
FT                   /translation="MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKV
FT                   NDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNA
FT                   SLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKK
FT                   IEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILF
FT                   EGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFP
FT                   TELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGL
FT                   DELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNY
FT                   IRKIEEVLEVPVALLSIGPERENTLIMSNPFED"
FT   gene            662814..664325
FT                   /locus_tag="CLIBASIA_02495"
FT   CDS_pept        662814..664325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02495"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57085"
FT                   /db_xref="GOA:C6XFD2"
FT                   /db_xref="InterPro:IPR037337"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD2"
FT                   /protein_id="ACT57085.1"
FT                   /translation="MVDFILVIQRAVDNLPENTPERRSHIYEHARNSVARRLESMKPRL
FT                   PKEILERQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFLEPRLRSIS
FT                   SILRSNKHKKLANILSVQGKSRTNTNLSPKNFSCRLREILSFSVNTQHEYDSSVSPVAA
FT                   IEHDKSRLRRGKLAGIFSFPTGSIFWSVHNYFFNKTRGLLSFYSALSEHHLFKYFVFLI
FT                   ILLGMAIGVSYSIGKSKGSITHFLRRESLDGGNVDKKNVFSGIRPKITRRLLEDGSEVD
FT                   VGPSTIPVADFANTSNIAFKNYIGGDENSTFVLGKKEIEEGNPLIGEGRVFINKGRGQS
FT                   SILSGKILWSLQQEKSQGLKGLVIKGDIPMIDNAFSASMTLKCNADISLSITHVMEIMF
FT                   SFPKESQDAVVDLRRISMRKTDNSPSVLIDSNIFVISKNSYLISLKGSEEDPFRNSKIL
FT                   EEYRFIDIPITYRSGQKILFTIDKGKKGADIFKSAIMQWENRSNN"
FT   gene            complement(664409..665317)
FT                   /gene="rpoH"
FT                   /locus_tag="CLIBASIA_02490"
FT   CDS_pept        complement(664409..665317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="CLIBASIA_02490"
FT                   /product="RNA polymerase factor sigma-32"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57084"
FT                   /db_xref="GOA:C6XFD1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD1"
FT                   /protein_id="ACT57084.1"
FT                   /translation="MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHG
FT                   DLSAAHRLVTSHLRLVVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATY
FT                   SMWWIKAAMQEYILRSWSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIA
FT                   KKLNVSESEVISMNCRLAGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERK
FT                   NRRNMLTRSMSVLNPRERRIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQ
FT                   ESIQKQVELSSSPPLLQKPRY"
FT   gene            complement(665465..666487)
FT                   /gene="rluD"
FT                   /locus_tag="CLIBASIA_02485"
FT   CDS_pept        complement(665465..666487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="CLIBASIA_02485"
FT                   /product="RNA-pseudouridylate synthase protein, ribosomal
FT                   large subunit D"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57083"
FT                   /db_xref="GOA:C6XFD0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFD0"
FT                   /protein_id="ACT57083.1"
FT                   /translation="MQQTLDNCSSIKISLLSDSTAEGRIDRWLATSLKEQFSRSYVKIL
FT                   ILNGFISINGMVSKNPNRKVVPGDSFLITVPAAQKLNIAQENIPLDILYEDDDIIVINK
FT                   PAGLVVHPAPGNWTGTLVNALLYHCHNNLSSINGVKRPGIVHRLDKDTTGVMVVAKNDL
FT                   AHQKLSEQFVDHGKSTRLKRAYYAMVWGIPLPDSGIINAPLGRCKSNRLRRAVKGIDDK
FT                   TADSAITHYQTIEIYNKNSNFAVSLLKCHLETGRTHQIRVHMAHKGNPLIGDPLYGKGF
FT                   KTKANIVNNNAKSAILSLARQALHAHSLSFSHPRNNQDMDFQVPIPEDMLTVIRKLNEK
FT                   "
FT   gene            complement(666731..667660)
FT                   /locus_tag="CLIBASIA_02480"
FT   CDS_pept        complement(666731..667660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02480"
FT                   /product="putative phosphoesterase protein"
FT                   /note="COG1409 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57082"
FT                   /db_xref="GOA:C6XFC9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC9"
FT                   /protein_id="ACT57082.2"
FT                   /translation="MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRK
FT                   KYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG
FT                   NHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA
FT                   NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG
FT                   ADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL
FT                   EGKRYTLSPDSLSIQKDYSDIFYDTLVL"
FT   gene            667861..668901
FT                   /gene="rluC"
FT                   /locus_tag="CLIBASIA_02475"
FT   CDS_pept        667861..668901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="CLIBASIA_02475"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57081"
FT                   /db_xref="GOA:C6XFC8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC8"
FT                   /protein_id="ACT57081.1"
FT                   /translation="MSLMTYVQYVVVENDEENMRLDRWFKNHYPHINFVNLQKILRSGQ
FT                   VRVDKKRVKFNNRIQSGQVVRIPPVINALNHIIKEQKILDSSVNLTKHSDFLKSILLYE
FT                   DSKIYVFNKPAGISVQGGSGIAYHIDGFLKSWVDSKGQKPRLTHRLDQETSGILVVART
FT                   RAAAQHLTESFRMRRIQKIYWSLVWGIPKNKKECIANWLLKKSHIGGDYVHVVKQNEKG
FT                   ANYAISHFKVIDCFAQKFCWLEMQPHTGRTHQLRVHALHMGCPIVGDHKYCANFKGNFT
FT                   SPIQNKLYLHARYMDLPHPEGGRLQITAPLPAHMVKTWDSLGFKYDRNLYIKRLYSQDE
FT                   CKQNIL"
FT   gene            complement(669428..669823)
FT                   /locus_tag="CLIBASIA_02470"
FT   CDS_pept        complement(669428..669823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02470"
FT                   /product="hypothetical protein"
FT                   /note="COG3755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57080"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC7"
FT                   /protein_id="ACT57080.1"
FT                   /translation="MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKE
FT                   KLEATYKKVLEKVEKHQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQG
FT                   HAIERNEKLESYLTCPEGDLLCPFINN"
FT   gene            complement(670382..672616)
FT                   /gene="ftsK"
FT                   /locus_tag="CLIBASIA_02465"
FT   CDS_pept        complement(670382..672616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="CLIBASIA_02465"
FT                   /product="cell division protein"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57079"
FT                   /db_xref="GOA:C6XFC6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC6"
FT                   /protein_id="ACT57079.1"
FT                   /translation="MKCSKKNNLHWLETPHKQVDLKSFVPPWHEAFLLAPNVRFTRTPE
FT                   NDLNRYRNNSTLQQPKETEHSIGDYLHTKAVTESLKSTSSLVYLKNRFMMNRNSVADQF
FT                   NSQKTPHKLHLVQKNGSHPDPNMQKETIEPSLDVIEEVNTDTASNVSDQINQNPDTLSW
FT                   LSDFAFFEGLSTPHSFLSFNDHHQYTPIPIQSAEDLSDHTDLAPHMSTEYLHNKKIRTD
FT                   STPTTAGDQQKKSSIDHKPSSSNTMTEHMFQDTSQEIAKGQKQYEQPCSSFLQVQSNVN
FT                   LQGITHEILEKNAGSLETILEEFGIKGEIINVNPGPVVTLYEFEPAPGIKSSRVIGLAD
FT                   DIARSMSSLSARVAVIPKRNAIGIELPNETRETVYLRQIIESRSFSHSKANLALCLGKT
FT                   ISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS
FT                   VYDGIPHLLTPVVTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEK
FT                   PQGCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV
FT                   DVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLYMSGGGRIQRVHGPL
FT                   VSDIEIEKVVQHLKKQGCPEYLNTVTTDTDTDKDGNNFDSEEKKERSNLYAKAVDLVID
FT                   NQRCSTSFIQRRLQIGYNRAALLVERMEQEGLVSEADHVGKRHVFSEKFS"
FT   gene            673130..674959
FT                   /locus_tag="CLIBASIA_02460"
FT   CDS_pept        673130..674959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02460"
FT                   /product="putative aminopeptidase"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57078"
FT                   /db_xref="GOA:C6XFC5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC5"
FT                   /protein_id="ACT57078.1"
FT                   /translation="MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEF
FT                   VDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPL
FT                   HAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRL
FT                   YRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPY
FT                   PLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILID
FT                   PKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWF
FT                   YSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSN
FT                   RLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQR
FT                   TRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNE
FT                   PGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKK
FT                   WCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI"
FT   gene            complement(675046..676251)
FT                   /gene="hemA"
FT                   /locus_tag="CLIBASIA_02455"
FT   CDS_pept        complement(675046..676251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="CLIBASIA_02455"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57077"
FT                   /db_xref="GOA:C6XFC4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC4"
FT                   /protein_id="ACT57077.1"
FT                   /translation="MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSR
FT                   KVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHG
FT                   KKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDL
FT                   EDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHG
FT                   SCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPP
FT                   AIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKC
FT                   TQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNR
FT                   YA"
FT   gene            complement(676440..677288)
FT                   /locus_tag="CLIBASIA_02450"
FT   CDS_pept        complement(676440..677288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02450"
FT                   /product="tRNA/rRNA methyltransferase protein"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57076"
FT                   /db_xref="GOA:C6XFC3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC3"
FT                   /protein_id="ACT57076.1"
FT                   /translation="MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ
FT                   PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI
FT                   VGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII
FT                   TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ
FT                   EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA
FT                   K"
FT   gene            677465..677549
FT                   /locus_tag="CLIBASIA_t05729"
FT   tRNA            677465..677549
FT                   /locus_tag="CLIBASIA_t05729"
FT                   /product="tRNA-Tyr"
FT   gene            677570..677643
FT                   /locus_tag="CLIBASIA_t05727"
FT   tRNA            677570..677643
FT                   /locus_tag="CLIBASIA_t05727"
FT                   /product="tRNA-Gly"
FT   gene            677746..678948
FT                   /gene="attA"
FT                   /locus_tag="CLIBASIA_02445"
FT   CDS_pept        677746..678948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="attA"
FT                   /locus_tag="CLIBASIA_02445"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57075"
FT                   /db_xref="GOA:C6XFC2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC2"
FT                   /protein_id="ACT57075.1"
FT                   /translation="MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDM
FT                   PENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVI
FT                   FNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITP
FT                   KTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVN
FT                   VEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAV
FT                   EALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPS
FT                   GDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSL
FT                   Q"
FT   gene            679565..681286
FT                   /gene="deaD"
FT                   /locus_tag="CLIBASIA_02440"
FT   CDS_pept        679565..681286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="CLIBASIA_02440"
FT                   /product="ATP-dependent RNA helicase protein"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57074"
FT                   /db_xref="GOA:C6XFC1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC1"
FT                   /protein_id="ACT57074.1"
FT                   /translation="MKIFENIPQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQ
FT                   TGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVV
FT                   VAVCIGGVSVHRERRDLQNGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDL
FT                   GFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQHSDIDYR
FT                   AVLVALSDRDNAIVNILRYHGAKNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQ
FT                   ERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGR
FT                   KGMSVFVIPQNMQRRAERLFREANVSVVWEPAPSVEAIRERDAQRILQDPLFLDSIQGD
FT                   EKKMVDVLLAKHDPEKIAAGFLRIHRAGLCAPEEITPVSLVSGRDRFRDDSRAFKVGGG
FT                   SRDNFKGSSWFSLSVGSKQKAEARWLMPMLCRSSGINRQSIGAIRVQPDLTFVEVSADG
FT                   VDLLRRTVKLDKGIQLKYLGGEKPDFRGYKSSGFKSKNSQDGATKRFKRFKGASKN"
FT   gene            complement(681399..682001)
FT                   /gene="pgsA"
FT                   /locus_tag="CLIBASIA_02435"
FT   CDS_pept        complement(681399..682001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="CLIBASIA_02435"
FT                   /product="CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57073"
FT                   /db_xref="GOA:C6XFC0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFC0"
FT                   /protein_id="ACT57073.1"
FT                   /translation="MASRSYNIPNMLTYGRILVVPLIVLCFFIQEIGSFTSPNLMRWIA
FT                   LSLFTIASITDFFDGYLARVWNQTSNIGRMLDPIADKLLISSVLLLMTADGTINRYSIW
FT                   AAITILCREILVSGLREYLAELKVSVPVTRIARFKTGIQMISIGFLLAGPACENQTSYI
FT                   TGTGIILLWISALLTIYSGYDYFRVGIKHIDSEDKQE"
FT   gene            complement(682088..683938)
FT                   /gene="uvrC"
FT                   /locus_tag="CLIBASIA_02430"
FT   CDS_pept        complement(682088..683938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="CLIBASIA_02430"
FT                   /product="excinuclease ABC subunit C"
FT                   /note="COG0322 Nuclease subunit of the excinuclease
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57072"
FT                   /db_xref="GOA:C6XFB9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB9"
FT                   /protein_id="ACT57072.2"
FT                   /translation="MSSEQMPECPGVYQMLDIAGRVLYVGKAYNLQKRIKSYMHSNNHT
FT                   HRITHMISQINNIRFTVTCTEVEALLLEANMIKRLKPRFNILLRDDKSFPYILITDKHK
FT                   IPALYKHRDSSTIQGSYFGPFASVDAVEKTINSLQRTFFLRSCADSVFRHRTRPCLLFQ
FT                   IKRCSGPCTGEISSEKYMEFVHEAKKFLSGGNHNLKEKIARNMNQATLKEDYESAIIHR
FT                   DRLAALSHIQNHNDSIYNRMDCFSLYHNKNLACIQTCFFHFGQNRGTCTFFLKTDSEST
FT                   NAQILSYFLRQFYTDKPCPENILLSEEAEETSLLEISFFKQYGYKVKITVPKQGEKRKI
FT                   IEQALINAHRSHTQKLSTEISHQMILKDFTKKFALPHIPKRIEIYDNSHIMGCSAVGCM
FT                   VVVGENGFVKNQYRKFNLHPNDVKTQDDCAMMRMVLERRFSQLIKNEENLNFHPKKQEY
FT                   SFPSWPDVVILDGGKGQLSAAQGVLKKLNVENRITIISIAKGPKRSAGMEKFFVKKGEA
FT                   LVLNMRDPILYFIQRLRDEAHRFAITTHRKRRKKAAYSPLDEINGIGPLRKRLLLQSFG
FT                   TVKMISRSSPETLASIEGISKKIACKIYNHFHKNTSHTPT"
FT   gene            684561..685178
FT                   /locus_tag="CLIBASIA_02425"
FT   CDS_pept        684561..685178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02425"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57071"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB8"
FT                   /protein_id="ACT57071.1"
FT                   /translation="MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR
FT                   YVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP
FT                   VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTA
FT                   GVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF"
FT   gene            685459..687222
FT                   /locus_tag="CLIBASIA_02420"
FT   CDS_pept        685459..687222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02420"
FT                   /product="ABC transporter permease"
FT                   /note="COG4986 ABC-type anion transport system, duplicated
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57070"
FT                   /db_xref="GOA:C6XFB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB7"
FT                   /protein_id="ACT57070.2"
FT                   /translation="MFLYNILPPFISRRIFPNIFDLLAFVLVIGIINILLHGIQETTVP
FT                   RDIVDIVPITLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPIL
FT                   DIMQSIPILGFLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPR
FT                   DLEEVSRSFRLSGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPL
FT                   PGIGSYIALAIKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPA
FT                   DSWVLYLFRKTNFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRV
FT                   SYMLDIFWFCVVCGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASI
FT                   IWIPVGIWIGFRPHISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIF
FT                   GTQWYILFNVIAGASAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGA
FT                   WNASIVSEVASWGHIHLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHP
FT                   LYLYGTRCLRL"
FT   gene            687251..688567
FT                   /locus_tag="CLIBASIA_02415"
FT   CDS_pept        687251..688567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02415"
FT                   /product="ABC transporter nucleotide binding/ATPase
FT                   protein"
FT                   /note="COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57069"
FT                   /db_xref="GOA:C6XFB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB6"
FT                   /protein_id="ACT57069.1"
FT                   /translation="MANIAIKDNRLLEIQDICQSFSLKKISGNLLVLDKVNFNVSSGEI
FT                   VGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKKIKDPPKDISVVFQTFALFPWLTVL
FT                   ENVELGLKAKGIDKEERRKRALSAIDLIGLDGFESAHTTEISGGMLQRVGFARAFVVFP
FT                   SLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIESMLMVTHNIEEAVLMCDRVLVFS
FT                   SNPGRIAEEVLISIPHPRNRLSPEFRQIVEKIYALMTKKEEKRLNPLENAPGSGIGIFL
FT                   RHVSTNLLSGLIEAVMAPPYNGKADLPDLANSLQLEADRLFHIGESLQLLQLVNLSGGD
FT                   ITLTESGIRFANLDTDSRKKLFAKQLLQHVPLVNLIRRVLDERRLHSAPAARFRNELED
FT                   YMSEEYAQETIDTVVSWGRYAELFSYDEQSELFSFDNPQ"
FT   gene            complement(688736..689605)
FT                   /locus_tag="CLIBASIA_02410"
FT   CDS_pept        complement(688736..689605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02410"
FT                   /product="nucleoside-diphosphate-sugar epimerase protein"
FT                   /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57068"
FT                   /db_xref="GOA:C6XFB5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB5"
FT                   /protein_id="ACT57068.1"
FT                   /translation="MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS
FT                   PFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPCIISMSKDFYKFMPHVKWIGYLSS
FT                   TSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRLSGIYGPKR
FT                   NPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGGIFNLSDDEPAPPQNVI
FT                   MEAASLMKITPPLEQCFDTANISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQ
FT                   LWKEIENL"
FT   gene            complement(689683..690375)
FT                   /locus_tag="CLIBASIA_02405"
FT   CDS_pept        complement(689683..690375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02405"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57067"
FT                   /db_xref="GOA:C6XFB4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB4"
FT                   /protein_id="ACT57067.1"
FT                   /translation="MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELN
FT                   PSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMY
FT                   QMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIA
FT                   GHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPV
FT                   SHYTNLDF"
FT   gene            690508..691308
FT                   /gene="bacA"
FT                   /locus_tag="CLIBASIA_02400"
FT   CDS_pept        690508..691308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="CLIBASIA_02400"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="COG1968 Uncharacterized bacitracin resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57066"
FT                   /db_xref="GOA:C6XFB3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB3"
FT                   /protein_id="ACT57066.1"
FT                   /translation="MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSF
FT                   IVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIK
FT                   SILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGT
FT                   SRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGF
FT                   MASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP"
FT   gene            complement(691544..692359)
FT                   /locus_tag="CLIBASIA_02395"
FT   CDS_pept        complement(691544..692359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02395"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57065"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB2"
FT                   /protein_id="ACT57065.1"
FT                   /translation="MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLE
FT                   NMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQ
FT                   EVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYER
FT                   ALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRM
FT                   KEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA"
FT   gene            complement(692688..693509)
FT                   /locus_tag="CLIBASIA_02390"
FT   CDS_pept        complement(692688..693509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02390"
FT                   /product="aminomethyltransferase protein (glycine
FT                   cleavage)"
FT                   /note="COG0354 Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57064"
FT                   /db_xref="GOA:C6XFB1"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB1"
FT                   /protein_id="ACT57064.1"
FT                   /translation="MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAIL
FT                   TPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSW
FT                   NQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPS
FT                   TIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILT
FT                   DDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK"
FT   gene            complement(693711..693986)
FT                   /locus_tag="CLIBASIA_02385"
FT   CDS_pept        complement(693711..693986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFB0"
FT                   /protein_id="ACT57063.1"
FT                   /translation="MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPE
FT                   IIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ"
FT   gene            complement(694297..695016)
FT                   /locus_tag="CLIBASIA_02380"
FT   CDS_pept        complement(694297..695016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02380"
FT                   /product="hypothetical protein"
FT                   /note="COG3034 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57062"
FT                   /db_xref="GOA:C6XFA9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA9"
FT                   /protein_id="ACT57062.1"
FT                   /translation="MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKR
FT                   TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF
FT                   YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEI
FT                   YAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEP
FT                   FIQIINKQYVFFKGQTI"
FT   gene            complement(695059..696012)
FT                   /gene="accA"
FT                   /locus_tag="CLIBASIA_02375"
FT   CDS_pept        complement(695059..696012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="CLIBASIA_02375"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0825 Acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57061"
FT                   /db_xref="GOA:C6XFA8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA8"
FT                   /protein_id="ACT57061.1"
FT                   /translation="MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVC
FT                   KTLSEIYSKLTPWQKTQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLAR
FT                   FHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGA
FT                   YPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIY
FT                   SVISPEGAASILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTIS
FT                   SVGEIISQFLSETSTYSETEIREHRRQKYLNIGRNL"
FT   gene            complement(696058..696960)
FT                   /gene="xerD"
FT                   /locus_tag="CLIBASIA_02370"
FT   CDS_pept        complement(696058..696960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="CLIBASIA_02370"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /note="COG4974 Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57060"
FT                   /db_xref="GOA:C6XFA7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA7"
FT                   /protein_id="ACT57060.2"
FT                   /translation="MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISY
FT                   LNHLSQRKLVTSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDT
FT                   IANLLEQAKIEAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMII
FT                   QGKGNKERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLK
FT                   ALAARAGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKL
FT                   QKLVQDYHPLAKKEKKHYN"
FT   gene            complement(697529..697834)
FT                   /locus_tag="CLIBASIA_02365"
FT   CDS_pept        complement(697529..697834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02365"
FT                   /product="BolA family protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57059"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA6"
FT                   /protein_id="ACT57059.1"
FT                   /translation="MQICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLG
FT                   ETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKNH"
FT   gene            697932..698507
FT                   /gene="dnaJ"
FT                   /locus_tag="CLIBASIA_02360"
FT   CDS_pept        697932..698507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="CLIBASIA_02360"
FT                   /product="molecular chaperone DnaJ family protein"
FT                   /note="COG2214 DnaJ-class molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57058"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA5"
FT                   /protein_id="ACT57058.1"
FT                   /translation="MKLDSKYFDRIRTRKKRKKNAPSPKSSICQWDNCQCIGEYRAPVG
FT                   SGAEEQFFLFCLDHVKKYNKGYNYFLGLSDDEVGRYQKEGVTGERFTWTAHLYAERYPS
FT                   NSSFFQDHRSSYGHFADRPDHRVGSMQFNAFEILGLLSDSSPEEIRGRYKDLVKKHHPD
FT                   ANGGDRGSEERFQAVIQAYKILKKSGFC"
FT   gene            complement(698718..699011)
FT                   /gene="rpmB"
FT                   /locus_tag="CLIBASIA_02355"
FT   CDS_pept        complement(698718..699011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="CLIBASIA_02355"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG0227 Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57057"
FT                   /db_xref="GOA:C6XFA4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C6XFA4"
FT                   /protein_id="ACT57057.1"
FT                   /translation="MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQ
FT                   KYQLRISKCALRSVERQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS"
FT   gene            complement(699385..700155)
FT                   /locus_tag="CLIBASIA_02350"
FT   CDS_pept        complement(699385..700155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLIBASIA_02350"
FT                   /product="glyoxalase II"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CLIBASIA_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT57056"
FT                   /db_xref="GOA:C6XFA3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="Inter