(data stored in SCRATCH3701 zone)

EMBL: CP001682

ID   CP001682; SV 1; circular; genomic DNA; STD; PRO; 1617804 BP.
XX
AC   CP001682; ABTM01000000-ABTM01000003;
XX
PR   Project:PRJNA20739;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Cryptobacterium curtum DSM 15641, complete genome.
XX
KW   .
XX
OS   Cryptobacterium curtum DSM 15641
OC   Bacteria; Actinobacteria; Coriobacteriia; Eggerthellales; Eggerthellaceae;
OC   Cryptobacterium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1617804
RX   DOI; 10.4056/sigs.12260.
RX   PUBMED; 21304644.
RA   Mavrommatis K., Pukall R., Rohde C., Chen F., Sims D., Brettin T.,
RA   Kuske C., Detter J.C., Han C., Lapidus A., Copeland A., Glavina Del Rio T.,
RA   Nolan M., Lucas S., Tice H., Cheng J.F., Bruce D., Goodwin L., Pitluck S.,
RA   Ovchinnikova G., Pati A., Ivanova N., Chen A., Palaniappan K., Chain P.,
RA   D'haeseleer P., Goker M., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Rohde M., Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Cryptobacterium curtum type strain (12-3)";
RL   Stand Genomic Sci 1(2):93-100(2009).
XX
RN   [2]
RP   1-1617804
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Sims D., Brettin T., Detter J.C., Han C., Kuske C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Cryptobacter curtum DSM 15641";
RL   Unpublished.
XX
RN   [3]
RP   1-1617804
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Inanova N.,
RA   Ovchinnikova G., Sims D., Brettin T., Detter J.C., Han C., Kuske C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 83dfd0b21da25b510c727217522d4a60.
DR   BioSample; SAMN02598434.
DR   CABRI; DSM 15641.
DR   EnsemblGenomes-Gn; Ccur_00070.
DR   EnsemblGenomes-Gn; Ccur_00080.
DR   EnsemblGenomes-Gn; Ccur_00120.
DR   EnsemblGenomes-Gn; Ccur_00130.
DR   EnsemblGenomes-Gn; Ccur_01380.
DR   EnsemblGenomes-Gn; Ccur_01560.
DR   EnsemblGenomes-Gn; Ccur_02350.
DR   EnsemblGenomes-Gn; Ccur_02360.
DR   EnsemblGenomes-Gn; Ccur_02500.
DR   EnsemblGenomes-Gn; Ccur_02560.
DR   EnsemblGenomes-Gn; Ccur_03410.
DR   EnsemblGenomes-Gn; Ccur_03620.
DR   EnsemblGenomes-Gn; Ccur_03750.
DR   EnsemblGenomes-Gn; Ccur_03930.
DR   EnsemblGenomes-Gn; Ccur_04600.
DR   EnsemblGenomes-Gn; Ccur_04940.
DR   EnsemblGenomes-Gn; Ccur_05420.
DR   EnsemblGenomes-Gn; Ccur_05430.
DR   EnsemblGenomes-Gn; Ccur_05810.
DR   EnsemblGenomes-Gn; Ccur_06030.
DR   EnsemblGenomes-Gn; Ccur_06390.
DR   EnsemblGenomes-Gn; Ccur_06510.
DR   EnsemblGenomes-Gn; Ccur_06590.
DR   EnsemblGenomes-Gn; Ccur_06600.
DR   EnsemblGenomes-Gn; Ccur_06610.
DR   EnsemblGenomes-Gn; Ccur_06650.
DR   EnsemblGenomes-Gn; Ccur_07180.
DR   EnsemblGenomes-Gn; Ccur_07190.
DR   EnsemblGenomes-Gn; Ccur_07200.
DR   EnsemblGenomes-Gn; Ccur_07210.
DR   EnsemblGenomes-Gn; Ccur_07570.
DR   EnsemblGenomes-Gn; Ccur_07580.
DR   EnsemblGenomes-Gn; Ccur_08220.
DR   EnsemblGenomes-Gn; Ccur_08680.
DR   EnsemblGenomes-Gn; Ccur_08950.
DR   EnsemblGenomes-Gn; Ccur_08960.
DR   EnsemblGenomes-Gn; Ccur_09040.
DR   EnsemblGenomes-Gn; Ccur_09640.
DR   EnsemblGenomes-Gn; Ccur_09690.
DR   EnsemblGenomes-Gn; Ccur_09720.
DR   EnsemblGenomes-Gn; Ccur_09730.
DR   EnsemblGenomes-Gn; Ccur_09740.
DR   EnsemblGenomes-Gn; Ccur_11580.
DR   EnsemblGenomes-Gn; Ccur_11590.
DR   EnsemblGenomes-Gn; Ccur_12300.
DR   EnsemblGenomes-Gn; Ccur_12430.
DR   EnsemblGenomes-Gn; Ccur_12440.
DR   EnsemblGenomes-Gn; Ccur_12720.
DR   EnsemblGenomes-Gn; Ccur_12770.
DR   EnsemblGenomes-Gn; Ccur_12800.
DR   EnsemblGenomes-Gn; Ccur_13260.
DR   EnsemblGenomes-Gn; Ccur_13480.
DR   EnsemblGenomes-Gn; Ccur_13960.
DR   EnsemblGenomes-Gn; Ccur_14070.
DR   EnsemblGenomes-Gn; Ccur_R0001.
DR   EnsemblGenomes-Gn; Ccur_R0002.
DR   EnsemblGenomes-Gn; Ccur_R0003.
DR   EnsemblGenomes-Gn; EBG00001090932.
DR   EnsemblGenomes-Gn; EBG00001090933.
DR   EnsemblGenomes-Gn; EBG00001090934.
DR   EnsemblGenomes-Gn; EBG00001090935.
DR   EnsemblGenomes-Gn; EBG00001090936.
DR   EnsemblGenomes-Gn; EBG00001090937.
DR   EnsemblGenomes-Gn; EBG00001090938.
DR   EnsemblGenomes-Gn; EBG00001090939.
DR   EnsemblGenomes-Gn; EBG00001090940.
DR   EnsemblGenomes-Gn; EBG00001090941.
DR   EnsemblGenomes-Gn; EBG00001090942.
DR   EnsemblGenomes-Gn; EBG00001090943.
DR   EnsemblGenomes-Gn; EBG00001090944.
DR   EnsemblGenomes-Gn; EBG00001090945.
DR   EnsemblGenomes-Gn; EBG00001090946.
DR   EnsemblGenomes-Gn; EBG00001090947.
DR   EnsemblGenomes-Gn; EBG00001090948.
DR   EnsemblGenomes-Gn; EBG00001090949.
DR   EnsemblGenomes-Gn; EBG00001090950.
DR   EnsemblGenomes-Gn; EBG00001090951.
DR   EnsemblGenomes-Gn; EBG00001090952.
DR   EnsemblGenomes-Gn; EBG00001090953.
DR   EnsemblGenomes-Gn; EBG00001090954.
DR   EnsemblGenomes-Gn; EBG00001090955.
DR   EnsemblGenomes-Gn; EBG00001090956.
DR   EnsemblGenomes-Gn; EBG00001090957.
DR   EnsemblGenomes-Gn; EBG00001090958.
DR   EnsemblGenomes-Gn; EBG00001090959.
DR   EnsemblGenomes-Gn; EBG00001090960.
DR   EnsemblGenomes-Gn; EBG00001090961.
DR   EnsemblGenomes-Gn; EBG00001090962.
DR   EnsemblGenomes-Gn; EBG00001090963.
DR   EnsemblGenomes-Gn; EBG00001090964.
DR   EnsemblGenomes-Gn; EBG00001090965.
DR   EnsemblGenomes-Gn; EBG00001090966.
DR   EnsemblGenomes-Gn; EBG00001090967.
DR   EnsemblGenomes-Gn; EBG00001090968.
DR   EnsemblGenomes-Gn; EBG00001090969.
DR   EnsemblGenomes-Gn; EBG00001090970.
DR   EnsemblGenomes-Gn; EBG00001090971.
DR   EnsemblGenomes-Gn; EBG00001090972.
DR   EnsemblGenomes-Gn; EBG00001090973.
DR   EnsemblGenomes-Gn; EBG00001090974.
DR   EnsemblGenomes-Gn; EBG00001090975.
DR   EnsemblGenomes-Gn; EBG00001090976.
DR   EnsemblGenomes-Gn; EBG00001090977.
DR   EnsemblGenomes-Gn; EBG00001090978.
DR   EnsemblGenomes-Gn; EBG00001090979.
DR   EnsemblGenomes-Gn; EBG00001090980.
DR   EnsemblGenomes-Gn; EBG00001090981.
DR   EnsemblGenomes-Gn; EBG00001090982.
DR   EnsemblGenomes-Gn; EBG00001090983.
DR   EnsemblGenomes-Gn; EBG00001090984.
DR   EnsemblGenomes-Gn; EBG00001090985.
DR   EnsemblGenomes-Gn; EBG00001090986.
DR   EnsemblGenomes-Gn; EBG00001090987.
DR   EnsemblGenomes-Gn; EBG00001090988.
DR   EnsemblGenomes-Gn; EBG00001090989.
DR   EnsemblGenomes-Gn; EBG00001090990.
DR   EnsemblGenomes-Gn; EBG00001090991.
DR   EnsemblGenomes-Gn; EBG00001090992.
DR   EnsemblGenomes-Gn; EBG00001090993.
DR   EnsemblGenomes-Gn; EBG00001090994.
DR   EnsemblGenomes-Tr; Ccur_00070-1.
DR   EnsemblGenomes-Tr; Ccur_00080-1.
DR   EnsemblGenomes-Tr; Ccur_00120-1.
DR   EnsemblGenomes-Tr; Ccur_00130-1.
DR   EnsemblGenomes-Tr; Ccur_01380-1.
DR   EnsemblGenomes-Tr; Ccur_01560-1.
DR   EnsemblGenomes-Tr; Ccur_02350-1.
DR   EnsemblGenomes-Tr; Ccur_02360-1.
DR   EnsemblGenomes-Tr; Ccur_02500-1.
DR   EnsemblGenomes-Tr; Ccur_02560-1.
DR   EnsemblGenomes-Tr; Ccur_03410-1.
DR   EnsemblGenomes-Tr; Ccur_03620-1.
DR   EnsemblGenomes-Tr; Ccur_03750-1.
DR   EnsemblGenomes-Tr; Ccur_03930-1.
DR   EnsemblGenomes-Tr; Ccur_04600-1.
DR   EnsemblGenomes-Tr; Ccur_04940-1.
DR   EnsemblGenomes-Tr; Ccur_05420-1.
DR   EnsemblGenomes-Tr; Ccur_05430-1.
DR   EnsemblGenomes-Tr; Ccur_05810-1.
DR   EnsemblGenomes-Tr; Ccur_06030-1.
DR   EnsemblGenomes-Tr; Ccur_06390-1.
DR   EnsemblGenomes-Tr; Ccur_06510-1.
DR   EnsemblGenomes-Tr; Ccur_06590-1.
DR   EnsemblGenomes-Tr; Ccur_06600-1.
DR   EnsemblGenomes-Tr; Ccur_06610-1.
DR   EnsemblGenomes-Tr; Ccur_06650-1.
DR   EnsemblGenomes-Tr; Ccur_07180-1.
DR   EnsemblGenomes-Tr; Ccur_07190-1.
DR   EnsemblGenomes-Tr; Ccur_07200-1.
DR   EnsemblGenomes-Tr; Ccur_07210-1.
DR   EnsemblGenomes-Tr; Ccur_07570-1.
DR   EnsemblGenomes-Tr; Ccur_07580-1.
DR   EnsemblGenomes-Tr; Ccur_08220-1.
DR   EnsemblGenomes-Tr; Ccur_08680-1.
DR   EnsemblGenomes-Tr; Ccur_08950-1.
DR   EnsemblGenomes-Tr; Ccur_08960-1.
DR   EnsemblGenomes-Tr; Ccur_09040-1.
DR   EnsemblGenomes-Tr; Ccur_09640-1.
DR   EnsemblGenomes-Tr; Ccur_09690-1.
DR   EnsemblGenomes-Tr; Ccur_09720-1.
DR   EnsemblGenomes-Tr; Ccur_09730-1.
DR   EnsemblGenomes-Tr; Ccur_09740-1.
DR   EnsemblGenomes-Tr; Ccur_11580-1.
DR   EnsemblGenomes-Tr; Ccur_11590-1.
DR   EnsemblGenomes-Tr; Ccur_12300-1.
DR   EnsemblGenomes-Tr; Ccur_12430-1.
DR   EnsemblGenomes-Tr; Ccur_12440-1.
DR   EnsemblGenomes-Tr; Ccur_12720-1.
DR   EnsemblGenomes-Tr; Ccur_12770-1.
DR   EnsemblGenomes-Tr; Ccur_12800-1.
DR   EnsemblGenomes-Tr; Ccur_13260-1.
DR   EnsemblGenomes-Tr; Ccur_13480-1.
DR   EnsemblGenomes-Tr; Ccur_13960-1.
DR   EnsemblGenomes-Tr; Ccur_14070-1.
DR   EnsemblGenomes-Tr; Ccur_R0001-1.
DR   EnsemblGenomes-Tr; Ccur_R0002-1.
DR   EnsemblGenomes-Tr; Ccur_R0003-1.
DR   EnsemblGenomes-Tr; EBT00001545379.
DR   EnsemblGenomes-Tr; EBT00001545381.
DR   EnsemblGenomes-Tr; EBT00001545383.
DR   EnsemblGenomes-Tr; EBT00001545386.
DR   EnsemblGenomes-Tr; EBT00001545387.
DR   EnsemblGenomes-Tr; EBT00001545390.
DR   EnsemblGenomes-Tr; EBT00001545392.
DR   EnsemblGenomes-Tr; EBT00001545395.
DR   EnsemblGenomes-Tr; EBT00001545397.
DR   EnsemblGenomes-Tr; EBT00001545399.
DR   EnsemblGenomes-Tr; EBT00001545401.
DR   EnsemblGenomes-Tr; EBT00001545403.
DR   EnsemblGenomes-Tr; EBT00001545405.
DR   EnsemblGenomes-Tr; EBT00001545406.
DR   EnsemblGenomes-Tr; EBT00001545409.
DR   EnsemblGenomes-Tr; EBT00001545410.
DR   EnsemblGenomes-Tr; EBT00001545413.
DR   EnsemblGenomes-Tr; EBT00001545414.
DR   EnsemblGenomes-Tr; EBT00001545417.
DR   EnsemblGenomes-Tr; EBT00001545420.
DR   EnsemblGenomes-Tr; EBT00001545422.
DR   EnsemblGenomes-Tr; EBT00001545425.
DR   EnsemblGenomes-Tr; EBT00001545427.
DR   EnsemblGenomes-Tr; EBT00001545429.
DR   EnsemblGenomes-Tr; EBT00001545431.
DR   EnsemblGenomes-Tr; EBT00001545433.
DR   EnsemblGenomes-Tr; EBT00001545435.
DR   EnsemblGenomes-Tr; EBT00001545438.
DR   EnsemblGenomes-Tr; EBT00001545440.
DR   EnsemblGenomes-Tr; EBT00001545442.
DR   EnsemblGenomes-Tr; EBT00001545444.
DR   EnsemblGenomes-Tr; EBT00001545446.
DR   EnsemblGenomes-Tr; EBT00001545449.
DR   EnsemblGenomes-Tr; EBT00001545451.
DR   EnsemblGenomes-Tr; EBT00001545453.
DR   EnsemblGenomes-Tr; EBT00001545455.
DR   EnsemblGenomes-Tr; EBT00001545458.
DR   EnsemblGenomes-Tr; EBT00001545461.
DR   EnsemblGenomes-Tr; EBT00001545462.
DR   EnsemblGenomes-Tr; EBT00001545464.
DR   EnsemblGenomes-Tr; EBT00001545466.
DR   EnsemblGenomes-Tr; EBT00001545468.
DR   EnsemblGenomes-Tr; EBT00001545471.
DR   EnsemblGenomes-Tr; EBT00001545473.
DR   EnsemblGenomes-Tr; EBT00001545475.
DR   EnsemblGenomes-Tr; EBT00001545477.
DR   EnsemblGenomes-Tr; EBT00001545480.
DR   EnsemblGenomes-Tr; EBT00001545481.
DR   EnsemblGenomes-Tr; EBT00001545482.
DR   EnsemblGenomes-Tr; EBT00001545485.
DR   EnsemblGenomes-Tr; EBT00001545487.
DR   EnsemblGenomes-Tr; EBT00001545490.
DR   EnsemblGenomes-Tr; EBT00001545491.
DR   EnsemblGenomes-Tr; EBT00001545493.
DR   EnsemblGenomes-Tr; EBT00001545496.
DR   EnsemblGenomes-Tr; EBT00001545498.
DR   EnsemblGenomes-Tr; EBT00001545500.
DR   EnsemblGenomes-Tr; EBT00001545502.
DR   EnsemblGenomes-Tr; EBT00001545505.
DR   EnsemblGenomes-Tr; EBT00001545508.
DR   EnsemblGenomes-Tr; EBT00001545511.
DR   EnsemblGenomes-Tr; EBT00001545512.
DR   EnsemblGenomes-Tr; EBT00001545514.
DR   EuropePMC; PMC5552949; 28326685.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001682.
DR   SILVA-SSU; CP001682.
DR   StrainInfo; 302365; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082789
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Cryptobacterium curtum 12-3, DSM 15641
CC   Culture Collection ID :: DSM 15641, ATCC 700683, CCUG 43107
CC   GOLD Stamp ID         :: Gi02234
CC   Funding Program       :: DOE-GEBA 2007
CC   Assembly Method       :: Newbler 1.1.03.24 , PGA
CC   Sequencing Depth      :: 12.9x Sanger; 20x 454
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Periodontal pocket of an adult patient
CC                            with periodontal disease in 1995
CC   Collection Date       :: 1995
CC   Host Name             :: Homo sapiens
CC   Host Age              :: Adult
CC   Host Health           :: Patient with periodontal disease
CC   Body Sample Site      :: Oral
CC   Oxygen Requirement    :: Obligate anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Caries, Periodontal infection
CC   Habitat               :: Host, Human oral microflora
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1617804
FT                   /organism="Cryptobacterium curtum DSM 15641"
FT                   /strain="DSM 15641"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Cryptobacterium curtum DSM 15641"
FT                   /db_xref="taxon:469378"
FT                   /culture_collection="DSM:15641"
FT   gene            130..1650
FT                   /locus_tag="Ccur_00010"
FT   CDS_pept        130..1650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="PFAM: Bacterial dnaA protein helix-turn-helix
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93738"
FT                   /db_xref="GOA:C7MLD2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD2"
FT                   /protein_id="ACU93738.1"
FT                   /translation="MSADKYDALWNTVVERIKTYENIDASQIDAFFSRLVPQAFSEGFL
FT                   MLTSDTEFIKKWIESHYTDVIKQALEEIYQVPFTIAIEVDTPSSAAEGVQQDQQNDVTH
FT                   TTPQHTSQQSEPSVKSLNERGSQSPFSPVSNNHSASPFTPTAEETISHNQDFLNSVISG
FT                   YSFESFVIGTSNKMAYSMAVAVAETPGQPQFNPLFIYGKSGLGKTHLLRSIQNYVHHAY
FT                   PTAKTVYVDTMALVNDYTDAAISRSNKSFSQFKQKYETADVLLIDDVQGLQNKKETLNM
FT                   VFQILNSMIDRGKQVVFSADRAPKNIDIDERYMSRFNMGGTCDIQPPELETKLGIIKNY
FT                   LEECRRGANDDFSIPADVQEYIAQNSSSNIRELKSAVTKVVFELRNNGKSEITIDEAAR
FT                   LLTDHFSGGAMKRLSISDIQTAVEQYYNVSHTELVGRKRSANITYARQIAIYLCRTMID
FT                   IPFNSIGTEFNRDHSTIMYSFRSVEEKVKESRQVNEELEIIRQMIIEQ"
FT   gene            1872..2969
FT                   /locus_tag="Ccur_00020"
FT   CDS_pept        1872..2969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="PFAM: DNA polymerase III beta subunit, C-terminal
FT                   domain; DNA polymerase III beta subunit, central domain;
FT                   DNA polymerase III beta subunit, N-terminal domain;
FT                   TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93739"
FT                   /db_xref="GOA:C7MLD3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD3"
FT                   /protein_id="ACU93739.1"
FT                   /translation="MKFNINKEDFQSTLEIVAKGAAVRSTLPILSGIHCITEGDMLTLE
FT                   ATNLDLSIKRSIPAFIEEEGEAVIPSKLLTDVVKSLPEAAVHVETTTETASIMCESSSF
FT                   SLKTFDPQDFPGFPEVEQTLAISFPFSTFSHMVKRVARVVSRDESRAILTGVLLEVHDG
FT                   MLRMVATDSYRLAVTDIDFTTPSEDFTAVISGSFMSDLAGLSDTGESLTLALAENQIVV
FT                   TYDGTTFINRRIEGNYPRYSQLIPETYETCAIFNTKMLIEAVKRTSLLSNKTAPVRFDV
FT                   NKASQTVQISTASQDVGEAHETLGAKIQGEDEEIAFNFGYVIDGLSSIETESVQLELQG
FT                   SMKPGILRATEQENFLYLIMPVRLS"
FT   gene            2977..4113
FT                   /locus_tag="Ccur_00030"
FT   CDS_pept        2977..4113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00030"
FT                   /product="recF protein"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93740"
FT                   /db_xref="GOA:C7MLD4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD4"
FT                   /protein_id="ACU93740.1"
FT                   /translation="MPSLEEPDKNLRLTNLVLRNFRNHQEFSLKGLQGITILAGPNATG
FT                   KTSVVEAIQLISALKSFRASQIGRAIRWGQTAASVIATIESDHRQLDLQLRIEEGKRSY
FT                   RLNGKARRARDLRGLFPAVTFVPDDLGLAKGPSSARRGALDDLGAQISKNFAMVQSDYT
FT                   KLVRQKNQALRDEASDTVIDSIDEVLTLVGVQILSHRSVMIKRLLPYFQLYYERIAQAN
FT                   ETADIQYIPCWNEENQTQWTFEREECLAIFTSTLQQARLQERLRRKSVVGPHADKVVFL
FT                   INGHDAAHFASQGQQRSLVLAYKLAEAAVIEETLNQRPILLLDDVMSELDHQRRDQFMS
FT                   MIEEDIQIFITTTNLEYFTDEIKEKALIQYLGGDNNEA"
FT   gene            4103..4654
FT                   /locus_tag="Ccur_00040"
FT   CDS_pept        4103..4654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93741"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD5"
FT                   /protein_id="ACU93741.1"
FT                   /translation="MKLNGRQVTAQLTHIPGFDGDKIRRALRIREVRDIWSQLVEQPIL
FT                   NHTNAVYIFTNDNRREMHVYVDESIYAAELNNRRELIKLACREQYGEVLDDFQIHISRG
FT                   MRKKEYPYQEHQEKTSTHTLSSQQEQENPYLSGQQKSFHLSDEEKNRITDQVSAIPDER
FT                   LKRHFIQAMIRDLECKKSQS"
FT   gene            4816..6753
FT                   /locus_tag="Ccur_00050"
FT   CDS_pept        4816..6753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00050"
FT                   /product="DNA gyrase subunit B"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; DNA gyrase B subunit, carboxyl terminus;
FT                   Endoplasmic reticulum protein ERp29, C-terminal domain;
FT                   Toprim domain; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93742"
FT                   /db_xref="GOA:C7MLD6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD6"
FT                   /protein_id="ACU93742.1"
FT                   /translation="MADNKPSHYDGKDIQVLEGLEPVRKRPGMYIGSTSERGLHHLVYE
FT                   VVDNSVDEALAGYCTDIQVWICDDGSIKVQDNGRGIPVDKHPKEHIPTVEVVLTILHAG
FT                   GKFGGEGYKVSGGLHGVGVSVVNALSTQMKVQVCRDGKRYEITFSRGKTVEKLHVVGDS
FT                   KHTGTTVRFWPDPEIFTETTVFNYNTLAERFREMAFLNKGLKITLYDERELDGEGVAKH
FT                   ETFQFQDGIKDFVKFLTTGKEVLNTKPIYFEAEGPAGEVEVAMQWTSSFSTNSVFSFAN
FT                   NINTIEGGTHLDGFKQAVTRTINDYAREKGILKEKDSNLTGDDCREGLSAVISVKLHDP
FT                   QFEGQTKTKLGNSEMRQLVSSAVNQGLGEYLEENPTPAKRIINKASQALKAREAARKAR
FT                   EMTRRKNVLDSFALPGKLADCSSKNAADCEMFIVEGDSAGGSAKQARDRKYQAILPLRG
FT                   KILNVERAGLHRALSSDTISSLITAVGTNIGDDFDAEKARYHRIIIMTDADVDGAHIQI
FT                   LLLTFFYRYMPELINRGYIYIAMPPLYGIKEGKKKIRYVYNDNALAEAMKDYPTDKKPS
FT                   VQRYKGLGEMDPDQLWETTMEPETRILMQVGIEDAAAAERAVSELMGDQVEPRKEYIQK
FT                   HAKDVRFLDI"
FT   gene            6797..9409
FT                   /locus_tag="Ccur_00060"
FT   CDS_pept        6797..9409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00060"
FT                   /product="DNA gyrase subunit A"
FT                   /note="PFAM: DNA gyrase/topoisomerase IV, subunit A; DNA
FT                   gyrase C-terminal domain, beta-propeller; TIGRFAM: DNA
FT                   gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93743"
FT                   /db_xref="GOA:C7MLD7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD7"
FT                   /protein_id="ACU93743.1"
FT                   /translation="MADKPKDTDDMVDNNSIDSSDQLEDKADEEETTGESTYESASQVL
FT                   PADLGQQMRQSFIEYSMSVIVARALPDVRDGLKPVHRRILYAMNESGILPNRPHAKSAR
FT                   TVGDVIGKYHPHGDTAVYDTMVRMAQPFSMSVPLVDGHGNFGSIDGDSAAAMRYTEARL
FT                   ARPAMELLRDLDKETVDWQPNYDESLKEPNVLPARFPNLLVNGSQGIAVGMATNIPPHN
FT                   LAEVIDATCLVIDNPDVSLDELLKVMPGPDFPTGATIMGREGIREAYETGRGSMTLRAK
FT                   CEISQTKRGRSIITVKEIPYMVNRTKLLEKIGELIRDKKLPEISNVHDGADRHGIDIII
FT                   ELKQNAIPQVVLNKLYKHTQMQTTFGANMLALVDDVPHTLSLKQILSYYIAHQIDVITR
FT                   RTRYDLQKAEERAHIVRGLLIALDNIDEVIHIIRSSKTDKEARDRLIENFNLDEIQANA
FT                   ILEMRLRRLTGLEYDKLVEELRDLEERIAYYKRVLEDENLVKQIIKEEMGEIKKKFSSK
FT                   RRTQIQRASAKDIDVEDLIADEDMVVTVTKTGYVKRLPLTTYRQQKRGGKGMQGVNLKE
FT                   DDFVEHLFVASTHAYMLFFSSKGKVYRLKVYELPEAGRHARGTAIVNLLSLEKGESIAA
FT                   VIATKDFPKEEYLMFATSAGMVKKTSMSLYDRTRRDGLIAINLNDGDELISVKRVSDGE
FT                   KVFMVSSAGKAIVWDESEARAMGRDTKGVRGMKVPADEHVLEMSIAKPQADLFVITEKG
FT                   YGKRTSVYEYPLHHRGGQGVYTITMTRKKGELAAAKIVTDDEELIIITNEGVVVRTPVK
FT                   GVSKLGRSTQGVRIMNVVDKDKVRAVGIADDGKGRKHKRVGGKTDDLDIDVDGDEGDL"
FT   gene            9520..9596
FT                   /locus_tag="Ccur_00070"
FT   tRNA            9520..9596
FT                   /locus_tag="Ccur_00070"
FT                   /product="tRNA-Ile"
FT   gene            9672..9747
FT                   /locus_tag="Ccur_00080"
FT   tRNA            9672..9747
FT                   /locus_tag="Ccur_00080"
FT                   /product="tRNA-Ala"
FT   gene            9818..10384
FT                   /locus_tag="Ccur_00090"
FT   CDS_pept        9818..10384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00090"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain protein"
FT                   /note="PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93744"
FT                   /db_xref="GOA:C7MLD8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD8"
FT                   /protein_id="ACU93744.1"
FT                   /translation="MDRQEALRILGLDRDASSEAIKIAYRETAQILHPDRFAGNKKLQE
FT                   RATEQFKNLQAAYDLLISGKGCASGVSSSSGKAGTSRSSGISRQEEELRARLAGIAAAR
FT                   VQLVEQRDSFFDRRRNAAAMMGIGALVAFFFRRFVWLAGVAGVAVVWGLIDVVSTTSNI
FT                   NSLTERLNALAKEKQQILSELEEIG"
FT   gene            10384..12198
FT                   /locus_tag="Ccur_00100"
FT   CDS_pept        10384..12198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00100"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="PFAM: Elongation factor Tu GTP binding domain;
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; TIGRFAM: GTP-binding protein TypA/BipA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93745"
FT                   /db_xref="GOA:C7MLD9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLD9"
FT                   /protein_id="ACU93745.1"
FT                   /translation="MKQEHIRNVAIIAHVDHGKTTLVDRLLYAGNVFRENQQVEERVLD
FT                   SNDQERERGITILSKNISIHYKDTKINIIDTPGHADFGGEVERVLNMADGALLIVDAFE
FT                   GPMPQTRFVLRHALDLGLRILVVINKIDRPGARPDEVLDEVFDLMVELDANDEQLDFPV
FT                   IYASAVNGYARFEPNDGNMDMVPLLDTILKEIPAPDCEPAGPVALQICTVDHSSFVGRI
FT                   GVGRLFSGTLHKNDQVLVIKRSGTRYNTGIKQVFTFDNLGKKEEDEVHAGDIVAVVGVE
FT                   DADIGDMVTSIDQPIELDPIKIDEPTMAVVFQASDSPLVGSDGDIVGARQLNERLMKEA
FT                   EGNVTMRITELEDKTGIEVAGRGILQISVLIETMRREGFELQVGRPRVIMKKDANGKTL
FT                   EPIEEATVEVPSEYAGKCIEVFGNAGGEMTDMASKGDQTHLVFKIPSRGTMGLRTKLLN
FT                   ASRGEANMFHRFSEYGPYRGEYAGRKNGSMISMTTEKSVAYALDTLQQRGTLFIGPGED
FT                   CYEGMIVGESAKEGDMVVNIAKSKNLGNQRSSGADKAIQLTPPTTFTLEEALEYIQEDE
FT                   LVEVTPKNIRLRKRILDTVARKKANKNR"
FT   gene            complement(12702..12818)
FT                   /locus_tag="Ccur_00110"
FT   CDS_pept        complement(12702..12818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93746"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE0"
FT                   /protein_id="ACU93746.1"
FT                   /translation="MLTFMLKRHLFEDHDDLGVHLSYSYKLISPMSDKPIPA"
FT   gene            12849..14352
FT                   /locus_tag="Ccur_00120"
FT   rRNA            12849..14352
FT                   /locus_tag="Ccur_00120"
FT                   /product="16S ribosomal RNA"
FT   gene            14822..17843
FT                   /locus_tag="Ccur_00130"
FT   rRNA            14822..17843
FT                   /locus_tag="Ccur_00130"
FT                   /product="23S ribosomal RNA"
FT   gene            17975..18085
FT                   /locus_tag="Ccur_R0001"
FT   rRNA            17975..18085
FT                   /locus_tag="Ccur_R0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(18251..19192)
FT                   /locus_tag="Ccur_00140"
FT   CDS_pept        complement(18251..19192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00140"
FT                   /product="membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /note="PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93747"
FT                   /db_xref="GOA:C7MLE1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE1"
FT                   /protein_id="ACU93747.1"
FT                   /translation="MLSRDFFLFNTENHIEVETDDDTILDQVEALCQHYERMLSCFNPE
FT                   SELYRLNQQAGKTTPISDELAEIIEAALFYCQATDGAFDITMGTVTRLWNLQDRIIPCR
FT                   EDLAAALAHVDWEAITLSGSAGQRTITISDADACLDLGGIAKGYITDSITRLLKQQDVA
FT                   RAIINLGGNVAVLGEKQAGKPWHVGLRSPLPSSSMSTLTCFGVVEIADASAVTSGIYER
FT                   AAEIEGVFYHHILDPTTGMPAETDVLSATVIAPQSIDADGYTTALIVMGAKRALECIES
FT                   IDGLEAIIVTTHGDVIGTSGIGETIPFALLQS"
FT   gene            19329..20315
FT                   /locus_tag="Ccur_00150"
FT   CDS_pept        19329..20315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00150"
FT                   /product="L-asparaginase type II family protein"
FT                   /note="PFAM: Asparaginase; TIGRFAM: L-asparaginases, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93748"
FT                   /db_xref="GOA:C7MLE2"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE2"
FT                   /protein_id="ACU93748.1"
FT                   /translation="MEPQSKVIVFGMGGTIAGTGSAGKSINYQPGQLDVDDLLQNIPPD
FT                   MRSHTTVVGQQICNVNSDDVTSQQWIDLACRINARASDPDVDGFVVTHGTDTLEETAYF
FT                   LNLTVKTKKPVVITGAMRPATALSADGPLNLIQAIRLATNRQAYGLGVLVCFAGRVFGA
FT                   RDVEKATTFGVEGFIGRNSGCLGSVIEDDFQLYQQPVRAHTTDTEFDVGDSASLPTVGI
FT                   AYFSSESDAGVLDYFTSSGVRGLVVAGAGAGCYSQEWNKRIEQISQKICVVRCSRVGNG
FT                   PAIADDSYRGNLVLGGDLSPQKAVVLLRLALSVTDKPHLIQKMFERY"
FT   gene            complement(20541..22661)
FT                   /locus_tag="Ccur_00160"
FT   CDS_pept        complement(20541..22661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00160"
FT                   /product="DNA/RNA helicase, superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93749"
FT                   /db_xref="GOA:C7MLE3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE3"
FT                   /protein_id="ACU93749.1"
FT                   /translation="MDQIFEEEQAHLTETYGKLDVIKQDAEQKLAAVQSEAAHNMESMR
FT                   NETSLDFSDDENALETVAALEAVNSVIDAYNRTIQVNSERLKNATQLMAQPYFAKVSLQ
FT                   FHSDEPTRDIYLGSVGITDEARRHFIVDWRSPVAETYYNQENGPMSYTANGRTISVDLK
FT                   LRRQFDITRNTLNAYFDTTVAIEDPLLLASLAANHSEKLKAITATIQKEQNEVVRHDDV
FT                   PVLLVNGIAGSGKTSVLLQRIAFLFYQKRDTLRPDQVCLLTPNPVFEKYIDNVLPDMGE
FT                   ANPQIFTWADFVALLGLSERGDGRDTSAETLHTLEQNMASLHLEAHDFSEIAIDGMRLV
FT                   KTTQIQGIAAKYKNIPVGPRLIALMKEDLHARLDTRLGQLASDEDIHDRMLSLEVSEQI
FT                   RLFGQTLAPQSEKETIEYARTFVQHLYGTAHDKIEQVSWLRFDRIGMRMLNAGHLSSVA
FT                   WLFLKTLITGTGAHDIRYVTIDEVQDYTEAQLMVLARYFKRAHFLLLGDENQAINEGTA
FT                   SFDRIRAIFAASHGSVDECRLMTSYRSTAEITALFTGLMDSTERVKTHSVQHGGKRPRI
FT                   EVLPDEEALLEALRGILHTEQDSEGLCAIIAPTHQDVQRIAQKLTGITVIDHHAVLPGR
FT                   GVVLLDLPLAKGLEFDHVVIVDADRHVYPDTQLARRRLYTALSRAAHQVTVLAQKSLTP
FT                   LLESATSASLDL"
FT   gene            complement(22665..22889)
FT                   /locus_tag="Ccur_00170"
FT   CDS_pept        complement(22665..22889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93750"
FT                   /db_xref="GOA:C7MLE4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE4"
FT                   /protein_id="ACU93750.1"
FT                   /translation="MSSQVKRRGTDTEIASLIALITAFVTFAIIFALSAAQASLELVAV
FT                   FSAAGIIIALLFLTWLAFYAPFSPFNRVK"
FT   gene            23263..24135
FT                   /locus_tag="Ccur_00180"
FT   CDS_pept        23263..24135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00180"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="PFAM: SEC-C motif; metallopeptidase family M24;
FT                   TIGRFAM: methionine aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93751"
FT                   /db_xref="GOA:C7MLE5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE5"
FT                   /protein_id="ACU93751.1"
FT                   /translation="MDSPSRNDACWCGSGKKYKKCHLHIDERLQELYELGEEVPYRNLL
FT                   KTAQDIEGIKRSAEVNIGALDYVAEHIQVGTTTEEIDQWVYDYCIKHDAIPADLNFEGY
FT                   PKSVCTSINEVVCHGIPSADDVLKEGDIINVDMSTIKDGYFSDSSRMFCIGEVSKEKKR
FT                   LVEITRRAVEAGLDAVKPWCHLGDVSAAVNKVAVDAGYSVVAEFGGHGIGLEFHEDPFV
FT                   SFVARAGTGPILAPGMCFTIEPMVNMGKAAIDMSDPNGWTVRTADGKPSAQWEVQLVVT
FT                   ETSYELLSW"
FT   gene            complement(24114..24995)
FT                   /locus_tag="Ccur_00190"
FT   CDS_pept        complement(24114..24995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00190"
FT                   /product="methenyltetrahydrofolate cyclohydrolase
FT                   /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /note="PFAM: Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain; Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93752"
FT                   /db_xref="GOA:C7MLE6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE6"
FT                   /protein_id="ACU93752.1"
FT                   /translation="MAQIWKAAPVVEALAEETDRLVAQVTAQGITPQLAIIRVGNRPDD
FT                   ISYERGARKRCEARGIAATTFELAAESTQDELMTTIQHINDDPAIHGCLMLRPLPASLN
FT                   EEAATAVLLPQKDIDGITPSSLFGVFAQETVGFAPCTAQAVIEVLDHYGAHLDGTNVCV
FT                   IGRSLVVGRPVSLMLQKRNATVTMCHSHTRTIQQVCRQADIVVAAIGQAHTIDVDWVSP
FT                   GQVVIDVGINWDSAASKLVGDVDFDSVEPKVAAITPVPGGLGAVTSAVLCKHLAQAAVN
FT                   QLAAPPYQESNS"
FT   gene            complement(25000..25632)
FT                   /locus_tag="Ccur_00200"
FT   CDS_pept        complement(25000..25632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00200"
FT                   /product="methenyl tetrahydrofolate cyclohydrolase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93753"
FT                   /db_xref="GOA:C7MLE7"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE7"
FT                   /protein_id="ACU93753.1"
FT                   /translation="MPQPFMQQSCADFAANIAARNSSPGGGSASAAVGAIAAALGQMAG
FT                   NFTLGKEKYADVQDDIERLCTQARNIRLRLLDCVEEDAAAFVPLARAYGIPKSDPDRTI
FT                   RLERATQAACKPPLEMMRALCEAIEVLEELEGTCNRMLVSDVGCGAALALGALQSASMN
FT                   IYVNTKTLIDRDFAQQYEAEADKLLATYVPRAQLIVGTVMNTIRGRK"
FT   gene            25897..27735
FT                   /locus_tag="Ccur_00210"
FT   CDS_pept        25897..27735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00210"
FT                   /product="NADPH-dependent glutamate synthase beta
FT                   chain-like oxidoreductase"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   NADH-ubiquinone oxidoreductase-F iron-sulfur binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93754"
FT                   /db_xref="GOA:C7MLE8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE8"
FT                   /protein_id="ACU93754.1"
FT                   /translation="MAVLSFGPYAHADAANGRVAEAFQRRVQTTPPGMCPIALQLSFLQ
FT                   ACGAQTCGKCVPCRDGIPQLARLLDQVVTCHATTETLIQIRALAQSIRDTSDCAIGYQA
FT                   GQGVLDGLEEFADEYESHLSQRSCLSDIGQTVPCETGCPAHVNVPSYLALAGKGDYAGC
FT                   INMVRKDNPFPTACGYVCEHPCEERCRRTIIDAPLNIRGIKKFACDQLPADEVPLPQPN
FT                   VGTGRRIAVVGAGPSGMTCAYFAALMGHSVTLIEARRQLGGMMRYGIPAYRFPREKLDQ
FT                   DIRAILSLDNIEVHTEETVGTEEMRRLAKEYDAVYVAIGAQQGKTLDLAGADAKGVMSA
FT                   VDLLTRIGDDDYPDFTGKNVVVIGGGNVAMDCARTAVRAGAKTVTVAYRRRLEDMTALR
FT                   AEVDSAMQEGVEMMTLQAPDSIEVVDGHCAALITQPQRIGAVKRGRPAPVTADKPQVKI
FT                   PADIILIAVGQAIESAPFEEAGMQADRTYFVADKQLHAAASAPNVFVGGDCQVGPKTVI
FT                   MAIAAGKVAARNIDAFLGYDHKLDCGVADPAPDANIREAYGRVNIAERSARERKGDFLA
FT                   TEVEMTVEEAQQECARCLRCDHFGCGAMVGGRIQYA"
FT   gene            27728..30448
FT                   /locus_tag="Ccur_00220"
FT   CDS_pept        27728..30448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00220"
FT                   /product="formate dehydrogenase, alpha subunit,
FT                   archaeal-type"
FT                   /note="PFAM: Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase; Molybdopterin oxidoreductase
FT                   Fe4S4 domain; 2Fe-2S iron-sulfur cluster binding domain;
FT                   4Fe-4S binding domain; NADH-ubiquinone oxidoreductase-G
FT                   iron-sulfur binding region; TIGRFAM: formate dehydrogenase,
FT                   alpha subunit, archaeal-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93755"
FT                   /db_xref="GOA:C7MLE9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE9"
FT                   /protein_id="ACU93755.1"
FT                   /translation="MPSMTVDGKQVSFRSGMTILGAARKAGAFIPTLCFLRGISSIGSC
FT                   RVCAVEVEGEEGLVTACNTPARDGMVVHTDTPRVIESRTIQLQLLIADHGLNTTNYCFS
FT                   CVKNGSCQLQDVCRACGVEESPFPVSDERKPIYDGNPFLQFDPNLCIRCQRCVGACNNQ
FT                   ARNHTIQTGKKGMRTTILAPFGDDWESTTCESCGCCAAACPTGAIVEKRRHSYRSWETK
FT                   RVLTTCPHCGTGCQYYLVVRDGRIVDVEAAKGPSNDGALCVKGRSASFDFVQSPDRLTT
FT                   PLIKNRTTGEFEPASWDDALDLVASRFVELKNTYGPDSLAAFACSRSSNEDIYMLQKMA
FT                   RVAFGTNNVDNCARVCHSPSVSGLARTLGSGAMTNPIPDITSKDVDLIMLVGSNPEEAH
FT                   PVIGMQIRRAVERGARLIVVDPRDIGLARKADVHLKLRPGTNVAFSNGMCHVMIKEGLI
FT                   DRTFIEERTEGFDKFARLVESYTPERVAEICHIRPEDLIQAARMYATAQVAPIIYCLGV
FT                   TEHSSGTEGVMSMSNMALLCGKLGRPGCGVNPLRGQNNVQGACDMGAQPTDFPGYQKVD
FT                   NPEIMAKFEKAWGVELNHKVGMFATNVFHAAAKKEIRGLFIFGEDQVRTDPDIGHVIRG
FT                   LEALDFVVVDELFMTETAKYADVVLPGISYAEKEGTFTNTERRVQRIRPAIAAPGDARP
FT                   DTWIFTEIMRRMGYDQPYLTPAEIMDEIASVTPSFAGISHKRLDSKEIGGKGLQWPCLA
FT                   PDHPGTPIMHVGTFARGLGKFAGTEYRASQEMPSGDYPLMLTTGRILYHYNAQAMTART
FT                   RGINRISDRSFIEINTEDARNLGVEDGDRVRVCSRRACIESEAHVSDKTGMGETWMPFH
FT                   FLDGNANWLTNAALDNISACPEYKVCAINIEKISS"
FT   gene            30745..32997
FT                   /locus_tag="Ccur_00230"
FT   CDS_pept        30745..32997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00230"
FT                   /product="dipeptidase"
FT                   /note="PFAM: Peptidase family C69; Putative cell wall
FT                   binding repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93756"
FT                   /db_xref="GOA:C7MLF0"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF0"
FT                   /protein_id="ACU93756.1"
FT                   /translation="MGKFAKIGCAVALSASLAVALPGSAFACTGIYIGSQYDTDSSSYF
FT                   SRCEDYTYVPPSAVHLKVFGVQAATKNSGQTYNNAEEMGGVDQTHFSRPYPASTYRFSY
FT                   IRDSSDYGAGDMAYAEAGTNELGVSMSATVTTDYNDAAKAADPLTDSGVTENNIGTILL
FT                   GEATSAKHAMQIAGDVMDQYGAGENFRIFASDSTGETWVFNALSGHQWVAFKLPNDKFS
FT                   VDPNMGRLQYKINLDSSDVLHSEKVKQLAEDNGFAKTFADGSFDVSTSYGKANSGAGQY
FT                   SRFYMGVNQLDPAVAGSLQITKDANGKLTDIQDPQYLYSSSTLKMTGPSKLMNALRTRG
FT                   QGSEFDATTNSNLYPLSNPYQLECHIFQTRAGDLPVGMKTIQWQATGRNGYNVFLPSYS
FT                   ALLLPDGDDGFKGTVQHDIGALAQDTGNQTTPSINKLNSLDGVENSQYYTMLELNNLVD
FT                   TKPDLYAKNVSKYLQNLQNKLIDEQSAVDQKMLALPADAREAKATDVADKLQTQLTQKT
FT                   IKLIKEMKAYEQAGDTSKPFMPSELNADGTNNAYLDYLSLFEEPAPNPEPTPGWAQDDN
FT                   GQWSYTNADGSKAVAWQEVNGTWYYFNDEGIMQTGWVQLDGAWYYLQSWGGMALDWQLV
FT                   DDTWYHFDSAGAMQTGWLQLSGAWYYLTDSGAMATGWIQVDGTWYYFANDGAMQTGWVY
FT                   VDNDWYYLNADGSMATGWLQLDSTWYYFKTWGGMAAGNYPVDNVMQRFASSGAWIG"
FT   gene            33290..34321
FT                   /locus_tag="Ccur_00240"
FT   CDS_pept        33290..34321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93757"
FT                   /db_xref="GOA:C7MLF1"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF1"
FT                   /protein_id="ACU93757.1"
FT                   /translation="MLTYVPRFIPDIVQAAPFVLAFAILCARPLHRRPLAFYIPIAVIV
FT                   TLVSLPDTCNVIMAGNTPAPLQSYGVALEGARKAVPLFDDVIDIITGACTGVWFYLIVM
FT                   FIGVLHRGPVVKKLYSARSELSVLGGIIVMGHVMRVLAFPFYFTSEQFRAVWGIPAVWF
FT                   MFFAAVIVGVFLTIVFLIPWITSFKFIRRQMPASTWRKVQKLAYPFMFLMLLQGLFLGV
FT                   GHAAYGWPFDSQISMRLIASNPASYVIDLARYVGQAWIYFFFICVYSALLVRRRAERKR
FT                   EARESMTSTKVSCEAPEGKTDMVVNRGASESKTDTKVGREVSESNHDESASLKTAEGSK
FT                   RDA"
FT   gene            complement(34389..34883)
FT                   /locus_tag="Ccur_00250"
FT   CDS_pept        complement(34389..34883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93758"
FT                   /db_xref="GOA:C7MLF2"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF2"
FT                   /protein_id="ACU93758.1"
FT                   /translation="MNTKNIVDTEKRTLSENIRFCLLAICVGFTIVMVVLLVLGSIFAG
FT                   EAAQQGIGYCWSVFGICVVAALLQFVFFTPIVIKRLSGVLRHALFGICLFAVLAITAVI
FT                   IGWFPATIPSAWISFTITYLVIFGIITAVFAFKQKRETRELNEKLATYRKDKKNKHSIE
FT                   N"
FT   gene            complement(34906..35349)
FT                   /locus_tag="Ccur_00260"
FT   CDS_pept        complement(34906..35349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00260"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="PFAM: LytTr DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93759"
FT                   /db_xref="GOA:C7MLF3"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF3"
FT                   /protein_id="ACU93759.1"
FT                   /translation="MKITIEEQPSAQDIEVTIVCKKTDGCVLDMLARLRMLDRKVTGSV
FT                   DGRTHVVSAEDVLYVESVDKRTFIYTTTEVLETTLRLYEMEERLTDCDFLRVAKGCVVN
FT                   FRKITALEPEINGRIIATMENSERVVISRQYAPDVKRKLGLLQ"
FT   gene            complement(35641..36984)
FT                   /locus_tag="Ccur_00270"
FT   CDS_pept        complement(35641..36984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00270"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93760"
FT                   /db_xref="GOA:C7MLF4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF4"
FT                   /protein_id="ACU93760.1"
FT                   /translation="MSSVKNKQQKRRSASRNRPFSSIARSISWGFWWRRLASYLFFNVL
FT                   LAICVVAVLIYGYNQTLPSNAFLFGYIPLNETHITITSATNSSGIGSLQYVVQLPTQAP
FT                   QSFALGKALTDLWLLYVAIFLWELLSLLHFFSDTRRIRRELLPLNDLALKAEKLSSADP
FT                   LAHDFSSHKMESLEQAIERATIDSPRVKTGDKDLASIEVALNRLLQQMQEAKLQQMRFV
FT                   NDASHELRTPIAVIRGYTDLLDRWGKTDATVLDESISALKAESEHMHDLVEQLLFLARG
FT                   DTGRGSLEKKMVNLAQITEEVWEESEMIDADHHYVLKLDKSALEDARYQVNGDVALLKQ
FT                   TLRIIVQNAAKYSRKQTTITFKVSLGEKRVSVSVQDEGIGMEADAARHAFERFYRAENA
FT                   RATNTDGSGLGLSIAQWIIDKHDGTIEVLSHEDVGTRFVVTIPASNED"
FT   gene            complement(36965..37669)
FT                   /locus_tag="Ccur_00280"
FT   CDS_pept        complement(36965..37669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00280"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93761"
FT                   /db_xref="GOA:C7MLF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF5"
FT                   /protein_id="ACU93761.1"
FT                   /translation="MTKILIVEDEEKIARFIELELKHEGYEVDKASDGRSGVEQALSAD
FT                   YDLILLDILLPQINGLEVLRRIRREKDTPTIMLTARDAVMDKVAGLDAGADDYLTKPFA
FT                   IEELLARIRVALKHHKSPDQPTSLSPEPTATKTLSIKGVLLDIDRREVRVNSDPVELTN
FT                   REFEVLRCLMEHAGVVMHRERIAADALGYEFMGDSNNVDVHIAHLRAKIDDKHDIKLIS
FT                   TVRGVGYVIRKE"
FT   gene            complement(37662..38204)
FT                   /locus_tag="Ccur_00290"
FT   CDS_pept        complement(37662..38204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00290"
FT                   /product="UBA/TS-N domain-containing protein"
FT                   /note="PFAM: UBA/TS-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93762"
FT                   /db_xref="GOA:C7MLF6"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR025642"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF6"
FT                   /protein_id="ACU93762.1"
FT                   /translation="MDKLEKVERICEKCGVSYEDAKAALDACNDDMLDAIIWLERAGKT
FT                   NKQTAHYTTKPTSQEIVSPEMVAAQAAYEKSSRKSDFSQHMSAFWDAFKKLLHKSVDTK
FT                   FVATRNGEEFFSLPVIIPIAGIFLWGATIWLLIIGLFFNIRYRLEDTKPITVDVNDAMD
FT                   KIADAAETLKKDVTGND"
FT   gene            38690..44140
FT                   /locus_tag="Ccur_00300"
FT   CDS_pept        38690..44140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00300"
FT                   /product="conserved repeat protein (List_Bact_rpt)"
FT                   /note="PFAM: Listeria-Bacteroides repeat domain
FT                   (List_Bact_rpt); TIGRFAM: Listeria/Bacterioides repeat;
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93763"
FT                   /db_xref="GOA:C7MLF7"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF7"
FT                   /protein_id="ACU93763.1"
FT                   /translation="MKTASKSIARNIFAVFISCVMVVSLSPTLSFAEPSASAAAESTPS
FT                   GSSVASGTEGTSTESSSSEAVTPTEATEASASTDTVSATDSTSAISADSVEGAQELEGE
FT                   EVSAVSAAAPTLRPPAGTTTLWVDGTSGNDANDGATQATAFKTLAQALSTQAANPTITT
FT                   IKMLGSFSNPPAATIPSGVTLVVAGNTTMTSNGNNGITLASGSFLKCENGSTLTMSGFN
FT                   TALTVKADAEVNDGTYKLDNNAIGFNLDGKFNGSTRSALTVSALESTGRAFTYGDKSSF
FT                   VNCTVNVQAKNESSEQYNGLNLKNASLTTKGVWYYFNPSNSATGYVGGVHLDNSDFYAY
FT                   KATGASAYKQTMSIFAPSELKNGSTLTSDGSRITLSAALTVDDSKVVIKNSTAGGLNIN
FT                   YSPGSAVFTNSTLETTNMKYTPSYGTGQSNGPCYLTFQGNSVVNTDAQDKTADDGGANR
FT                   DTNSTYVVTGGSFLVAYDPSFNYNVTTPTNGASNGNEWLSLFTLTDTSTTVLNPINKNG
FT                   AAYTYNVATPSKDGKKHVWTPAAKVTFKLNNANATFADGTTADKTASTIRGYKLDDVVG
FT                   NVQPGNPTDSTGVAFLGWYYKDASGVEHAFNWSNETLTSDIEVYAKWDAKTVIYHNGAG
FT                   QSYIQALDTSASSATALSYDEVVNKDASFNVAGKTFTKWTTSSDGSGNAVNAGDTLAFA
FT                   SGTTQIDLYAQYTDNEYRVAFSANGGTFASTSVFKAHPEAFTIEQDSTGGEVAVLKKTA
FT                   TYNQKIRELLNGVSYNDLKVTKAEASKTGFKLADKDNWNTKADGTGSTVRFDDHSVWIF
FT                   PITGDNPSITADTTYYLKWQEDSSVPLIQADGILPSDMWGNAGANSQADSKSVLKVSTD
FT                   GDGAFSLTGAVDTAGIKQQMQAIESQFGQDANNFSNIKLTGTTSTFSATFELPNGVTVP
FT                   SDPQVTATGLGDCYEVKSVTTSGQKIVVTFGLKQAFTDYQQLKNAVDSTGAASGGTSEE
FT                   INPISDSITLTIPGLKVDSASVANGDELTAKGSVAGSFSAVAKGSNDKVKRFSFKWTGE
FT                   QIAAGKDVRAANDTVIQQTILVKKPYALTLGADMLATVLPDNPTTSQLKQAGTDTEHTK
FT                   VIGVYQGSKLNVTGTIDSTSVKQQMKAIENQFGQNPSGFSSIKLTGLSSTFTATFELPD
FT                   GMELPSGLDASKVIPEGFADTFTVSNVAVSGKTITVTMGLKDGIENYQQLKDAVDALGD
FT                   TMKLTIPGVTVNEDVADGTSLTMKGTVEGSFDATATSASGTVKDFSFRWTGEQIDEGKD
FT                   VTVTDPADKTIQLTVQTPTPTDAELPADILSGDDTEHTAVYETLAGSTMDLTGAIDANT
FT                   IKQQMRNIENRFNNPDGTTIAIDVKQFGFTADFTVPDGMELPSSLSVSDLTTEGFGNGF
FT                   KVQSVTVSGKTATVNFVLSDPDAIRTYADLKAIVDAVGKDASGTDTGWMKLTVPNVKVD
FT                   DGLASGTELTMTGTVNGSFKALATSQSGRQETFSFRWNGTQWPDGKDFAAPASDNSIRF
FT                   TARVVSTLQSELPGDILIGDDTEHDAVYKAKATDTLTYTGALNVDPIKQQMSYIESQYP
FT                   GTSADTIKVNVKNCTFTATFTVPNEMNLPSSLSVSDITTHDFGPFEVTDVQVSGKTVTV
FT                   TMKLKNASAIKTYADLKAAVNTAGDANNWMKLDVPGITIDASQVSPGQQLTVTGTVEGT
FT                   FAADAISASGKRKVFSFAWTGTQWPDGRDAVADPTDNTIRFTLEITEDEPQPGPEPQPQ
FT                   PQPTPDPNPQPGPNNNGTPNNDILAKTSDALPLTIIGLLAVSAVAVGIAVYRMRKSSGE
FT                   K"
FT   gene            44311..44553
FT                   /locus_tag="Ccur_00310"
FT   CDS_pept        44311..44553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00310"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="PFAM: Ribosomal protein S16; TIGRFAM: ribosomal
FT                   protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93764"
FT                   /db_xref="GOA:C7MLF8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF8"
FT                   /protein_id="ACU93764.1"
FT                   /translation="MVKIRLARHGAKKRPYYRIVVTDSRAARNSRPIEEVGRYNPCVEP
FT                   SMIQIDLEKVDKWIANGAQPTDTVAHLIESARKEA"
FT   gene            44558..44812
FT                   /locus_tag="Ccur_00320"
FT   CDS_pept        44558..44812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00320"
FT                   /product="RNA-binding protein (KH domain)"
FT                   /note="PFAM: KH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93765"
FT                   /db_xref="GOA:C7MLF9"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLF9"
FT                   /protein_id="ACU93765.1"
FT                   /translation="MSGEALDLSGLVRTLVEPIVDYPDDLEVTQNEGEQGDYLVEIRVN
FT                   EEDAGKVIGRQGRVIKAIRTLARAAATRDARHVEVEIVD"
FT   gene            44813..45517
FT                   /locus_tag="Ccur_00330"
FT   CDS_pept        44813..45517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00330"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="PFAM: PRC-barrel domain; TIGRFAM: 16S rRNA
FT                   processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93766"
FT                   /db_xref="GOA:C7MLG0"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG0"
FT                   /protein_id="ACU93766.1"
FT                   /translation="MSAWVKAACIIKTKHLQGELVVRKVDRFPFLLSEGMQVYFVPPTL
FT                   CGPREGHVVSVSPAREGEWTVSFDTVDDIASAEELVGSWCLIAKSDVPEPSEGALPLLC
FT                   EGWRVVDTKRGELGALSAIIEQPAQSLLSVEGSVEGRLGEILIPAVDEFICQIDTADRC
FT                   ITVQLPEGLLDLAAENAVVSNKDASAITGDKATDRAGSHTGVNKMQGCKSAGKEGSIDA
FT                   HKQDDNSLQGGA"
FT   gene            45517..46272
FT                   /locus_tag="Ccur_00340"
FT   CDS_pept        45517..46272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00340"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="PFAM: tRNA (Guanine-1)-methyltransferase; TIGRFAM:
FT                   tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93767"
FT                   /db_xref="GOA:C7MLG1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG1"
FT                   /protein_id="ACU93767.1"
FT                   /translation="MIIETLSTFPAMYDSVMGTSMMRIAQEQGALDFRAFDLRDWTHDR
FT                   HRTTDDSPYGGGQGLVMKCEPIFEAFDEIVAAREMKPYTVFLTPTGEAFTQAVAQELSE
FT                   KPRLLFVCGHYEGIDERAYTLADRCLSLGDYVLTSGELASMVVIDAVVRLLPGVLGDEG
FT                   SAIDESFYDGLLEYPQYTRPAEFRGMEVPPILCSGDHAKVATWRRQQSLKRTAHLRSDL
FT                   LAQANLSEADRAFLKSLSTEAGSSSETVS"
FT   gene            46461..47036
FT                   /locus_tag="Ccur_00350"
FT   CDS_pept        46461..47036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00350"
FT                   /product="signal peptidase I"
FT                   /note="PFAM: Peptidase S24-like; Peptidase S26; TIGRFAM:
FT                   signal peptidase I, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93768"
FT                   /db_xref="GOA:C7MLG2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG2"
FT                   /protein_id="ACU93768.1"
FT                   /translation="MSSARRATSSRKRGGFIRDAIEYIVLLVVVFAVFWAGRVFVVEPY
FT                   SIPSGSMETTLMINDCVFSEKVSYHLRDVQQGDIVTFADPEVEGRTLIKRVIATEGQTV
FT                   DLVNGAVSVDGQVLDEPYTHGLPSEELTPARNVQISYPYTVPAGYVWVMGDNRTNSADS
FT                   RYFGAVPTSNITGRAAAIYWPLNRIATL"
FT   gene            47077..48198
FT                   /locus_tag="Ccur_00360"
FT   CDS_pept        47077..48198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00360"
FT                   /product="glycyl-tRNA synthetase, tetrameric type, alpha
FT                   subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: Glycyl-tRNA synthetase alpha subunit; TIGRFAM:
FT                   glycyl-tRNA synthetase, tetrameric type, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93769"
FT                   /db_xref="GOA:C7MLG3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG3"
FT                   /protein_id="ACU93769.1"
FT                   /translation="MESTLTSEQSQRHLHGSQEGVRTFQDIIMSLQQYWADQGCVVLQP
FT                   YDGAVGAGTNHTATTLRSLGPDTWRTCYAQGCRRPADGRYGENPNRLQFYYQFQVLMKP
FT                   SPDNIQDLYLGSLNAIGIDPNKHDVRFVEDDWESPTLGAWGLGWEVWLNGMEVTQFTYF
FT                   QQVGGFECAPVPVEIAYGLERLAMYIQGVDSVYDLIWARGDDGVEFTYGDVYLENEREF
FT                   SEYNFEIANTKFLFTAFDDFEQEAKLCLEARLPLPAYDWVLKCNHVFNLLDARGVISAT
FT                   ERMAYILRVRSMVKECCSAYIDRVVGGAASGKANSGVVDGASDGAKVNASSLGRGNANP
FT                   SGSGETSTGSRDNTSANSATKNNARTNSTVQGE"
FT   gene            48203..50287
FT                   /locus_tag="Ccur_00370"
FT   CDS_pept        48203..50287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00370"
FT                   /product="glycyl-tRNA synthetase, tetrameric type, beta
FT                   subunit"
FT                   /note="PFAM: DALR anticodon binding domain; Glycyl-tRNA
FT                   synthetase beta subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   tetrameric type, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93770"
FT                   /db_xref="GOA:C7MLG4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG4"
FT                   /protein_id="ACU93770.1"
FT                   /translation="MAEMHTLAFEIGVEEIPAFDLDSATKQLERLAPAAFEGARIPFDR
FT                   IEVFSSPRRLIVMAYGLPEATEELMEKYKGPAARIAFDEAGQPTKAAIGFARGKGLTPD
FT                   DLERRLVKDVEYVFAVKQIPAVPVISLLPAILQGFIEDIKWPRSQRWAAYREVFVRPVR
FT                   WIVALFDDQVIPLQFAGVSTGRDTWGHRVLAPGAHRVNEATDLIKVVRAASVVPSQSER
FT                   EQIIRDDVAAIEHTYDLVADLPAKTLLEVVNLSEFPQPLAATFDESFLQVPQEIIIDAM
FT                   LMHQRYFPLYDKKGALTNRFVIVSNGNPACQETIISGNERVVRARLDDAKFFYEEDLKQ
FT                   PLESYVEKLSSVVFQEDLGTVLDKTKRLVRQATHLAADAKLSKADARDLERACYLCKAD
FT                   LVTNTVVEFTSVQGVMGGYYALASGETEQVAQAISQHYRPRFASDTAPDSVVGQFVAFA
FT                   DKLDTVCGLIAVGQAPTGSSDPFALRRSAIGIIGMLDAGLPVSLLPAIDCALDALMADG
FT                   ISFNRTTAREAISDFFIARTKVILRDEGLPIDAVNAVLAAGVTEPALIAARTRALAAAR
FT                   ASSPETMTDLATAFARADNLRDASLGSKTDTSLFTPEEADLQAAIDAVTAAIPDLLNQG
FT                   DYVRALEKLASLRAPIDTFFEAVMVMDKDQTLRENRLRLLNRFVSTFKDVADFGELASS
FT                   "
FT   gene            50284..51159
FT                   /locus_tag="Ccur_00380"
FT   CDS_pept        50284..51159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00380"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF299)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93771"
FT                   /db_xref="GOA:C7MLG5"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG5"
FT                   /protein_id="ACU93771.1"
FT                   /translation="MIPTINIISDSVGTTAQAIARAAASQFGETEPIIELLPNVRTFEE
FT                   VETFLQKRLDETRRRTGSPEMIVFYTIVEAEVTRQLKEYLAFHPEIHAVDLITDAVDAI
FT                   SQVSGREPMVVPGELHITDERYFHRIEAIEYTIAHDDGRNPQDLPSADIVLLGVSRCGK
FT                   TPTSIYLAQEGYRVSNVPLDLVSAPPAEIHKVDPSRLFGLVTTPDVLVDIRRRRLGNAL
FT                   AVAGDYADREKVEQDLEKARSLMRQLGCFVIHTENRAVEETAQEIMRYYEVAHPRKGSL
FT                   RGEGDLQTVE"
FT   gene            51169..53880
FT                   /locus_tag="Ccur_00390"
FT   CDS_pept        51169..53880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00390"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="PFAM: PEP-utilising enzyme, mobile domain; Pyruvate
FT                   phosphate dikinase, PEP/pyruvate binding domain;
FT                   PEP-utilising enzyme, TIM barrel domain; TIGRFAM: pyruvate,
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93772"
FT                   /db_xref="GOA:C7MLG6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG6"
FT                   /protein_id="ACU93772.1"
FT                   /translation="MAEEVKRVFAFGKDANGNNVTEGNTSMKAVLGGKGANLAEMANIG
FT                   LPVPPGFTISCQTCMEYANAGNVWPEGVLDVIHEYRSDLEARAGKKIGDAQDPLLVSVR
FT                   SGAPISMPGMMDTVLNLGLNDESINGLIVQTENPRFAWDSYRRFIQMFSNVVMGLDGDL
FT                   FENAISMKKNLRGVRSDTDLTADDLQELVEEFKRIFAENVDAAAYPDLAHNGVATFPQD
FT                   PTVQLKLAIEAVFGSWKNPRAVLYRQKNKIDDNMGTAVNVQCMVFGNKGDTSATGVAFT
FT                   RNAATGEKEFYGDYLVNAQGEDVVAGIRNTSPIAELKHTPGLEEAGRELEEVFVLLEQH
FT                   FRDMMDIEFTIEQGKLFMLQTRVGKRTAAAALRIAIDMEKEGLITKEEALKRVEPEQLD
FT                   QLLHPQFDKNASYDVLARGLNASPGAAVGEIVFSSADAVAVSEAGRKCVLVRWETNPDD
FT                   LAGMIAAEGILTSHGGKTSHAAVIARGMGAPCVCGVDALKIDAEKKEITVAGSDVVLHE
FT                   GDMISIDGTTGTVVSGAVELVMPELTGDLDTILEWADEVRVLGVRANADNPEDAQLSRD
FT                   FGAEGIGLCRTEHMFLGDRKQLIQQFILNDDEDIRTECVHKLGELQTGDFLGMFRAMDG
FT                   LPVIVRLLDPPLHEFLENPRALDVEIAHMEEQGASAESVAEKRALMAQIDSWAEANPML
FT                   GLRGCRLSILFPQLPDMQVRAIATAAAALKKEGLDPHPEIMIPLVSFESEIESLRAKAE
FT                   AVIAEVEAEQGVQLEIPIGTMIELPRAALIADQIARHADFFSFGTNDLTQTTLGFSRDD
FT                   AEAKFLPRYLEEHLLKRNPFATIDDGVAELVRMGCEKGCSANPKLACGVCGEHGGDPES
FT                   IMKFAQVGPDYVSCSPYRVPIARLAAAQAALV"
FT   gene            54298..55869
FT                   /locus_tag="Ccur_00400"
FT   CDS_pept        54298..55869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00400"
FT                   /product="amino acid carrier protein"
FT                   /note="PFAM: Sodium:alanine symporter family; TIGRFAM:
FT                   amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93773"
FT                   /db_xref="GOA:C7MLG7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG7"
FT                   /protein_id="ACU93773.1"
FT                   /translation="MDMKFLVDLSGQIDTFMYTYILIIMLVASGVLFTIRTKGVQIRLF
FT                   KDMIKSITEQKYNEGEKTTSSFQALMISTASRVGTGNIAGVSTAIAFGGPGALFWMWIM
FT                   ATVGSASAFIESTLAQIFKVKNEDGSFRGGPAYYIQQGIGKRWLGVVFALALIVCFAYG
FT                   FNALQAYNASSTLEVYMPDYFKSDVVVAVALFLAAFTAICIFGGGSRISFFTSIIVPVM
FT                   AFSYLAIALVITFMHISAVPAVFGLIFSSAFDFRSFAGGFAGSVVSWGIKRGLYSNEAG
FT                   MGSSPNAAAAASVSHPVKQGLVQTLSVFIDTMIICTCTGMMVLVFYVGSNLETMVDPIT
FT                   NVTSFVNPQTGAILTGMPLIQEALRYSLGDFGVNFVTFSIFLFAFSSLLGNYYYAESNM
FT                   RFIKDNRIVVFIFRITCIIAVFWGAQAGFDLVWNFADIAMGFQAFVNLVALFLLGGWAV
FT                   KALRDYESQSQKGENPVFLAASIPGLPKTECWHETAEELAADAARGTLAADAKMKHQVV
FT                   ELLNDK"
FT   gene            complement(56933..57535)
FT                   /locus_tag="Ccur_00410"
FT   CDS_pept        complement(56933..57535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00410"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93774"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG8"
FT                   /protein_id="ACU93774.1"
FT                   /translation="MSDSTSQSKFDEIFEAIRRDEQNASYTAQGIDPLYSAHAEARIVI
FT                   VGQAPGRIAQDTHMVWNDRSGDRLRDWLGIDRETFYTSDKLAIMPMDFYFPGTGKSGDL
FT                   PPRKGFADKWHPALLALMPHVELTVLVGNYATHAYLHLKSSAKLTDIVHNYQRYLPERL
FT                   PLVHPSPRNQIWMKKNPWFGAEVLPELQKRVAHIMNE"
FT   gene            57883..58230
FT                   /locus_tag="Ccur_00420"
FT   CDS_pept        57883..58230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00420"
FT                   /product="cupin domain-containing protein"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93775"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLG9"
FT                   /protein_id="ACU93775.1"
FT                   /translation="MAEMRVYTVSEVGKASEEQAVKTVFHNTDSTSSSVWVVKPGQEVV
FT                   CHLHSASDDVWVCTQGKALFHPEIGEDIEVTAGQVIVNPAGKCHGATNHGTEDFIFVSV
FT                   VAPVPSDYVAL"
FT   gene            58347..59252
FT                   /locus_tag="Ccur_00430"
FT   CDS_pept        58347..59252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93776"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH0"
FT                   /protein_id="ACU93776.1"
FT                   /translation="MNHPAAVMSRRAFVATGLLVASAAVGQIGCSHTSQAANIPDESGT
FT                   LAQLSWADIAAAAQAIAACGSRQEALEAARLYGLIDDAGRLDPSGSKNISLSDGRIAPT
FT                   QIIGVYADTATAGGSVGLTFAITEALDQRGINTDHVNTGGWEQSALRAWLANEGLALLP
FT                   DEVATSIIAVDKLTNNTGAAGDSSAVTVTSDRLWVPSLIELYGAADWFEGDQAWCNDIV
FT                   NAEGHQYQRFSDGGITASSSLSSEGILKATYKGKPCEWWTRTPRPSDNVYFAGVYRDGT
FT                   ANAIGYLGGYSAGAIACFCL"
FT   gene            complement(59386..60717)
FT                   /locus_tag="Ccur_00440"
FT   CDS_pept        complement(59386..60717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00440"
FT                   /product="Fe-S oxidoreductase, coproporphyrinogen III
FT                   oxidase"
FT                   /note="PFAM: HemN C-terminal region; Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93777"
FT                   /db_xref="GOA:C7MLH1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH1"
FT                   /protein_id="ACU93777.1"
FT                   /translation="MLAERLLTRIVKGMANCQLALKPTDESMMPPAETGRTYMLYMHVP
FT                   FCEVLCPYCSFNRYPFRPEIAGPYFASMRKEMLMLKGLGYDFESIYVGGGTPTVMIDEL
FT                   CETLDVARDNFHIKEVACETNPNHLTRPYLEKLQHRVQRLSVGVQSFDDTLLKQMDRYR
FT                   KYGSGQEILERIEEAHGYIDSLNVDMIFNFPSQTEEGLFADLEKIALCGARQVTFSPLY
FT                   ASNGTVAKMASKFGQLDYDREERFYHIIDGVLAGGEQPLFDRTTLWTFTRTDKNGAIND
FT                   PDHIDEYQTCYEDYPAIGSGSITHLNGALYVNTFSISDYNAAIEAGHMSIMGKTELSRR
FT                   DLMRYRFLLDLYKLRLDKRRFKADFGCSVEAGLPMEMAFMRLMGAFATDTSDELTLTPT
FT                   GRYLVVVIYRQFLSGMNNLREQAREALSGDEKILLFGDEEFSGA"
FT   gene            complement(60794..60949)
FT                   /locus_tag="Ccur_00450"
FT   CDS_pept        complement(60794..60949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93778"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH2"
FT                   /protein_id="ACU93778.1"
FT                   /translation="MLDQGKLIGIVTRSGLMHRILDAAAIKNKCLCYTDRTLDPGNIPR
FT                   ACADET"
FT   gene            complement(61126..62679)
FT                   /locus_tag="Ccur_00460"
FT   CDS_pept        complement(61126..62679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00460"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Family of unknown function (DUF438); Domain of
FT                   unknown function (DUF1858); Hemerythrin HHE cation binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93779"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH3"
FT                   /protein_id="ACU93779.1"
FT                   /translation="MKKMSLDMTVHDLCEEFPEAINIMANLGFPEIVEKDRRDTVGRMM
FT                   TPAKGAMVKDVPIETMVAAFQEAGFVVEGFENGTENSNDLSSSNNSSDSETGTENAADI
FT                   DAHRVDVIKNLLNKLQTGASVDEVKADFAREFDGVAATEVSKAEQALMAEGVPVNDVQR
FT                   LCDVHAAALGEHVEAAEGTPEVVDIPGHPVHSLLAENAALTAYLNNTLKPAIESVRSGA
FT                   ADAASLVEGLRTIRQVSVHYRRKENLMFPLLEKHDITGPSKVMWGKDDEVRDAIDQATE
FT                   LASTDNADKAAVATAADAAVEGVEGMIYKEENILIPMMAEQFDTMEWMAVAEDEPDIGF
FT                   VFIDTPQKWVPSMNDLLAATAKHEAQRAAGEVEEKPEVSADYIKLPTGSFNAQELAAML
FT                   NTLPLEITFVDKDDIVRYFSHGDNRTFARPIASLGNNVMTCHPPKNQEMVKNIFDSFKD
FT                   GSEDHYDFWMHMGPKFVYVRYFAVRNRAGEYLGALEVTQDIAPIQALEGENRRGENQPD
FT                   "
FT   gene            62764..62925
FT                   /locus_tag="Ccur_00470"
FT   CDS_pept        62764..62925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93780"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH4"
FT                   /protein_id="ACU93780.1"
FT                   /translation="MTGKYVANTTLALVSSNCEDIEVFLKDKTLVADFFWGRIDKYVEI
FT                   ADSLFVSL"
FT   gene            complement(63325..65145)
FT                   /locus_tag="Ccur_00480"
FT   CDS_pept        complement(63325..65145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00480"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93781"
FT                   /db_xref="GOA:C7MLH5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH5"
FT                   /protein_id="ACU93781.1"
FT                   /translation="MNTTVIMHLNQTIIASLKPTSASLGYALFLAVNATGIWGGVFPFL
FT                   PISIQTSEIMFWFYLAQSTMLLVTFSVAARGAYFAPRAKTGTQVIGASLIYFAGWALLI
FT                   GVMYLHDWAFPLVVASGVFLGTGSALFYLLWQRLFASQQQEMGQRDLIVGFMCSAVFYF
FT                   GLYLIPRAVTVYLVPLVFLPLISLALILGNRTIDFSQPMFSDIPRENLRVYRRAVKNMW
FT                   RSALCMGAIAFCTGIVRSLAINQPEVGLYVNLLSIAALFAAAGAVFFLWQAKGLRLNII
FT                   KLYQIVFPVLISTFLILMFAPGFYAHWLASGLFALYSVGLMLTMLQCTQMSRDRGVTPF
FT                   FVFGLFGGIIYALHDLGFIIGSFSDSFTALGFNAQETAAIVAIYLLALMFFIGSVSFKN
FT                   ARSQFFYGDTIELISASLPVEQMSGQLNNSGAPYSSYQKGKKGFGPSASKPSVPRPSVF
FT                   EPSMEINSEQTKDGSLRHTALDTTFDTRSDAASSGRSLEERLGKPSESLDKSLGGPFRN
FT                   PFRNPLRDSLEEGDWKDLLSKRVSALQQVYRLSDREAEVTDLIVHGYTVPRIAETLFVS
FT                   ENTVRTHTKRIYTKLDIHKKQELIELVEQF"
FT   gene            65318..67756
FT                   /locus_tag="Ccur_00490"
FT   CDS_pept        65318..67756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00490"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="PFAM: Molybdopterin oxidoreductase Fe4S4 domain; TAT
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   Molybdopterin oxidoreductase; Molydopterin dinucleotide
FT                   binding domain; TIGRFAM: molybdopterin guanine
FT                   dinucleotide-containing S/N-oxide reductases; Tat
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   anaerobic dimethyl sulfoxide reductase, A subunit,
FT                   DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93782"
FT                   /db_xref="GOA:C7MLH6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH6"
FT                   /protein_id="ACU93782.1"
FT                   /translation="MLMPQTSMSRRGFIKASGALAALAAAGEGAALAGGGFVAEAAQEA
FT                   NEETIAWSQCNVNCGGNCIFQWHVRDGKVLYMETDNTGNSDLQARACLRGRSMRKWLNH
FT                   PDRLLYPMKRVGKRGEGKFERISWDEAIQIIHDNMERIYANYGPNSVFINYATGMYSTT
FT                   GRNPSKRLLSLLGGFVNQGADYSTHMMQVVMPYMFGSDKTKGSIYSPYDNINASSFTEA
FT                   EAHSDLIVMFGNSPAETRMGGANATWDFAKVREAVYARGGKVVNIDYRLNETSSAHADE
FT                   WLPIRTGTDTALCCALVHEFIVDGKTDEEFLVRYCVGWDEDTLPESAQGQNLSYKAYIM
FT                   GEGYDHIAKTPEWAAEITQIPAEKIRELARDLEKAEAPFVVQGWGPQRHTNGEQTSRAI
FT                   SMVPIALGKIGLPGTNTGQREAEPPVYLVSALPFKNPVTTTLPVYQFINAIDHGHKMTA
FT                   TNAGITGADALGVDIKCLWNYAGNCLTNQHGDINYTHEVLIDENKCEFILVWDTVMTDS
FT                   AKYADLLLPDAMRSEQLNMQTQGYSEYYTGVTVGGPAQEAPGECRIHYDVCADIAETFG
FT                   LRDEFTEGRTQEDWIRFLYEQGREKHPEMPTWEQILKQGVYKTKPDQAIGLKDFRDDPI
FT                   AHPLGTPSGKIEIYSESLAKLNETWELEEGDKIFAIPEFDSGFQGYGAATDEYPLYCSG
FT                   FHHKSRTHSSFGFIEELEQAARQQMWINPVDAEPRGIAMGDICAVKSPAGEIRIEARVT
FT                   NRIIPGTVGIPQGAWHKADMQGDRVDKGGCINTLTTYRPTPLAKGNGNAHSIIVQVTKA
FT                   "
FT   gene            67772..68392
FT                   /locus_tag="Ccur_00500"
FT   CDS_pept        67772..68392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00500"
FT                   /product="Fe-S-cluster-containing hydrogenase subunit"
FT                   /note="PFAM: 4Fe-4S binding domain; TIGRFAM: DMSO
FT                   reductase, iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93783"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH7"
FT                   /protein_id="ACU93783.1"
FT                   /translation="MTQYAFYFDSARCTGCKTCELACKDYQNLDKNTAYRHVFDYEGGS
FT                   WTINADGTCQTNAFVYHVSVSCNHCDNPACTGVCPTGAMHKNPETGLVSVNTDKCIGCG
FT                   YCHMACPYNAPKVDRALGHSVKCDGCASRVEAGLNPICVDACPLRALKFGSVSEMAALG
FT                   EQANIAPLPESHYTHPHLYIKVNENAKAPGSAEGSVANVMEVL"
FT   gene            68394..69257
FT                   /locus_tag="Ccur_00510"
FT   CDS_pept        68394..69257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00510"
FT                   /product="DMSO reductase anchor subunit"
FT                   /note="PFAM: DMSO reductase anchor subunit (DmsC)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93784"
FT                   /db_xref="GOA:C7MLH8"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH8"
FT                   /protein_id="ACU93784.1"
FT                   /translation="METAFAELPLAIFTTLASIGAGSFIVLACVLWRRNMSSTQMKALD
FT                   RAMLVPFMVAGVGFVASFLHLTAPLHAVYVFSGMGSSPLTNEICCGIVFMAAAFLYLVL
FT                   ALIGKLGNARKPFALIVAVLATVFVIFVGLAYIVPTIVSWNTALVPAEMLGYALVGGTA
FT                   LMVCVAQYAGVLDEETRTVLKMPLVILVVCGLVLALAAPITHIAIINGLGNAVSQGSAL
FT                   VSEVLPYVLVGLVLIALSAVELLWGIAKGFTPARGLRSTLEALVGIFLLRLTFYALYLS
FT                   IGVTLM"
FT   gene            69503..70141
FT                   /locus_tag="Ccur_00520"
FT   CDS_pept        69503..70141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00520"
FT                   /product="uncharacterized component of anaerobic
FT                   dehydrogenase"
FT                   /note="PFAM: Cytoplasmic chaperone TorD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93785"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLH9"
FT                   /protein_id="ACU93785.1"
FT                   /translation="MSVLEQSVLEQIAFIGNTLSPLFLYDPLAKETADLYEALRQVDVH
FT                   TAAADWPFGNTLAIEHGLHLMQVGINAGREELSHEFQRLFVGPETKAVPPWGSVYTDHD
FT                   RILFGETALDLHDWMSKNTIRATVDDHMPDDHVGRMLALLAWIAQQRPSLLEEYLQDHF
FT                   LTWIPHFLSVLDDRTRSDFYHGLSVLTQESIEGIGQALSVQVVEPRFFR"
FT   gene            70166..71218
FT                   /locus_tag="Ccur_00530"
FT   CDS_pept        70166..71218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00530"
FT                   /product="DMSO reductase anchor subunit"
FT                   /note="PFAM: DMSO reductase anchor subunit (DmsC)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93786"
FT                   /db_xref="GOA:C7MLI0"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI0"
FT                   /protein_id="ACU93786.1"
FT                   /translation="MSGVQIAWANALSESTLVFFTTLAPSAAFAYLALLILLFRSGIDT
FT                   VIHEQIHHLLWAPLVLCMIGLIASATHLGNPSNALYVLMRVGSSPLSNEVFAAGAFLGM
FT                   AAVFWLASFSIQKYYLVERIAMVCIIASGICFIAAISCAYHVETIVTWSMPLMPATIAC
FT                   SSAMGGPLLALCCLQATDPFPSKVPFAKGLAVVSFGATVAWLSMQTAIGLALPGIANEL
FT                   FTASELVPMFWPALVLSGVLCLAGSVSPFVVARRLGWDVSKAYPAGHKSVKQKSIEQNA
FT                   EQKRAIQESARQKITAQEPAEQKVAGQESVGRELSARYWLIGASVSMLIGIFIMRFMFY
FT                   MMHMTVGVAV"
FT   gene            complement(71345..71599)
FT                   /locus_tag="Ccur_00540"
FT   CDS_pept        complement(71345..71599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93787"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI1"
FT                   /protein_id="ACU93787.1"
FT                   /translation="MSSAGSALHKEHLIVPFDSTTDALALQACAQRYGLVGRLIPIPRT
FT                   LSAGCGMAWKEPVAHRSLLEATLAAENLEHSAIVQMRLR"
FT   gene            complement(71620..71826)
FT                   /locus_tag="Ccur_00550"
FT   CDS_pept        complement(71620..71826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00550"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /note="PFAM: SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93788"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI2"
FT                   /protein_id="ACU93788.1"
FT                   /translation="MKQLDARGLSCPEPVLLTLEALKETPQEPLQVLVSSSTSRVNVCD
FT                   AVKRKGHQTSVERDGDDYVITIS"
FT   gene            complement(71916..73061)
FT                   /locus_tag="Ccur_00560"
FT   CDS_pept        complement(71916..73061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93789"
FT                   /db_xref="GOA:C7MLI3"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR026366"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI3"
FT                   /protein_id="ACU93789.1"
FT                   /translation="MESLNSKKGLALVGVVVGLLIAVLAATGNPGNMAICAACFIRDMA
FT                   GSLKLHTAAPVQYFRPEIVGFVAGAFLIALATREYRSTAGSSPMVRFILGFIMMIGALI
FT                   FLGCPLRMVIRMSAGDLNAWVGLVGLVAGVATGAVFLKRGFSLGREHDTNKAAGTVLPI
FT                   ALVVLLIISLTLTVMAVSESGPGSKHAPWIISLAVALVIGALAQKTRICFIGGVRNVIL
FT                   MRDFSLLIPIVGLFAVMAIYNVATGGFKLSFDGQPIAHAQHLWNILGLYAVGFAGTLAG
FT                   GCPLRQMILAGQGSCDGAMTFLGMLIGAAFAHNFGLAGAAAAAATADTPAVAGGPSLAG
FT                   QVVLVAGIAVLFVIAFTNQKKKKAAAAKATPAVSAPVASEA"
FT   gene            complement(73466..74122)
FT                   /locus_tag="Ccur_00570"
FT   CDS_pept        complement(73466..74122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00570"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93790"
FT                   /db_xref="GOA:C7MLI4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI4"
FT                   /protein_id="ACU93790.1"
FT                   /translation="MQNERRKQDRRVVRTRAAIRTAFLSLARTQQPDKISVTALARAAD
FT                   IDRKTFYLHYDSIDSLIDELLYEESQRIADILREGSIDGDGHIDVNKMYALLSTELASG
FT                   LDERALILGHMDMFQVLRRIEPIMVSVIIENDSLHLGHSLGKHLEYFVSFFCAGLLSVY
FT                   RHWMETDSEIPMDELADMVSVLVLSGLEGALTKEKTARKDLRSQAEIKQESASTR"
FT   gene            74347..75780
FT                   /locus_tag="Ccur_00580"
FT   CDS_pept        74347..75780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00580"
FT                   /product="predicted Fe-S oxidoreductase"
FT                   /note="PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93791"
FT                   /db_xref="GOA:C7MLI5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI5"
FT                   /protein_id="ACU93791.1"
FT                   /translation="MKAIDQIKRAGLMKTVDYLLEDPEARATKIMDMIDKVAPANLFPS
FT                   QRLAFRDAIEQKSDWYQLIMKIADLNPAMRDTFIKNFLVDGNLMAWGRQEEMREKYQCN
FT                   IPWAILLDPTSACNLHCIGCWAADYGHKLNLSYEDIDSIINQGVDLGVHIYIYTGGEPL
FT                   VRKRDLMRLCEEHQDCTFLCFTNATLIDEDFCQDLLRVKNFVPAISAEGFEETTDARRG
FT                   EGVYQRIVDAMALLKEHGLPFGISACLTSQNTESVGSEEYFDWLIDQGALFCWVFTYMP
FT                   VGVDSDISLMPTVTQRRRMYDFIRAMRKTKPLFTLDFQNDGEYVGGCIAGGRRYLHINA
FT                   AGDVEPCVFIHYSNVNIHDVSLLEALRSPLFMEYYEGQPFNNNLLRPCPMLENPDCLPA
FT                   MVERAGAHSTDLQAQETADELCAKCHSFAEKWAPAADDMWNNESDPEFERRQDPYKGMS
FT                   ESDISKFNRLAQQRAGKSA"
FT   gene            75946..76977
FT                   /locus_tag="Ccur_00590"
FT   CDS_pept        75946..76977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00590"
FT                   /product="predicted phosphohydrolase"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93792"
FT                   /db_xref="GOA:C7MLI6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI6"
FT                   /protein_id="ACU93792.1"
FT                   /translation="MARNISRRGFLKGLAAAAGVATIPVLANIDPLAFGWGPAPAYADE
FT                   VFNDPSQRGSLKSRFAVISDTHVTADNATYVNNLKQAFADLASIADQPEYIVVNGDLVN
FT                   DGTTEEYDLFMSLAANAGIKRSSLKMVMGNHEQSTDDYGNELYEQRRATFMQYAGTSSV
FT                   YYDTEVSSLHLIVVGPDLNPTNDWVNFKLSTDQLLWLDDLLQKDEDRGVVSYVFCHEPL
FT                   QNTVKDTRITQWGYNNSIENDSALAQVIDAHKNTVLFSGHTHAYPDVARSAEGRLYVGT
FT                   GSVAYAYPKGSSDTDASEAVESNGLMVSVYERCIRIQVRDFITGSWSDDLFYALPTTNA
FT                   SSK"
FT   gene            77004..77408
FT                   /locus_tag="Ccur_00600"
FT   CDS_pept        77004..77408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93793"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI7"
FT                   /protein_id="ACU93793.1"
FT                   /translation="MQHSITGFSATLFADRLHRAHFGIELRLIFASDCASGSQENSGQT
FT                   TEEGSMCQNGVNTGQYKMMLEQIDDQIAVNRRWAHKLAHLAGDNGYQKTDEVMHQVQEL
FT                   LDEARALMTDAKDALDEDAETLAGVTVNLV"
FT   gene            77571..77993
FT                   /locus_tag="Ccur_00610"
FT   CDS_pept        77571..77993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00610"
FT                   /product="predicted transcriptional regulator with
FT                   CopG/Arc/MetJ DNA-binding domain protein and metal-binding
FT                   domain protein"
FT                   /note="PFAM: Ribbon-helix-helix protein, copG family; NikR
FT                   C terminal nickel binding domain; TIGRFAM:
FT                   nickel-responsive transcriptional regulator NikR"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93794"
FT                   /db_xref="GOA:C7MLI8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI8"
FT                   /protein_id="ACU93794.1"
FT                   /translation="MPHDLMRFSVAMPEDLLIEFDQLVARRGLSKNRSEVIRDLVREAL
FT                   VEAECATPGCEVMGTLTIVFNHHANDLRDRLDDIQHHYVENIISSTHVHLDEHSCLEVI
FT                   IMRGETGLVQGISDMILGTKGVKTGRLVLTTTGKFI"
FT   gene            78181..79203
FT                   /locus_tag="Ccur_00620"
FT   CDS_pept        78181..79203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00620"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="PFAM: AIR synthase related protein, C-terminal
FT                   domain; AIR synthase related protein, N-terminal domain;
FT                   TIGRFAM: hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93795"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLI9"
FT                   /protein_id="ACU93795.1"
FT                   /translation="MDETVLLGHGSGGSMMRRIIDQVFMEAYGSDELAQGNDAANLPLP
FT                   ASGERLAYSTDSFVVTPCFFPGGDIGHLAVCGTVNDVATAGARPVYLSSAFILEEGFPV
FT                   ADLKRICASMAQTAREAGVRIVTGDTKVVNRGHGDGVYINTSGIGFIPQGRALGGDKCQ
FT                   PGDKILVSGTLGDHGITIMSCREQLSFKADLRSDAAPLNHLIEDVLKAAPNTRCFRDPT
FT                   RGGLASTANELAEQSGVDMVIDEDAVPVKDMVRGACDMLGYDVLQVANEGKMVCVVPPD
FT                   EADAACEAMRANKYGIDAAIIGEVRLSNAARGSRVTVRTAFGSERILDMLVGEQLPRIC
FT                   "
FT   gene            complement(79236..79358)
FT                   /locus_tag="Ccur_00630"
FT   CDS_pept        complement(79236..79358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93796"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ0"
FT                   /protein_id="ACU93796.1"
FT                   /translation="MGLLLPYFLVYGFLYEPALVKSWFLPLRKIPCAQFDATGI"
FT   gene            79357..79545
FT                   /locus_tag="Ccur_00640"
FT   CDS_pept        79357..79545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00640"
FT                   /product="dissimilatory sulfite reductase (desulfoviridin),
FT                   alpha/beta subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93797"
FT                   /db_xref="GOA:C7MLJ1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ1"
FT                   /protein_id="ACU93797.1"
FT                   /translation="MAHPIISEEECIGCGICVDACPQEVLEVIGGIAATENEDACIACG
FT                   DCLEECPMAAITEIVED"
FT   gene            79917..81845
FT                   /locus_tag="Ccur_00650"
FT   CDS_pept        79917..81845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00650"
FT                   /product="chaperone protein DnaK"
FT                   /note="PFAM: Hsp70 protein; TIGRFAM: chaperone protein
FT                   DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93798"
FT                   /db_xref="GOA:C7MLJ2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ2"
FT                   /protein_id="ACU93798.1"
FT                   /translation="MAKIIGIDLGTTNSAMAVMEGSEPEILVNAEGDRTTPSVVGFRKD
FT                   GERVVGKAAKNQAVTNPTNTVSSVKRFIGRSFAETAEERKTVSYTVKDGKDGRAVIDID
FT                   GKDYMPEEISAMVLQKLKNDAEKQVGSPITQAVITVPAYFNDAQRQATKDAGKIAGLEV
FT                   MRIINEPTAAALAYGLDKTNKDEKVLVFDLGGGTFDVSVLELGDGVFEVCSTAGDNHLG
FT                   GDDWDQRVIDWMADKFKTDNGIDLREDKMALQRLKEAAEKAKIELSSTTQTNINLPFIT
FT                   ADATGPKHLDYTLTRAEFERITHDLLERCKQPVQRALSDAGLSTGDVNEVLLVGGSSRM
FT                   PAVQELVKTVTGKQPNMSVNPDEVVAMGAAVQGGVLAGDVEGILLLDVTPLSLGVETMG
FT                   GVMTKMIDRNTTIPTRKTEVYSTAADNQTSVEIHVLQGEREMAADNKTLGKFQLTGIPA
FT                   ARRGVPQIEVTFDIDANGIVNVSAKDLGTGKQQQITISGSTALSDDEVDRMVKDAESHA
FT                   EEDKKRKEEVEVRNNCDSLVNATEQTLSELGDKVPEDTKKLAEEALSEAKSALAGTDAD
FT                   AIKAATEKLQQAGYKLSEVVYSQNAAQPGADAAGAAGAAAQAGQAAGDDTIEADYEVVD
FT                   DNKNDGK"
FT   gene            81851..82597
FT                   /locus_tag="Ccur_00660"
FT   CDS_pept        81851..82597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00660"
FT                   /product="molecular chaperone GrpE (heat shock protein)"
FT                   /note="PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93799"
FT                   /db_xref="GOA:C7MLJ3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ3"
FT                   /protein_id="ACU93799.1"
FT                   /translation="MRGAKDFTDNVSETAESARSGSADAEAQTANMHAATASDTAADTA
FT                   ADTEVDVPIDGEPTVSEGTDSMPGNNSAVEGASEAAGDDLAAAQAQAAAWQDKFMRLHA
FT                   EWDTYRRRMNEQRDDERKRATEKLVGDLLPVLDDFERSIDYAQNNGEGDLLDGVQKVHT
FT                   KLVDVLVKCGVEVIDPVGEAFNALEAQAVATVERTDIFDETVQDVYQKGYKMGRKVIRP
FT                   AMVTVTSGGPKREKEDPLEETEDFSK"
FT   gene            82681..83646
FT                   /locus_tag="Ccur_00670"
FT   CDS_pept        82681..83646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00670"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain protein"
FT                   /note="PFAM: DnaJ domain; DnaJ C terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93800"
FT                   /db_xref="GOA:C7MLJ4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ4"
FT                   /protein_id="ACU93800.1"
FT                   /translation="MPQTTPDYYKTLGVPRSATSDEIKKAFRKLARKLHPDAGGDETKF
FT                   KELNEAYEVLSDEKKRALYDQYGTAKESEIPSGWGGGFGGNGGYTVNVNGADFGGSWAD
FT                   ILESIRRGEGAFGTDWGFGDFGQGTRSRVQRPRRGRDVNVTLQVTFNEAFNGAEKRVSV
FT                   KVPGASNPEQVSCKIPAGAVDGGRIRAKGRGGFGEAGGARGDLLITTRIKPDSLYTRDG
FT                   ADVLMDVPVSIDEAALGAQVDVPLPQGKKVRLKIPAGTQDGTVLTLRGEGALRLKGSGS
FT                   GDVRATIRVRIPRSLNDKQKAALEAFAQARKGSNEKVRSW"
FT   gene            83643..84035
FT                   /locus_tag="Ccur_00680"
FT   CDS_pept        83643..84035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00680"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93801"
FT                   /db_xref="GOA:C7MLJ5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ5"
FT                   /protein_id="ACU93801.1"
FT                   /translation="MRDDRNEPLYMISVAAKLAGVHPQTLRSYEQKGLVTPQRTSGNTR
FT                   MYSQADIDRLELINELTDEGINLTGVIRIMDLEGRIEERDRELDALHRKVRRLADRVHE
FT                   LETRESITSLVAVRSTALRRLPSRLD"
FT   gene            84276..86891
FT                   /locus_tag="Ccur_00690"
FT   CDS_pept        84276..86891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00690"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); C-terminal, D2-small domain, of ClpB
FT                   protein; ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93802"
FT                   /db_xref="GOA:C7MLJ6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ6"
FT                   /protein_id="ACU93802.1"
FT                   /translation="MRLDKLAITAQEALQVAMGIAGEHDNPTVEPIHLLAALIDSNENN
FT                   LEAIIKRIGADAAQLRTLVSDEVEKLPHTQGSMSVPSNALLQVLDRAVKAAEKLGDSYA
FT                   TSEHVLIALSEDKGAAGRILSGQGVTRKNIEEAYEELRGDTRVTEADQKAEFEALEKYG
FT                   QNLTQQAREGKLDPVIGRSEEIRRTVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIV
FT                   AGDVPTSLRDRDIIALDLGSMMAGAKYRGEFEDRLKAVLREVKDAEGRIILFIDELHTI
FT                   VGAGSTGDSSLDAGNMLKPALARGELHAIGATTLDEYHKYIEKDAALERRFQPVIVGEP
FT                   TVEDTIAILRGLKEKYEIHHGVRITDNALVAAAELSNRYISDRFLPDKAIDLMDEAASR
FT                   LRIEIDSMPEEVDLASRKLTQMQIEEQALMKEGDAASKERLAALQQEIASAQEDLDKRK
FT                   AEWKNEKDVIVRVQELKSELEAAQSEEERATREGDLSRASELRYARIPELKNQLADAET
FT                   ELNAKQQDGAILKEEVSEEEIAEVVSTWTGIPVSKMMQGEMAKLADLEDRLHERVVGQD
FT                   EAVSAVAGAIRRNRAGLSDPDRPIGSFLFLGPTGVGKTELAKALAEYLFDTERAMVRID
FT                   MSEYMEKFSVQRLIGAPPGYVGYDEGGQLTEAVRRRPYSVILLDEIEKAHPDVFNILLQ
FT                   VLDDGRLTDGQGRVVSFKNAIIIMTSNVGSQFIREFAENGDEKQMREAIDDALRQTFRP
FT                   EFINRIDDVVVFNSLSFNAIEPIVDLQLEDVRDRLAQRRIQLEVKPDAMQQLALDGYDP
FT                   VFGARPLKRLIQKEIVDRVANEIVRGHVLDGSKVVISLDDELHYHCTVEEPAGQPELGV
FT                   "
FT   gene            87090..87560
FT                   /locus_tag="Ccur_00700"
FT   CDS_pept        87090..87560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00700"
FT                   /product="deoxycytidylate deaminase"
FT                   /note="PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93803"
FT                   /db_xref="GOA:C7MLJ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ7"
FT                   /protein_id="ACU93803.1"
FT                   /translation="MPDKRDNVITWDQFFMGVAIAASQRSKDPHTQVGACIADTNHRIL
FT                   SVGYNGTPSALNDDDFPWGASDDPLHDKHSYVVHAEANAVLNYRGSLKDMDGASAYVTL
FT                   FPCHECAKILVQAGIREVVYQDNKYEGTIDNQIAMRIFDDCGVSYRQVKTTY"
FT   gene            87779..87916
FT                   /locus_tag="Ccur_00710"
FT   CDS_pept        87779..87916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93804"
FT                   /db_xref="GOA:C7MLJ8"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ8"
FT                   /protein_id="ACU93804.1"
FT                   /translation="MLKTRVEQTKDAVTPLVGAVIMVLSIGCFIAFLEAILAIVRFAIG
FT                   "
FT   gene            87926..89458
FT                   /locus_tag="Ccur_00720"
FT   CDS_pept        87926..89458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00720"
FT                   /product="Trk-type K+ transport system, membrane component"
FT                   /note="PFAM: Cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93805"
FT                   /db_xref="GOA:C7MLJ9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLJ9"
FT                   /protein_id="ACU93805.1"
FT                   /translation="MWQRYTFYDLRVIAHYLGVLLVYTGAAMAVPLVTAAASSEWEPAA
FT                   RYLFSMGIALTVGSAMRMLRIEPGRLNRQQAIAVTSFAWIVVAAIAAIPLALSPHYQSY
FT                   LNALFDSVSSFTTTGVTIISNPDHISNADNMWRFISVYAGGAGLVVVAMSFGLFGRVAD
FT                   SSLYESEGRSEHVLPNVVQTARFILRFSLAVIVVASIVLAAICLLHGMQVPRALLHGFW
FT                   LAVSGYMTGGLTPMSTSITYYHSVMVEGVLMVLMLLGSVSFLLQSEVLRGRVQGYFRDI
FT                   EVRTAVVWIGIMLALFIVTLSSSTLMRSLPELARTGLFTFISAATTTGFSTLTSNQLTS
FT                   IMPSGALLILALVMSVGGASGSTAGGIKLKNIAIIGKSAFETLKGVASPDSARVVTTYY
FT                   HIGRRCLGAEEVKRAMTVFTMFVIMYIVGALVGVAHGYDAVSAITESVAMASNGGISTG
FT                   ITQASMPALLKIMYIAEMWAGRLEFITLLAVGVKICASLRARGLLGARKGRS"
FT   gene            89455..90078
FT                   /locus_tag="Ccur_00730"
FT   CDS_pept        89455..90078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93806"
FT                   /db_xref="GOA:C7MLK0"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK0"
FT                   /protein_id="ACU93806.1"
FT                   /translation="MRILRASIQVRRHFLQGAFLLVSFCIAAILFLSPSSAQARTDTTD
FT                   GNRVNPQQMPDSSFLYDTSIYDLLNADTSLNGSTVQVTGEVVGDAVSDTQDPGKVWITL
FT                   ASTDRSKEGSISVLIAQDDVDLIDTFGRYGAKGTTLRVKGTFYLSSPTYQGITDIQADT
FT                   VSVVSSGLDAAVPFNQMKFVPGFIMVGIGLALTGLYYLLRARQR"
FT   gene            90087..91154
FT                   /locus_tag="Ccur_00740"
FT   CDS_pept        90087..91154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00740"
FT                   /product="predicted GTPase"
FT                   /note="PFAM: Protein of unknown function, DUF258; TIGRFAM:
FT                   ribosome small subunit-dependent GTPase A; GTP-binding
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93807"
FT                   /db_xref="GOA:C7MLK1"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK1"
FT                   /protein_id="ACU93807.1"
FT                   /translation="MILKAQVVQLDRGFPLVRLASGDLIRCKHATSLVKEATQRAVIGD
FT                   WVKIETDDAADKAQIVEILPRQQVLLRKDPAERSMVQVLAANFDTVIIAHPLPGLNIRR
FT                   LERELVVACDTGARVVVALTKSDLVESDQVRTDAVAAVQAVVAPGIGVIEVSTVNQIGI
FT                   DAVRALVSTGTQAVLMGRSGAGKSSLINALADQEVQATQPVRAADGKGRHTTVNRTMVR
FT                   IQGGGEVIDMPGVRGLGLWDAQAGIDAAFPDVVEAARNCRFRDCRHQGDAGCGVGAAIK
FT                   AGNITPERVAAYVRLSEENSQQLKRNKEAQWQTGAGRSGRSRQPYSRDVARSSNARKNS
FT                   YKTARNSNARNSNAQ"
FT   gene            91315..92217
FT                   /locus_tag="Ccur_00750"
FT   CDS_pept        91315..92217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00750"
FT                   /product="predicted TIM-barrel fold metal-dependent
FT                   hydrolase"
FT                   /note="PFAM: Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93808"
FT                   /db_xref="GOA:C7MLK2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK2"
FT                   /protein_id="ACU93808.1"
FT                   /translation="MITAPDGTMYRAADAHVHIYKEKIAAKASQVIGDFYHADGYNFEM
FT                   WEPDPAPEVLLRKGKEIGIDRYAVFSAATAARQVDSINRFIADECARHPEFVGLGTAHP
FT                   DAIDPTLPDGRDCEALVEQIAALGLKGMKLHPDMQQFNIDDPRMMPLYRAAAQAGLVVL
FT                   FHVGDERHSFSDPVRLARVLEEIPDLRCHAAHLGCCRIWDRRPVALAASVLAGADIVFD
FT                   TSSMLAWAPADDVRFIIGQLGIDRIMWASDYPMWSPAEEFKLLLGLGYSSADNQRMLYD
FT                   NFARFYRIDDSIKNAVENA"
FT   gene            92257..92814
FT                   /locus_tag="Ccur_00760"
FT   CDS_pept        92257..92814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00760"
FT                   /product="putative NADPH-quinone reductase (modulator of
FT                   drug activity B)"
FT                   /note="PFAM: Flavodoxin-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93809"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK3"
FT                   /protein_id="ACU93809.1"
FT                   /translation="MANILIVSGHPDLAHDSVANVTIRQALQEKLPEAEFDDLGTLYPD
FT                   YQFDVASEQQKLERADIIVFQYPVFWYHFPALLQKWMEDVFLRGFSHGSTGDKLKGKKV
FT                   VVSLTTGAPAAFYEGAEAGFPLQILLAPLEATCNLTQMKLVGQVLTGDVSYASRNDAAA
FT                   KASMIERARAHASQLAELVRSI"
FT   gene            complement(93173..96961)
FT                   /locus_tag="Ccur_00770"
FT   CDS_pept        complement(93173..96961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00770"
FT                   /product="ATP-dependent exonuclase V beta subunit, helicase
FT                   and exonuclease domain-containing"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93810"
FT                   /db_xref="GOA:C7MLK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK4"
FT                   /protein_id="ACU93810.1"
FT                   /translation="MDLSRLRPGQLASIKHLDGPLLICAGAGSGKTFTLTQRITWALLP
FT                   GSGTNGSSFLNSIDEALVITFTNKAAGEIKDRIRAALRAEGMMTEALKVDGAWISTIHG
FT                   MCSRILREHALEADLDPAFELAMGADCQMARTEACACVLEEVKETDDNAYQALFAGFRT
FT                   TQALEDSIGRLLDEVSYQTDGFASLDRGPDPAQASDVVRKVLAACEATIACGTDKNRAT
FT                   AQALADALNDLIAKNHVTPETLLDALNAVNSNGLRGGKAVELKDAVSEAKALLQLSAAS
FT                   EMLDELIDLAQRTEEKYRAILHARAQLDTSDLIRTTLRLFKQNPALARTYTERFKLIMV
FT                   DEFQDTSQLQIDLIEFITGADKHNLCTVGDSQQSIYRFQGADVEVYLRHKRDMLSDAVG
FT                   ARIEQLDDNFRSHADVLALVRRICGQKGYFSEEFLDLKAAGPGKTWLSSDSRIEMALTR
FT                   CTSAEAGARCEAAHIARRFAALRQAGHKARDMVVLMGSTTASDIYAQALRDEGLPCIVA
FT                   GGSKFFEAPWVDLCQRLVNVLANPYDSESLLMVLTSELLPVSSDDLLFLATYHNEVTGD
FT                   AVRQNPAVGLLRADRAPFIASELLDHATDVLKRAWQSLGSQRPRDVFMQVILESGWLAC
FT                   LEKQGAEGQAIAADILKFARLIEEESYANGFDMARVARALEHRRTLSSEKPGALTIEGS
FT                   DAVRIMTVHASKGLEFPIVAIANCYTTRTTGERPYMLTDQGKIALTLPPSDLKAPKLPE
FT                   ELADATTPFEATNQLEFLQLIRKIDTDRKYAERKRLFYVAATRASDAVIVCLKHKLKKD
FT                   GSPQEYKQVERDLLNGLFPGEADFPLESGTFEYGESEPGVFTCLTAAEDDAAGTQVAPV
FT                   QTDAQADTQANTRADTQAGTQTGTDSHTDTNAQPDTTIHTEANARTSVSACLSAHADEA
FT                   ALPSDDSFEHHRIALPELESKTALVTYPLDDRSDFFSYTSLAAGATHAQTDEATSGVTI
FT                   SDVANTNIVGTTADAAKTSTVSTAATPVKTDPADVTPAETVSAYIADIKNEQLPGSIAT
FT                   GRHQVEDDATAFGSAVHQTCEWLALQPVLPSSDELAAAIKRFSLLWHVSDVPRVHTAVS
FT                   NWLNSSLCKQAFSFPQHSPEVPFTILVGNEVLEGEIDLLCTGTHPRKTKGHAASADDCA
FT                   FIVDYKTGGSPLETPEQLSAKHLLQAQCYAYAALQNGFSHVEAHFIRLEQLSDSGEPQT
FT                   ISYSFDRSNLSELERLILAARKAAQQAITQTITAQQD"
FT   gene            complement(96961..99933)
FT                   /locus_tag="Ccur_00780"
FT   CDS_pept        complement(96961..99933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93811"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK5"
FT                   /protein_id="ACU93811.1"
FT                   /translation="MDASLPFVLEQQIGSGSGIDTQPVLLVPTANRVIPLRRLLARHEL
FT                   GFNVTVDSLGRWVESLWILFGDGSTPISAEERRICLISLLEQSELDTTDGIVEAACRIA
FT                   REGLPVVRISDEQRSLPLSPMEEALAQVLESYRLWLRAHQRIEYAEMLSLLPDRIDATH
FT                   WQVLGVFFLADSLTPFEREFLGALNATLLVSGSNGTLTDNSKWVVDEKKSSPSRKANSN
FT                   ACYGTHHVESVETSRAPELCELSHLLFQRSASSKPVNASGAVRVALACGPEAQLLSVHE
FT                   AILDAVKGADSEQDPSIVVVLPDPLRQFTFSAPLLAQQGISCACQGSKLLCDIDVGRAL
FT                   IDACTLVDDAAAETALAADYSYNPFAGIWYATAFYSDKLHRGNRLIEQEELLCDLAGHA
FT                   EEDLQGLIGLIEQDDLPQALSVLESYIVRHFSSQPGYAAEQFAALQYVSRVVEAALAIG
FT                   KSPAQMIRHVETAQIPLAFDTDSGSQINDQIDSQIKDTSQIKGTHRVLFCTLDEAAALE
FT                   PASAHTIIAADMTAQSYPIVENVDAADTLLAKWGLVTTDNKMAASRQKFSAALLAARNR
FT                   VVMQRTMHNGLADEEQPAALFEEVLDCYRGDPTSRDSDDTTTRVPISLAPFTHLSGEEH
FT                   LVENTLGHAQRVASETDRPIMGSITPQARSFIVLNRRYHGHTFPGMDLSASQIESYLEC
FT                   PYQWFAKRRLKLESLDEGFGPAERGTFIHAVLESFYLRFQAEVQPKVTPSTLGQAREVM
FT                   QAVFSQVAERQFTDRHLVGNRYVPINAWEERQRDKVLDQLLDYLEFECRLLPSFEPWKF
FT                   EWAYGEDTPYSYAGCNLVGRIDRIDRDRAGQVVIIDYKSSLSSAYRLHADSSDESSAFE
FT                   LPAKMQALIYAKAVRDTLGCPIAAILYVNPLDASIQGAWDAGQIGLEELPFAPADARAG
FT                   RIPWCDVETFDALLDRCELLVGEHMASLANGEISPTPHGPNACRYCPVIDCPNRLEKRR
FT                   L"
FT   gene            99959..100219
FT                   /locus_tag="Ccur_00790"
FT   CDS_pept        99959..100219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93812"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK6"
FT                   /protein_id="ACU93812.1"
FT                   /translation="MGDIIELVLTLLWGGGKVFWAAAFLPASENSTVRARGKMKKYSFV
FT                   GAVCSSVAWHHFQYRVGWSLLICQLLGGLISQRGQSLPSPF"
FT   gene            complement(100469..101128)
FT                   /locus_tag="Ccur_00800"
FT   CDS_pept        complement(100469..101128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00800"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF1949);
FT                   Uncharacterized protein family UPF0029; TIGRFAM: conserved
FT                   hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93813"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK7"
FT                   /protein_id="ACU93813.1"
FT                   /translation="MDLYRTIREVSCAEIEVKKSRFIAHVHPVSTEAEALAFLDEIRST
FT                   HRTARHNVYAYILHDDSSNGGAERIRYSDDGEPSQTAGLPVLEALQHAHLTNIACVVTR
FT                   YFGGTLLGTGGLVRAYTQAVQSALHAARIARVVQCVEVETVCAYPLYEQIQRIAVDTAG
FT                   EIVRTSFTDTVSVTIRTECTNKELLIEKLTALLKGNCGLTVSQPFNALMDDDNPNN"
FT   gene            101455..102897
FT                   /locus_tag="Ccur_00810"
FT   CDS_pept        101455..102897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00810"
FT                   /product="Cna protein B-type domain-containing protein"
FT                   /note="PFAM: Gram positive anchor; Cna protein B-type
FT                   domain; TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93814"
FT                   /db_xref="GOA:C7MLK8"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK8"
FT                   /protein_id="ACU93814.1"
FT                   /translation="MRATSLTISQRLVAVCAAMALAVSLTPGLAFASPTSTTDVADSTV
FT                   TITDLLAGDTVEAYRIADADIDAANNLTYTMASDLPSDYDTIDEIAAVASDGTSFVQGS
FT                   AMQNAASKIAKAFADASTAPAATATATGTSANLTLGSGYYLVRVTSTSGETRVYQNMVI
FT                   DVSPKANTNGTYNPHDAVNVAVKKTDVTVKKTVGSEYKESTDKYSVGDTVPFKIETAIP
FT                   NYPADSKDATFKIGDTPTAGLEIDTTSIMINGATAVSGADYTLTASATGYTIEFSKAYV
FT                   LAHPGESITVTYNAKLTSDAFSHSADDVTGNTATVTFNPNPYNSTTVTPSDKTKVKTYG
FT                   YVFKKVDASGNSLAGAVFTITLANGTQVTSTSDANGYVYFEDLAAGTYTATETNVPAGH
FT                   LKAADQTFTLSEAVCTADNPATTQVENNYLVATSDVVDPDQPQLPITGGAGTLALTAAG
FT                   VVLLAFGGVVFVRSRKNQRDNA"
FT   gene            103391..105685
FT                   /locus_tag="Ccur_00820"
FT   CDS_pept        103391..105685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00820"
FT                   /product="putative collagen-binding protein"
FT                   /note="PFAM: Cna protein B-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93815"
FT                   /db_xref="GOA:C7MLK9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLK9"
FT                   /protein_id="ACU93815.1"
FT                   /translation="MIKSFSSRCSIAHRGAVFLCVLGFVIAVALCSLAPNKAFADPIST
FT                   SGDLLNSVSGNVYLTNPPSANSGQFWSNGAWHNFSEITPADKRQNGPARDLGGGWYIQW
FT                   MGKTNGGEYMIWRYHNAWTYNGATWGGFKVRFNNIGYTSKGEAIDSILDFTSVMAWKFD
FT                   GTPSPTWFSPFEITTKYGPIVGAVTTQDDAADTTPVGVQSIYGTSIVKHGTDTLIDSDN
FT                   EVDIVYWDIDRPVVMPDKSLNYSSNWRESVHFVSGYKGATVGTHTTLQVSDNGTWFRST
FT                   QNDDSQVPDNLSTVVAKATPQFTTEWRGHTCSTGIGYDTRVTVYPEWSAPVKSPERQIH
FT                   KRGETASFDVTETFPYVADSNKASSIVMEDTLDNALDASRATVQVLKNGVDVTDNWTIS
FT                   ISGQTIKATAKNTGHGYAEDKHVFRITAPVSESANLDSYETENIDGNKYWKVPNTASVA
FT                   VNNNAKVTNTVHVFVPYEAKGSVQLKATKSLLGGALQANQFTFTLKDSNGALIDTKKND
FT                   TSGAVTFGEIPYTQEDIGKTYTYTIEETPGADAGMIYDSHSETVTVKIEDAGSGKLAIT
FT                   TTYDDDGAAFTNTKTIPVTVLKTSTDGSVLSGAEFTLYKDDGNNTFDANDTPATVYSDA
FT                   GLTTAIPVAVVTTDAAGEGHYYGLMPGTNYWIKETKAPSGYNLDTKAHLIAVAADGTVS
FT                   TKDSAGVSANLPLKNGVASITIADEPIPNLPLTAGSGMVAALLFFGGLLAIGGSALILR
FT                   HQFLDSKPNEK"
FT   gene            105729..107177
FT                   /locus_tag="Ccur_00830"
FT   CDS_pept        105729..107177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00830"
FT                   /product="Cna protein B-type domain-containing protein"
FT                   /note="PFAM: Cna protein B-type domain; Gram positive
FT                   anchor; TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93816"
FT                   /db_xref="GOA:C7MLL0"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL0"
FT                   /protein_id="ACU93816.1"
FT                   /translation="MSSVVRTGMHKVSCAVAAVALALALTPVVAFASPTSTTDVADSTV
FT                   TITDLLAGDTVEAYRIADADIDAANNLTYTMASDLPSDYDTIDEIAAVASDGTSFVQGS
FT                   AMQNAASKIAKAFADASTAPAATATATGTSANLTLGSGYYLVRVTSTSGETRVYQNMVI
FT                   DVSPKANTNGTYNPHDAVNVAVKKTDVTVKKTVGSEYKESTDKYSVGDTVPFKIETAIP
FT                   NYPADSKDATFKIGDTPTAGLEIDTTSIMINGATAVSGADYTLTASATGYTIEFSKAYV
FT                   LAHPGESITVTYNAKLTSDAFSHSADDVTGNTATVTFNPNPYNSTTVIPSDKTKVKTYG
FT                   YVFKKVDPDGNALPGATFTLKVTNSDGSVTEIESTSDENGYVYFSGLSAGTYTISETVV
FT                   PAGYTKVADQTFTLSAAVCTADNPVTSEVEDNYLVSSTDVVDGKQPVLPLTGDVGTFIL
FT                   VAAGVGLLACAFVTIARFRKQKQS"
FT   gene            107217..108140
FT                   /locus_tag="Ccur_00840"
FT   CDS_pept        107217..108140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00840"
FT                   /product="sortase family protein, LPXTG-site
FT                   transpeptidase"
FT                   /note="PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93817"
FT                   /db_xref="GOA:C7MLL1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL1"
FT                   /protein_id="ACU93817.1"
FT                   /translation="MATREPSGSPARVVRSSKKKRWARLQLVIAVIILLAGVALISYPF
FT                   VSDWLNQRAQDAVSANQQEVVAALPPEDLSQEQQRAEAYNAQLFSGSSQVVDPFDTKAT
FT                   YLGNKEYESVLNVAGDGVMGELFIPKINVDLPIYHYTTDESLTRGVGHVVNTSVPIGGE
FT                   STHSVLAGHTGLPSARLFDRLDELSVGDWFIIRVLGEDHAYEITSTEVVLPEEVDSIKT
FT                   EAGRDLVTLVTCTPYGVNTHRLLVHAERCEVPDSWNTSEDSTIRLVATPTDLPRHLWAY
FT                   ALAGVLVAVAIIAVVYVILRYRRRQR"
FT   gene            108365..109537
FT                   /locus_tag="Ccur_00850"
FT   CDS_pept        108365..109537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00850"
FT                   /product="Fe-dependent oxidoreductase, alcohol
FT                   dehydrogenase"
FT                   /note="PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93818"
FT                   /db_xref="GOA:C7MLL2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL2"
FT                   /protein_id="ACU93818.1"
FT                   /translation="MEDFEFVSPTHFVFGKDAEEKVGEKIRAAGAQRVLIHFGGKSALA
FT                   SGLISRVRASLSQVGIACIELGGVRPNPEIGLVREGVRLCKQEQIDWIVAVGGGSVIDS
FT                   AKAIALGALSDIDSWEFYETKQAPSEVLPLAVVLTIPAAGSEASSNTVISNDELGRKTG
FT                   YGHISLRPRFSFMNPELTFTLPPYQTAAGITDMYSHLLERFFDDMGSVPVTDNLSLSLM
FT                   KTIRAEAPRVMADPEDYDARANIMWAGMLCHQGLAGVGRHEDWATHGLEHELSALNPQI
FT                   THGAGLAVLFPSWMEYVFEENPARFIQYGREIFGLVSTGDDWSDAYNAIDATRSFFASL
FT                   GMPTTLEELDVHEEDIDTMLVTLEKNRGAVFGSFKKLTINDAREIYRLVL"
FT   gene            complement(109555..110259)
FT                   /locus_tag="Ccur_00860"
FT   CDS_pept        complement(109555..110259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00860"
FT                   /product="putative effector of murein hydrolase"
FT                   /note="PFAM: LrgB-like family; TIGRFAM: conserved
FT                   hypothetical protein TIGR00659"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93819"
FT                   /db_xref="GOA:C7MLL3"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL3"
FT                   /protein_id="ACU93819.1"
FT                   /translation="MDINLPLPVLLVVGMILSIVVFQLAVLLYQKVKSPLLNPLLVTLV
FT                   VLIAALSVLHIPYDAYEASVQVFSFMLGPATVALAYSVWRQRSILKSHFIPIVSGCLVG
FT                   SIVSMISAYTLCTLLGLGDDMAVSFIPKSVTTPIAIAASQELGGITSITVAAVIITGIL
FT                   GAIFSPLMAKIFHVHDHVATGVAIGTCSHAVGTTKAIEMGELEGAMSGVSLAVAGLMTT
FT                   VIVIVAHCVFQG"
FT   gene            complement(110277..111023)
FT                   /locus_tag="Ccur_00870"
FT   CDS_pept        complement(110277..111023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00870"
FT                   /product="putative effector of murein hydrolase LrgA"
FT                   /note="PFAM: LrgA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93820"
FT                   /db_xref="GOA:C7MLL4"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL4"
FT                   /protein_id="ACU93820.1"
FT                   /translation="MLKEARTSKGTTGEAVLCDSAATGLIAGEATVSSSVSDESASGKT
FT                   LLRDSISSESTSSETVSSDSTLNKAVPGENACDTHKSDNERETSKTRKRKRLKRRTKVR
FT                   LGRAILLTLQIALLIIVYEIGCTVATFLPIDLPGNIVGMGLLLILLATGILKHKHVGRA
FT                   CDYLIDNMSIFFIPAGVGIMGCFTLLAGNGLKFAFVCITTTVIVFLATSWTVIAAQRLV
FT                   ESYAHKKTIRTQSDKTKQSCSHRLTH"
FT   gene            complement(111360..111806)
FT                   /locus_tag="Ccur_00880"
FT   CDS_pept        complement(111360..111806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00880"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93821"
FT                   /db_xref="GOA:C7MLL5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL5"
FT                   /protein_id="ACU93821.1"
FT                   /translation="MPYEQLKLDNQVCFPLYAAARDIVRHYKPFLDKLDLTYTQYIALM
FT                   VLWEEDSASIKELGGRLYLDSGTLTPLCKKLEAKGLVKRVRDEKDERNVIVSLTPKGRA
FT                   LEHKAADIPGLMAQSGCMPLTAEERDVLRKLLYKTLHGLDATDA"
FT   gene            complement(112162..112545)
FT                   /locus_tag="Ccur_00890"
FT   CDS_pept        complement(112162..112545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00890"
FT                   /product="predicted nucleic-acid-binding protein, contains
FT                   PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93822"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL6"
FT                   /protein_id="ACU93822.1"
FT                   /translation="MPSKKINTIIDETVILRYLLNDNKAQARQARKIIETGIACTYPEI
FT                   IARVAVCLRDVHRVPRTVIAASLIALLDEVNVPEEAVVRYASRLFGSSPLDYVDCLMVA
FT                   RNTVSGIPFVSFDKPIMKRTFTV"
FT   gene            complement(112580..112912)
FT                   /locus_tag="Ccur_00900"
FT   CDS_pept        complement(112580..112912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00900"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="PFAM: RelB antitoxin; TIGRFAM: addiction module
FT                   antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93823"
FT                   /db_xref="GOA:C7MLL7"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL7"
FT                   /protein_id="ACU93823.1"
FT                   /translation="MSKDSIIQVRISEHDKLEADELFTTMGTSTSEAVRLFIRQCLIHQ
FT                   RIPFEVCLPAKKTRGKAAGMLAEYASGGHRGEERSAWLKALTKSPDFLIGNSQATNPDG
FT                   DRAYRN"
FT   gene            113406..113939
FT                   /locus_tag="Ccur_00910"
FT   CDS_pept        113406..113939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00910"
FT                   /product="Fe-S-cluster-containing hydrogenase subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93824"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL8"
FT                   /protein_id="ACU93824.1"
FT                   /translation="METEMAEGVCVVADPDVCIGCRTCMAACLAKHDVIDDVAVARLNL
FT                   VSTLMISAPVACRHCVDAPCAAVCPTEALYREEGGRVAIREENCIGCRNCVMACPYGAV
FT                   SVVMRDVTTKLGDLVIERHEKPTVVKCDLCADRLGGPACIEACPTKGLVLIDKVKLQNY
FT                   SQNENRATSQSSVA"
FT   gene            114034..116247
FT                   /locus_tag="Ccur_00920"
FT   CDS_pept        114034..116247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:114454..114456,aa:Sec)
FT                   /locus_tag="Ccur_00920"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /note="PFAM: Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase; Molybdopterin oxidoreductase
FT                   Fe4S4 domain; TIGRFAM: formate dehydrogenase, alpha
FT                   subunit, archaeal-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93825"
FT                   /db_xref="GOA:C7MLL9"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLL9"
FT                   /protein_id="ACU93825.1"
FT                   /translation="MERHMAVCPYCGAGCKLDLLVDDNGKVVGAEGLDGVTNQGELCLK
FT                   GLHGYDFINDTKILTPRIYHPMIRRTKGAPLERVSWDEALDFTAKKLTEIKEKYGPDSI
FT                   MLTGSSRGPGNEANFVMQKFTRACIGTNNIDNCARTUHGPTVIGLMDTVGSGCMSVSIP
FT                   GMEDAECIMLFGYNPSASHPIVSRRIVRAKEKGAKIIVVDPRVIETARIADIHLQINNG
FT                   CNIAFLNAFANAIVTENLHDKQFIEEHTNGFDEWWETIKNYTPESVEHITGVDPELMRR
FT                   AARMYATAKTSILGWGMGVAQQKQNVPTVHTLAAIACISHQIGKPNAGLAPVRGQNNVQ
FT                   GSCDMGMLPNLYPGYQKATDIKVREKFAKAWNVPLERLSDHDGYKLTDVGHNVDEGKVH
FT                   AFYNFGEDPLQTEPDAIDLKRQLQDLDLFICQDIFMTQTTMLADVIFPGTSWGEHDGVF
FT                   TASDRTFQRFTAAVPPKGECRHDWQIFQDLSTRMGYPMHYNDTKEIWDEVRELCPTFYG
FT                   ATYEKMAGVGHAQWPIRNIEDEGTRDMFLGGQFTTPDHKAVLMAHDWEPPTELPDDEYP
FT                   LILCTVREVGHYSCRSMTGNCRTLAVLADEPGEIHIHPDDAAARGINDGELVRAHSRRG
FT                   EAMTRAVVDPRINKGTVYMTYQWWIGKCNNLTLHAVDPRSHTPEDKFSACQVDAIEDQV
FT                   WAEQRLQEMYDQLKEDLVETASAQDMEPGQEAKLSRQTANAIV"
FT   gene            116312..116911
FT                   /locus_tag="Ccur_00930"
FT   CDS_pept        116312..116911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00930"
FT                   /product="Fe-S-cluster-containing hydrogenase subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93826"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM0"
FT                   /protein_id="ACU93826.1"
FT                   /translation="MNRFIAINPDKCIGCGTCRAACSDGHREVGLQEEPRLSVVMTRDI
FT                   SAAITCHHCAGAPCLAVCPVNAITRENGSIQVNEQTCIGCKLCGIVCPFGAIHPSGTGI
FT                   QGVAGMAMGTPTYSRTLDPLLRWEIGVYTCAVKCDLCSYDPEHGPHCVPACPTNALEYV
FT                   TEGTADESVRTKRIQTATDQEVINAEIKAARKEVQR"
FT   gene            116908..118926
FT                   /locus_tag="Ccur_00940"
FT   CDS_pept        116908..118926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00940"
FT                   /product="formate hydrogenlyase subunit 3/multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93827"
FT                   /db_xref="GOA:C7MLM1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM1"
FT                   /protein_id="ACU93827.1"
FT                   /translation="MSATTLFLTSVVFSCVGALASILAMRNQQASKVIGCVFGMVSALF
FT                   GIAAGCQAIVGTAEWSSVVTPFSFANFSLLLNPLSGLLMLVISVLAFAAWIYGLNYFDE
FT                   YKGQGLGTMGFFMNLFIASMGFVICVDNALWFLVFFELMSLTSYFLVIVEQNETSIKGG
FT                   FLYLIMAHIGFFLIMIAFFVMAGLTGSFEFQAFRTSAFSPVISSLVFVLCFIGFGCKAG
FT                   MIPFHSWLPQAHPAAPSNVSALMSGGMIKIGVFGMVKVGLDLLQSSPVELWWGILVLLF
FT                   GAVSSVLGVVYALAEHDIKRLLAYHSVENIGIILLGVGIGFIGVAVGNPIVAVLGFLAG
FT                   FYHLFNHAMFKGLLFLGAGSVLYSTGTRNMEKMGGLARVMPVTAMCFLIGSLAISAIPP
FT                   LNGFVSEWFTYQSMFTAAFAGDAVIRLFAAFAAVSLAITGALAVTCFVKAYGVTFLSAP
FT                   RSDVARNAQEVPGPMKFAMGLIAFICVCMGLGAPWVAPIMQHIAEATVQAPSLGVTAGL
FT                   ANVNVSTAGVVSTPLIAVLLIGLVGLAIGLRALFDKGGVDEREDPWACGYHPNAHMPVI
FT                   ATSFASQVNMFLGPLYTARDVFSRQSDRATALFNGTVEGAKRIEGIPDKYLVDAPARFV
FT                   NWISAKVQKIEGGDFRLYILYIVVALVVLLALAVAVK"
FT   gene            118937..119866
FT                   /locus_tag="Ccur_00950"
FT   CDS_pept        118937..119866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00950"
FT                   /product="formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93828"
FT                   /db_xref="GOA:C7MLM2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM2"
FT                   /protein_id="ACU93828.1"
FT                   /translation="MTEIIIAIVQAVLLTLLAPLFSGTARWMRAKMHTRRGPSPLQDYY
FT                   DLIKLIKRQDLHTKDSSFVSRLMPPLFLGSMLILACGMPMITRLSPVPVLADIITIIYL
FT                   LALPRFFFALAGVDSSDAYAGVGGIRELLVGVLVEPSMMLALFVAALACGTTNVGLMGA
FT                   QIAEGNVTSPIAVVIAGVAFAMACYIELGKLPFDAAEAEQEIQEGPLQEYSGTSLSMVK
FT                   LSMSMKQILVISWFVAIFLPFGSAATLAPMDLLVGAVLFLVKITVIGLICSIFENVVAR
FT                   VRWKLTGRQTWTVVGVAVMALVFVVLGI"
FT   gene            119882..121336
FT                   /locus_tag="Ccur_00960"
FT   CDS_pept        119882..121336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00960"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 5 (chain
FT                   L)/multisubunit Na+/H+ antiporter, MnhA subunit"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93829"
FT                   /db_xref="GOA:C7MLM3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM3"
FT                   /protein_id="ACU93829.1"
FT                   /translation="MLSTTLPLLSLGAVAVPFVTALIIVMTPQRAAKWLCITAAAISTL
FT                   FTLLIWGNLAASGLDSITVPLAQFGSTQVIGLIFDKVSVMLAPCFVGIGLLISIYSVGY
FT                   MNAGNREHPDAPRRRFYAFFTVFIGAMAGLVYSSTVIGQLMFFEITGACSWALIGYYDT
FT                   PTARKAAMKALILTHIASLGLYAAAAILYMNTGTFETTAIAQLAPNVKIACLILILIAA
FT                   WGKSAQLPFYMWLPSAMEAPTPVSAYLHGASMVKVGVAVFARALIGAGQIPEVVGWVVV
FT                   IGGILTCLFAFLMYLPQKDMKRLLAFSTISQLAYIFLGFGFYIFGSNLALSGSITHIFN
FT                   HAFTKTLFFLIAGAFSYTMGTRMLPKLKGVLKKRPILGVGFGVAALSIAGAPPMNLFFS
FT                   KYVIFCGGIEAAEHNPILMAIVIIALIETVGCFAWFLKWTGAVLPGEPSEVVEASQPVP
FT                   KPMVGVFIVLIILVMCSSFVAAGWLG"
FT   gene            121346..121999
FT                   /locus_tag="Ccur_00970"
FT   CDS_pept        121346..121999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00970"
FT                   /product="hydrogenase 4 membrane component (E)"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93830"
FT                   /db_xref="GOA:C7MLM4"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM4"
FT                   /protein_id="ACU93830.1"
FT                   /translation="MTGFSLVNFLGALLIVTSTMVVLTKKAKPTAFVYAVQSLVLVSIF
FT                   IVLGATTNSHELFTWAGTAFITKVVIVPAIIWYLASKVGDAGASLEPRITPPRAIVLVA
FT                   IEVFICFVVVQGFTLPTAFEVKPALAISLAHFFIGLTCIVTQRNIVKQIFGYCLMENGS
FT                   HLTLALLAPQAPELVEVGVATDAFLAVIIMAVVAWRIYHATHSLDAEELMELNG"
FT   gene            122010..123611
FT                   /locus_tag="Ccur_00980"
FT   CDS_pept        122010..123611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00980"
FT                   /product="formate hydrogenlyase subunit 3/multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93831"
FT                   /db_xref="GOA:C7MLM5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM5"
FT                   /protein_id="ACU93831.1"
FT                   /translation="MDFSALLLTLIAVPLVAGLFMAVLPSKAVPRVAYEAIHLLSVTAA
FT                   CVLSLAVVVHVMAGGKPVDALGMWLHLDALGSVFVALIGVIGFLTGLYSVPYVRNDVAI
FT                   GHMNNARVKQFYLFFSLFIFTMLVVATSNNIILMWVGIEATTLSTVFLVGAYDAKLSLE
FT                   AAWKYVIVCTAGVAFGLYSTVLIYANAADVMANPHEAIFMTSIMPYATQLDGMLVQVAF
FT                   VFAAIGFGTKAGLFPMHTWLPDAHSEAPSPVSGLLSGVLLKCAMLIIMRFYILACQSIG
FT                   SQFPRLVMLIIGILSVFMAALAVFSQDDLKRKLAYHSCENVGIVALFLGFGGPLGIAAA
FT                   LLHCITHGFTKALLFCISGNVLMKYGTRDLNKISGILKTMPATGVLMSIGFFALAGFPP
FT                   FAMFVSEITGITAGVIEGQWFVIVVFVIALTIVVAACAHVVTQAVMGKVPEGMKKGDVS
FT                   PVALIPEVVLVALILWFGVAMPQPVLNGIEQATAIVLQQDDTAALHEAPLFRDLFATTD
FT                   GAHTHDQAMPPASSSK"
FT   gene            123620..125350
FT                   /locus_tag="Ccur_00990"
FT   CDS_pept        123620..125350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_00990"
FT                   /product="Ni,Fe-hydrogenase III large subunit"
FT                   /note="PFAM: Nickel-dependent hydrogenase;
FT                   Respiratory-chain NADH dehydrogenase, 30 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93832"
FT                   /db_xref="GOA:C7MLM6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM6"
FT                   /protein_id="ACU93832.1"
FT                   /translation="MDTRPLEKRPGATHAEAVRNRFPGVVRDVSWQDEDQMTITVAIDS
FT                   LPDVVEYLYFGRGGFLPMMVGNDERPLTGNYALYYILSMEEEDPCWCTVRVEVPADTCE
FT                   FPSVTPRVPACVWSEREVRDMYGLTPVGLPDERRLVLPDDWPDDLYPLRKDSMDYRHRP
FT                   MPASDVENYEFLADTGEHETTIMPMGPLHITSDEPGHFRLFVEGENIIDADYRLFYVHR
FT                   GMEKVAESRMNYDAVTFLADRVCGICGNAHSVAYAEAVEHAQGIEVPERAQYIRAISLE
FT                   VERMHSHLLNLGLVCHYCGFDTGFQHFFRVREDSMRLAELLTGHRKTYGINLIGGVRRD
FT                   ILSEQKLATFKAVDKLRKDVKGLVDELMSTPNFIDRTKGVGRLDPQIARAFSPVGPCMR
FT                   GSGFTRDVRFDHPFDGYKFLPDTFKARSHDGCDVMSRSMVRIEEFLDSCDMVEYLLDNA
FT                   PEGPILTQDWTYTPHKYALGYTEAPRGEDTHWAMVGDNQKCYRWRAKAATYSNWPILRY
FT                   MFRGNTISDAALIVGSMDPCYSCTDRVTVVDVEKNTSKTLTKDQLESYCVRRTHSPLKD
FT                   "
FT   gene            125351..125896
FT                   /locus_tag="Ccur_01000"
FT   CDS_pept        125351..125896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01000"
FT                   /product="NADH:ubiquinone oxidoreductase chain I-like
FT                   protein"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93833"
FT                   /db_xref="GOA:C7MLM7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM7"
FT                   /protein_id="ACU93833.1"
FT                   /translation="MKAMLKTLRNILKTGDATIKYPFAPYDTVPYMRGKPEHDLEKCIA
FT                   CAACAVACPPNAIQMPTDLSAGTITWSIDYGRCIFCGRCEEVCPVVAIKLTNEFELAVA
FT                   SKSDLIEDCTYTLQKCSKCGQYFAPRKEVDYAVRIMQADKDNPEAQEAARLAGICPTCK
FT                   RIADATAAQAAVRAQGGN"
FT   gene            125896..126747
FT                   /locus_tag="Ccur_01010"
FT   CDS_pept        125896..126747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01010"
FT                   /product="Ni,Fe-hydrogenase III small subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93834"
FT                   /db_xref="GOA:C7MLM8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM8"
FT                   /protein_id="ACU93834.1"
FT                   /translation="MTSNTITETRSTQSSIMQGYETRSTATAQKLQYQLEPKVLDQKIA
FT                   EAKAALLNDIKRSVYIYRVDCGGCNGCEIEIFGTLTPVFDAERFGIKNMASPRHADILV
FT                   YTGAVTRAMRLPALRAYEAAPDPKLIVSYGACGCTGGIFHDNYCVWGGTDKLFPVDVYI
FT                   PGCPPSPAQTIYGFAMALGLLGQKLHEKHLVEGEGEQAPIMFADIPYKLRCELEREARR
FT                   MAGYVYGRDLVDTFMQALEPEDGKVLTSVDALIEAESDPRKVEIYADLKQILTSKIVGK
FT                   KA"
FT   gene            126751..127248
FT                   /locus_tag="Ccur_01020"
FT   CDS_pept        126751..127248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01020"
FT                   /product="Formate hydrogenlyase maturation protein HycH"
FT                   /note="PFAM: Formate hydrogenlyase maturation protein HycH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93835"
FT                   /db_xref="GOA:C7MLM9"
FT                   /db_xref="InterPro:IPR010005"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLM9"
FT                   /protein_id="ACU93835.1"
FT                   /translation="MADKEYVPGENRMEAIGSTGDHISFYLLTRKMVDNAKSIPEDVQD
FT                   VLYYTLAIGHHTGVMDFFEERLSIPVESYRKIVDLMEDDQARRKWLGVFKFGEIEVGKE
FT                   HLSQVLPAARSALSHIDVFNEVGKKSISLTADEIDELSRLVELLLRVRSETNVYLMVRR
FT                   TQ"
FT   gene            127245..127763
FT                   /locus_tag="Ccur_01030"
FT   CDS_pept        127245..127763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01030"
FT                   /product="hydrogenase maturation protease HycI"
FT                   /note="PFAM: Hydrogenase maturation protease; TIGRFAM:
FT                   hydrogenase maturation protease; hydrogenase maturation
FT                   protease HycI"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93836"
FT                   /db_xref="GOA:C7MLN0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN0"
FT                   /protein_id="ACU93836.1"
FT                   /translation="MSVDEQHVNSSTTEKAADEKPRNIVFTAGSVLRGDDAAGPLLAKI
FT                   LDEDPADGWEVIDGGQTPEDDLGYIRDRAPERILFVDASKMGLLPGMVRQLSAEDVAES
FT                   FLITTHSLPISFLLKRLYEVCNDVTFLGIQVASTEFFDPVTPEVRHAVEDIARRVRQGA
FT                   DFSDYEHIQ"
FT   gene            127811..128650
FT                   /locus_tag="Ccur_01040"
FT   CDS_pept        127811..128650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01040"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="PFAM: Formate/nitrite transporter; TIGRFAM:
FT                   formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93837"
FT                   /db_xref="GOA:C7MLN1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN1"
FT                   /protein_id="ACU93837.1"
FT                   /translation="MSATAEDLKGLKPDALAPAEVEMKSETIGVGKANMAPVKMFVSAM
FT                   LAGAFIAFGGMYFCIFLGDATMPFAAQRMVGGICFCLGLVLVLCCGCELFTGNSLMVTA
FT                   LASKKIGIGGLLKNWVIVWIGNLAGAIVAVFFIWMAHVGALNGGNVANAMYNVALGKVT
FT                   PDWMTLFFKGIMCNIFVCLAVWIGFSARTVVDKVIGILLPISAFVAAGFEHCVANMSFL
FT                   PMGFALNAFAGIGDPGTITIASVFYNLSAATLGNIVGGAIVGLAYWFVYAQGKKKQG"
FT   gene            complement(128682..131543)
FT                   /locus_tag="Ccur_01050"
FT   CDS_pept        complement(128682..131543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01050"
FT                   /product="ATPase involved in DNA repair"
FT                   /note="TIGRFAM: exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN2"
FT                   /protein_id="ACU93838.1"
FT                   /translation="MRPLSLELCAFGPYADRVFIDFSLFGESGVFLICGPTGSGKTTLF
FT                   DAMKFALFGEASGTRRPTSSFASGFANATTEPFVEFIFEQAGKTYRARRVPHYSRSKKR
FT                   GVGTTAAGGAAELVCETTGSVIASKANAMDEAVVDLLGITTEQFSQIVMIAQGDFSQLL
FT                   TANTKQRAEIFRRIFHTEPYQHIQERLVERKRTLEQHVEASEEQARIHLALLASENAPE
FT                   TTMPNDEVAGQQEVFLTLKGPIPSADKQGDPFAFERSVPSAGEQDNPFTFEGSVLSRLD
FT                   DIEKELANIAAHDDMRKHSLTKQQAEAETRLQEIDRNLGSARQTTQLEKRLAETTSYLV
FT                   EHENAYQTAQANWQTAQAEEGLRHRLSEDIATATEKARTLSEVSRLEGQHTTAQSKVAA
FT                   SQKAATETETALHQARQQLEEIAEAAKRVHDAPAQLERARNDERLIADALEQTALVDRM
FT                   KQQTQTTTAAFADAQERYAQARADTTQATNAFFAAQAGILARSLSTGTPCPVCGSKEHP
FT                   HPAHLAADAPTQAYIDTLQATEQTARTHLEEAGNKLAADKAAEDAQLKRATQALAALPP
FT                   TYQSERIDTGKLATARTAIATRISELNAATDQQKQLTNEANRLSCMVPDLEEKARAASD
FT                   TLIQAQRNEAEIAASINALRATADYANALQAQKTIDDLRSRLEAAQKRFTVAQATWEEQ
FT                   RRAHDEHVARKKELEEQLAVAPHFNVATLEEQRILVVQTRKNTVAEITTIESRQATNEK
FT                   ALVALKKIAQSSQRIEEEFSQISYLADLASGNAVGTQGKISFETYVQSVYFDSVLDAAN
FT                   ERLSLMSEGRYTLLRRQQARDNRTQSGLDMDVFDAYTGKQRDVKTLSGGESFLASLSLA
FT                   LGFSDVIQRQAGGIQLDTMFIDEGFGSLDTEALELALRVFDQLGRDKRLVGIISHVEEL
FT                   KDRIDHRIVVQKDQTGSTLTVKR"
FT   gene            complement(131540..132769)
FT                   /locus_tag="Ccur_01060"
FT   CDS_pept        complement(131540..132769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01060"
FT                   /product="exonuclease SbcD"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93839"
FT                   /db_xref="GOA:C7MLN3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN3"
FT                   /protein_id="ACU93839.1"
FT                   /translation="MKFIHIADLHIGKRVRGFSLIDEQKYTLEQVASYAVQEKVHAVII
FT                   AGDVFDKPVAPLEALDVLEEFFATLATAHIPVVAIAGNHDSAERLSFGARFREEQFVHI
FT                   ARAFSATPQFLDFTEANNDSKEENKEKVAPLRVRVHLIPFVRPVHVRAAFPHQAEAIAN
FT                   YTDALRVACANQPLIEKDANLLVAHQFVVHGESEPETCESETVSVGGLDSVQASVFDAF
FT                   DYVALGHIHTAQSVGRDTIRYSGSIFPYSFSEAGREKSVTLIDISPSITGANTSPGATN
FT                   KRLSVTTRSLPLHENRTLREITGSFEELARTAPSDPHADDYLHVTLTDDALMNAMEKIR
FT                   ALYPHVMQLDFAHTRRIQTARQQAIKEAHLSNDPIGLLTDFYRSQTENELSESQIAAIR
FT                   TIIDEEVAAR"
FT   gene            133100..136723
FT                   /locus_tag="Ccur_01070"
FT   CDS_pept        133100..136723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01070"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="PFAM: Predicted permease; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93840"
FT                   /db_xref="GOA:C7MLN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN4"
FT                   /protein_id="ACU93840.1"
FT                   /translation="MIELRELRKSYKTGDFVQKALDGVSLNLRNNEFVAVLGASGSGKT
FT                   TLLNILGGLDHADSGDIVINGTSTKNYRAKDWDAYRNHRIGFIFQSYNLIPHQSILSNV
FT                   ELALTLAGVSRAERRRRATEALKQVGLGDHLHKRPNQLSGGQMQRVAIARALVNDPNIV
FT                   LADEPTGALDTETGIQVMNILKDVASDRLVIMVTHNPELAEEYATRIVRLTDGRIAGDS
FT                   NPFVPPVASALPRAAQAATGAAAVRAAAVDAAEAAETMSAESVEDNAGEVTSATSDQAG
FT                   APKDKMSAFVPVAGTAWSTGVSAAGSSAATSAGAGAGSGIGSDRKRNAGKASMSFLTAL
FT                   ALSFNNLMTKKGRTFLTAFAGSIGIIGIASILSLSNGVNNYIADTEEKALMSYPLSITK
FT                   SSFDIAGLMTVTMGYSTSSSDDVASEQTNGDATAVSTSTKIPEEKIMSDMFAKVKTNNL
FT                   RAFKNFLDNGDSGIDQYLNAIQYNYSITPQVYLPNTENDEIKRINPSEMGGMFSNGLTG
FT                   SALSVSSSGMNSFYELSDSSAVRDTQMELLEGHWPESANEAVLVLSGAGQISDYTLYSL
FT                   GVYDPEEMTKMAKDALAGNEVTVPETSGDFTYEDALNLSFKIVPLSSMYQYNDESGTWT
FT                   DMSKDDDYMKQRIDEGIDLRIVGVVKKAEGASGSSATEGVAYTSALTRELMNKAAESDI
FT                   VKQQIDNPDTDVFTGKTFDELKDSQKEEFDLSSVFSVDEEALQKAFSFDSSALSQMGSG
FT                   FDPSALSFDGSSLAFDPSSLQLDSSAISEIFNEDSMREIMANAPRFNLDSSSAGSITDG
FT                   LSAEQRQQIAQASNSLAAGFLAWYVTPQANGGYGGSLSDLTGSSSNFAAAFQQYLATDG
FT                   ARAITDPLMQDLGGDIQQQINAAMQNYMTNQFAPYLSESLSALMQQAAQVMGLQMAQAL
FT                   QTQMAALTGTLGSQLSQAISGQLSGQINQLSEAMQNGFSFDPEAFADAIHFNMTQDDLT
FT                   SLLTNYMNTGDLTYDGNMKKLGYAEEASPSSIDLYPVDFPAKEKVIGIIGDYNTDMTNA
FT                   GEDDKVIQYSDLAGVLMKSVTDIVNTISLVLIAFVSISLVVSSIMIAIITYISVLERRK
FT                   EIGILRAMGASKRNVGSVFNAETIIEGLIAGIFAIAAVWLASFPVNAFVEAGWNVPNIM
FT                   SLPWESALILIGVSVALTFVAGLIPSSMASRRDPVEVLRSE"
FT   gene            complement(137017..138579)
FT                   /locus_tag="Ccur_01080"
FT   CDS_pept        complement(137017..138579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01080"
FT                   /product="hydroxylamine reductase"
FT                   /note="PFAM: Prismane/CO dehydrogenase family; TIGRFAM:
FT                   hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93841"
FT                   /db_xref="GOA:C7MLN5"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN5"
FT                   /protein_id="ACU93841.1"
FT                   /translation="MSEMFCFQCEQTAGCSACTGAAGVCGKTALVANDQDELTGALVAL
FT                   GQAVQQGHATEEAREVVVTGLFATVTNVDFSDAAVRTLIDRAHAATRAISPAGIADYDM
FT                   NRMWTANEDIRSLKSLVLFGIRGMAAYAYHARQLGYVDETVDAFFFEALAALAEEGSLD
FT                   TLLPLVLKVGEINLSCMALLDRANTETYGDPVPTEVPFEVEAGPFIIVTGHDLHDLQLL
FT                   LEQTDGTGVNVYTHGEMLPAHAYPELKKHPQLKGNFGTAWQNQRKEFDGVPAPILFTTN
FT                   CLMPPKESYADNVFTCDCVEFDGTHHVGAEKDFSELIAKAKELGGYAENHPMTGINGGT
FT                   HATTGFGRATVLSVAGDVVNAVKAGDIKHFFLVGGCDGARPGRNYYTEFVQKTPADSVV
FT                   LTLACGKFRFNDLDLGTVAGLPRILDMGQCNDAYGAIQVAVALAQAFDCGVNDLPLSMV
FT                   LSWYEQKAVCILLTLLHLGIKNIYLGPTLPAFISPNVLNVLVENYQISPTSTPEEDLKK
FT                   ILG"
FT   gene            138746..139420
FT                   /locus_tag="Ccur_01090"
FT   CDS_pept        138746..139420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01090"
FT                   /product="transcriptional regulator, crp family"
FT                   /note="PFAM: Cyclic nucleotide-binding domain; Bacterial
FT                   regulatory proteins, crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93842"
FT                   /db_xref="GOA:C7MLN6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN6"
FT                   /protein_id="ACU93842.1"
FT                   /translation="MTEAFNDETIGILQRSVLFQGVSPHEMHEVLSCLGARCVAFEKDE
FT                   RIFRVGDGVDTLGVVLSGSVLVGSEDYWGNGNIIARIGPGGLFAEAFACLPDEASTVNV
FT                   VAASACRIAFLDVRRITDTCVSSCAYHQRIIRNLLMVLARKNLTLTRKVEHVTKRTTRE
FT                   KVLAYLSSCSQQAGSSRFDIPFNRQQLADYLAVERSALSSCLGKMQREGLISFKKNRFE
FT                   LK"
FT   gene            complement(139482..140264)
FT                   /locus_tag="Ccur_01100"
FT   CDS_pept        complement(139482..140264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01100"
FT                   /product="apurinic endonuclease APN1"
FT                   /EC_number="3.1.21.2"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel; TIGRFAM:
FT                   apurinic endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93843"
FT                   /db_xref="GOA:C7MLN7"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN7"
FT                   /protein_id="ACU93843.1"
FT                   /translation="MARTASNIGANTFQFFTRNPRGGAARAIDPNDIKAFRTAAEQAGI
FT                   TRILAHAPYTLNAAAKEQRIQDFARQTFADDLARMENTPHQLYNFHPGSHVGQGSEVGI
FT                   DKIASVLNDVLRPDQTTTVLLETMSGKGTEIGRTFEEIREIIDRIDLTDQMGVCLDTCH
FT                   IWDAGYDIANNLDGVLEEFDRVIGLERLHAIHLNDSKNPCGAHKDRHEKIGDGCIGFEA
FT                   LSRITRHPSLRHLPFFLETPNDLDGYADEIARLRAAWD"
FT   gene            complement(140546..141109)
FT                   /locus_tag="Ccur_01110"
FT   CDS_pept        complement(140546..141109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01110"
FT                   /product="peroxiredoxin"
FT                   /note="PFAM: AhpC/TSA family; C-terminal domain of 1-Cys
FT                   peroxiredoxin; TIGRFAM: peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93844"
FT                   /db_xref="GOA:C7MLN8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN8"
FT                   /protein_id="ACU93844.1"
FT                   /translation="MSLIGKEISDFSVQSYQNGEFKTVTKQDVLGKWGLFFFYPADFTF
FT                   VCPTELEDLADLYGKFQEAGCEVYSVSCDTHFVHKAWHDESERIQKVTYPMLADPTHAL
FT                   ARDFKVYIKEDGLAERGAFIVDPEGRIQVYQVNAGGIGRNAAELLRLLLAAQFVAKYGD
FT                   QVCPAKWQPGADALKPSIDLVGQL"
FT   gene            141258..141671
FT                   /locus_tag="Ccur_01120"
FT   CDS_pept        141258..141671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01120"
FT                   /product="Fe2+/Zn2+ uptake regulation protein"
FT                   /note="PFAM: Ferric uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93845"
FT                   /db_xref="GOA:C7MLN9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLN9"
FT                   /protein_id="ACU93845.1"
FT                   /translation="MVQRRNTKQRKLVLDSVRSLHNHPTADEVYVQAQQFDGHISRGTV
FT                   YRNLALLAEEGQIFMVKTPGGFRYDFRTDDHAHVICTSCGTVYDFPIDVDRLQELDAQV
FT                   EAVTGFSKVEHSVVFSGLCDSCRAREHSQRAAS"
FT   gene            141814..143100
FT                   /locus_tag="Ccur_01130"
FT   CDS_pept        141814..143100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93846"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP0"
FT                   /protein_id="ACU93846.1"
FT                   /translation="MNPLLIIPTYVSARSQAKIAPVAETYDHMTPLQSPGELARCLKSL
FT                   MHVQGVGQIAVLVVSETQVAAQAARKVRAICEQFPLLNTIVIGQVEESLIKQRFKQLNL
FT                   TGLDEAISLHGYSAMRNLGLIVAGVFGFDSVVFIDDDEVVDDSEFLVKGMYGLGKLTRR
FT                   GIPILAKSGYFLDKEGSVHSKRQDRWYDRFWMQGSAFNRWIDSALRGPRLSRSNHVCGG
FT                   CLALHREAYRRVCFDPWIVRGEDLDYLLNLRMYGSDIWFDNQWHLRHLPPKTPSEGLRF
FT                   RQDIYRWIYEFRKMEYSRTQIDLQQIKPSSLEPYPGPLLEPGITKRIKRTALLRSLARP
FT                   DKAAYRRAARVATSEATVYAERCCSKYFEFQFIWPEAMHRIEDDGALRDALLQHATVGS
FT                   DTSTRPVTDDQVGRIDPGATSEIRLNMAD"
FT   gene            143116..144024
FT                   /locus_tag="Ccur_01140"
FT   CDS_pept        143116..144024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01140"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93847"
FT                   /db_xref="GOA:C7MLP1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP1"
FT                   /protein_id="ACU93847.1"
FT                   /translation="MVLGLVIASLAGVGIGLLSGLLGIGGGTVIVPLLRLGFGFAAIEA
FT                   TATSLFAIIPTSVAGVVGHLRHRTCVVGVGVAAGLAGALTSPIGVQLADRSPSWAIMLA
FT                   AALVIGYSAVTMLKKALVSSHVTSSHAASPHVPHAMPSQDASPHVASSHAISPYVAQES
FT                   IKKSINAHRVHATCHQILVGALSGLIAGLASGYVGVGGGFIMVPLFVSFAGISMKQSSG
FT                   TSLIGVAILAIPGVISQMTLGNVQVLPGLALALGSVPGALWGARLVQVIPERSLRLLFG
FT                   MVLVLMACALVFNEVFSLIVG"
FT   gene            144219..145541
FT                   /locus_tag="Ccur_01150"
FT   CDS_pept        144219..145541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01150"
FT                   /product="putative regulator of cell autolysis"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93848"
FT                   /db_xref="GOA:C7MLP2"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP2"
FT                   /protein_id="ACU93848.1"
FT                   /translation="MSNQVSSRQALYRSVEVMLLVVALLAGAATVFFLTDSARDVRFMT
FT                   ISGLVLTACLIVLIRLWMNPDRVRAGQTDAVLNLASRMLACMDGGLKEESAQRICDMLL
FT                   PETSAIAVAITDKQVILGYSGRGQETNPQDAPIRTAATHAVLDSGEMQVLFSSDAIGFP
FT                   DERRAINGAIVVPLTMGAETVGTLKFYYPSARKINETQRSIAAGFGELLSTQLAATALE
FT                   EQKRMVTSMELKALQSQINPHFLFNTINTIASFIRTDPAKARVLLREFAVFYRRTLEDA
FT                   SDLIPLAREVDQTERYLRFEMARFGEDRLQLTCSIPSQVSEMLVPAFMVQPLVENAVKH
FT                   AMPATGCLHISICAEPQADDLVIRIIDDGVGMSEERRANIMETSSQTGLGIAVRNIRDR
FT                   IQGYFGAESFMRVESEEGSGTTITLFLKGGCFKNPLDLEEK"
FT   gene            145662..146378
FT                   /locus_tag="Ccur_01160"
FT   CDS_pept        145662..146378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01160"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="PFAM: Response regulator receiver domain; LytTr
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93849"
FT                   /db_xref="GOA:C7MLP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP3"
FT                   /protein_id="ACU93849.1"
FT                   /translation="MVLKAIIVDDEAPARSELKFLLDELGQTEVVAEAASVREAIEKLK
FT                   EYPCDVMFLDINMPEASGLQLAEALQHLKYPPAVVFVTAYSEFAIEAFKVNAIDYLVKP
FT                   VESERLSQALARVREHVSLHAKVQKLERIPVEKGGKKILIGIDTIRYVMARDDYTYLQT
FT                   DNDRYFSTVSLAQLEKRLDGHGFFRVHRGYLVNLSLVCEVEPVSGGTLLLTLDSCEDKV
FT                   PVSRRRVSSLKKALGI"
FT   gene            146791..148497
FT                   /locus_tag="Ccur_01170"
FT   CDS_pept        146791..148497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01170"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93850"
FT                   /db_xref="GOA:C7MLP4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP4"
FT                   /protein_id="ACU93850.1"
FT                   /translation="MLSVEMEKVYPSAKTLVKDTVASRLHAKDATLFSFSEEAEATARE
FT                   YMGWVDLASNPPYPLDDIKKFARQVLDDGFDTVLLLGEGGSTQAPMTITKYNSVDCSNV
FT                   KFRTLDSDSPVRVRSALANCNPHRLLIVTSSKSGGTIEPISYLRAVRAELKKAIPAEEL
FT                   VHQLVAITDPGSELDCLARTEGWRKVFSGEPSVGGRYSALSVFGLVPAALVGIDLDNFI
FT                   DRARTAEQACSEDSVDNPAIILAAFLYDNYMAGRDKFSFLTQKRGRVLGLWIEQLIAES
FT                   LGKGGKGILPNIESDALLLSRPSPDRTAIVYQTQNSLWDEQKNFEMSLAYIDQSIPLLS
FT                   FKVDTVCELAADFVIWEYATAMCGYLMKVCPFDQPDVASSKAATISVLTEGEIPPNFIQ
FT                   ENIGDMNMGEIEVRLSDTFVDATNLEEALRSLMASIVPGDYFSLNAFLPFAGEGRREAL
FT                   ELIRHTFAREFGVVSCLEIGPRYLHSTGQLQKGGANNGVFLILSADELKDIPLSDWHAP
FT                   SLGALAKAQAEGDLKVLSERGRRVVHLHLPDNSGATLRQVGEVVQKVARSL"
FT   gene            148632..151178
FT                   /locus_tag="Ccur_01180"
FT   CDS_pept        148632..151178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01180"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="PFAM: yrdC domain; HypF finger; Acylphosphatase;
FT                   TIGRFAM: [NiFe] hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93851"
FT                   /db_xref="GOA:C7MLP5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP5"
FT                   /protein_id="ACU93851.1"
FT                   /translation="MTEALNIHVTGIVQGVGFRPFVYRLARKHHLCGWVLNGVDGVRIH
FT                   AEGSQSDLDHFALAIADEAPAAAKVERVLLDPASVESFETFEIRFSDDTDTTSTTLVSP
FT                   DLATCDDCLYELFDPADRRFHYPFINCTNCGPRFTITRELPYDRANTSMGPFKMCPDCA
FT                   AEYADPADRRFHAQPDACFECGPHISWWVSPSATDRVAGMLANQESWASDASDWAPTYD
FT                   QRKIGRNQVQSDAIIAACIAVLTAGGIVAIKGLGGFHLACDATNEQAIAELRRRKRRPG
FT                   KPLACMVATLDKARALCQTTQEEEALLSSPARPIVLLRKRSDVSFATGLSDGLSEMGLM
FT                   LPATPLQHLILRAFGGMLVMTSGNVHDEPIQTDDARAAHVLADVADAFVGNDRPILERY
FT                   DDSVVRVAFIDADDSIVQMIRRARGFAPQPVPLPKDTPDECVFATGPEQKNTLALTRPG
FT                   EAFVSQHIGDMENAQTNDAWLEAAAAFKRLFHLTPSRVICDMHPEYLTSKWALAQDLPV
FT                   VRVQHHHAHIASVLAENALEGPALGFAFDGTGYGVDGAIWGGEVLLADLSSFERFANFS
FT                   YFPLPSGAGAITHPPRCAYGVLWAFDLLDHPGAASALSALGETADLCAQMIDRGVNCPQ
FT                   TSSVGRLFDAASALLGLCTEARYEGEGACLLEAAIDYSADDAVVDSVVRRAASNCDTPD
FT                   LDSAHANAVVNSAVDSTAEADKSAITHRYRVDIVKNAATEQSTAQDTAVLLLDAAPLFR
FT                   ALLDDKQAQVATGVIARRFHDAIVRAIVQMAQLGEALYGVRQTALSGGVFMNRYLLEQT
FT                   VSALSAAGYAVALNRDLPPNDGCISYGQAVVGLHTK"
FT   gene            151230..151481
FT                   /locus_tag="Ccur_01190"
FT   CDS_pept        151230..151481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01190"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /note="PFAM: HupF/HypC family; TIGRFAM: hydrogenase
FT                   assembly chaperone HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93852"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP6"
FT                   /protein_id="ACU93852.1"
FT                   /translation="MCLAIPAQITQRKEDNMAEVNIMGVTRDISIDLTPDAAEGDYVLV
FT                   HAGFAIEVVDPQFAEETLDLVKQFPDMVAEEVPEAVLG"
FT   gene            151485..152597
FT                   /locus_tag="Ccur_01200"
FT   CDS_pept        151485..152597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01200"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="PFAM: Hydrogenase formation hypA family; TIGRFAM:
FT                   hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93853"
FT                   /db_xref="GOA:C7MLP7"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP7"
FT                   /protein_id="ACU93853.1"
FT                   /translation="MARNLPDNILARDLSRFKDPDLARGLIASIEELAPVSCNLMEVCG
FT                   THTVAIARNGIRAIMPEGTRLLSGPGCPVCVTANKDIDTVIALTRIPEVTVATFGDMTR
FT                   VPGSTSSLLAEKAAGRSVEIVYSPLDALTFAQEHPERQVVFVGVGFETTTPLVSMAIKR
FT                   AHVLNLSNFTVFVAHKNMPGALETIVADPSLKVDALILPGHVSTVTGIRCYEFLAHDYG
FT                   VPGVVTGFEPVDVLQGIAMLMRQLREGRAEIEIAYTRGVRPEGNQVALAAIDEVFETCT
FT                   ATWRGLGPIPDSGYAIREKYRAFDAVARFQPVVEKTVEHAGCRCGDILRGAQSPDECPL
FT                   FGKVCTPENPIGPCMVSSEGSCAAYYRYYR"
FT   gene            152769..153260
FT                   /locus_tag="Ccur_01210"
FT   CDS_pept        152769..153260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01210"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93854"
FT                   /db_xref="GOA:C7MLP8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP8"
FT                   /protein_id="ACU93854.1"
FT                   /translation="MSSLPQNKLDPRIKNVWRCNDAFWIIILTAICAAVCKMVTLEPQA
FT                   RAIGEAGFTLVLVLGVIALVIWLFVLPPIRFIRWRYEITPEYLDIARGIIWRKRVVIPF
FT                   IRVQNTDTRQGPLLRLFGLASVTVSTAAGEHEIPGLSFTAAEELRNRAAELARLAREDV
FT                   "
FT   gene            153271..155373
FT                   /locus_tag="Ccur_01220"
FT   CDS_pept        153271..155373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01220"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93855"
FT                   /db_xref="GOA:C7MLP9"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLP9"
FT                   /protein_id="ACU93855.1"
FT                   /translation="MAQNSPGVQPNGMPQSTLTSTFTTGQRQHVHGSYIWLMPLTQLFA
FT                   IIFVALMANLASVSALFNSFGRNSLVATSALSFLFIGGIIIIPLLIYGLLVALAYWAYR
FT                   NLSFVFDEGEFSLYSGIIVKKRVHVPYARVQSVNHHATVIQRIFGICTVAIDTAGGAAN
FT                   KAVRIPYVSLSVAERLRSELFLRKAVALEQMAGGSAASQQAPAVQQVPVPSAASDTSAA
FT                   SAVSAAISTPGVSSGASSAGAVATLAADTSSAQVAIPTYGSAAIDASGRPVPPTEQIRQ
FT                   HTESVQVGNGAQASNVLDDTVGDIATFRGMFGGAIGGLETVSYEHGLSNGQLLMASLSS
FT                   SGMPMVIAIMSVIGFVTAFTGASALPLGLFALVVLIGGLGGMLQVIFSYGGFKVRRRGS
FT                   RIEVEQGLLQRQFSGIDIARVQSISVRQTFFRRLIGYCEVSLGRIDALESNQQKKGSSA
FT                   NLSRGLVVHPFVKLSQVENILAGLTPELIDIPRIDQLVKPPRRALRRALIRRCIWRNGW
FT                   VPAAIALIVALACLSVLRNSIGMNIAYTIDYTMTDMLLEAGASTSVTMLILDLLTKIIG
FT                   AFLGLCLILTALQAVGAFLWYRHSGFACTKHVAAIRNDGLSSEFTMIPREKLQYAGTCS
FT                   NPFQRFSQVASIEATTAAGVTKTVVRLWDVRADDAQRWLEWMHPRTGTAFSIEQITAQD
FT                   GINRSA"
FT   gene            155672..156445
FT                   /locus_tag="Ccur_01230"
FT   CDS_pept        155672..156445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01230"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="PFAM: Haemolysin-III related; TIGRFAM: channel
FT                   protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93856"
FT                   /db_xref="GOA:C7MLQ0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ0"
FT                   /protein_id="ACU93856.1"
FT                   /translation="MKPRRRTSSSSEDPGPAGISASRPTRPGAPEGYNDNPTNKHKAVS
FT                   RPCVREYRLGEEIANSVSHGVGALLSIAAVVLLIVTAVSHGVGIHLAAALIYGISMLFE
FT                   YLASTLYHALTHEGAKRVFKVLDHSFIYLFIAGSYTPFCLISLADAGGISLAVFVWAVA
FT                   ITGIALEAFWTFRPRWISAVIYVLLGWSIVAFLPTLAQVLPTVGFVLLVVGGLCYTVGA
FT                   VFYVFKKVPYLHFVFHLFVLAGSIFQFFVILLYVV"
FT   gene            156533..157864
FT                   /locus_tag="Ccur_01240"
FT   CDS_pept        156533..157864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01240"
FT                   /product="CBS domain-containing protein"
FT                   /note="PFAM: Transporter associated domain; CBS domain
FT                   pair; Domain of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93857"
FT                   /db_xref="GOA:C7MLQ1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ1"
FT                   /protein_id="ACU93857.1"
FT                   /translation="MAIWISIAITLALILANGYFSAAELAMVSVRKTKLEAALDDGDKR
FT                   ARKALDVAADADNLLATIQVYITLLGFFASAAAATTLSDPFASWMQELGVHAGVALPLA
FT                   TVIITLIVSYITIVVGELFPKRLGLANPEGVSMAMASSFAFFQHLARPLVAMTAASSNA
FT                   LARLFHVKSVDERQAVSEDEIKYIVKDNEELLPDEKRMIHEILDLADATARDIMTPRAD
FT                   IIFVEDTETVKETLNRMRGTGYSRLPVYHEDYDRIVGVVKYKDLIPAIMDDREDATVDE
FT                   FTDEVYFVPETKDIFPLLSEMQTNRQQIAIVVDEYGGTDGLITIEDIVEEIVGEIIDET
FT                   DLESRYVTQLTDGEWLVDGSLPVDDAIELSWPLEESDDYETIAGWLIDMVDTIPQIGDS
FT                   YDFGGYRFTVQSMRRRRISVIRVQKLVESTDDTDQSSDSPNEEK"
FT   gene            157996..158766
FT                   /locus_tag="Ccur_01250"
FT   CDS_pept        157996..158766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01250"
FT                   /product="putative stress-responsive transcriptional
FT                   regulator"
FT                   /note="PFAM: PspC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93858"
FT                   /db_xref="GOA:C7MLQ2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ2"
FT                   /protein_id="ACU93858.1"
FT                   /translation="MHEASKRLYRTEDGRFAGVAGGFARYFGIDLTVMRLIFIALTILT
FT                   CGLFVVAYIVIWLLIPCEGKPIRPLDVTVDPSLSSCCNTSHAKAAALRGVAVACALVGG
FT                   VLLLVVALSLAMPFVLPVFSPLQFWPLAVMAFGVLRLAVPGRDGYTLNSIVEGVILLVV
FT                   GAMALMASLGAVSLRFDGWLSENWAFLCVVAGLLVLARATRSNGFIVAAAVLFLLFCFI
FT                   GLGGYADRGPSLDDAARVFPMLESVNSWQGDLPQ"
FT   gene            158763..159185
FT                   /locus_tag="Ccur_01260"
FT   CDS_pept        158763..159185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01260"
FT                   /product="putative stress-responsive transcriptional
FT                   regulator"
FT                   /note="PFAM: PspC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93859"
FT                   /db_xref="GOA:C7MLQ3"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ3"
FT                   /protein_id="ACU93859.1"
FT                   /translation="MKKFSRYTPAARVGIVVGVALVAIGVIGLVVDRASVVLWWTAIDA
FT                   VCIVFDALFPVSLVALIVYLIWAYRKEALVAQGPRPTNLVRSSVDWRIAGVCGGLARWW
FT                   AIDSLTVRIIVLLLFVASPALTVFIYLILTLILPRA"
FT   gene            159630..160289
FT                   /locus_tag="Ccur_01270"
FT   CDS_pept        159630..160289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01270"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="PFAM: TrkA-C domain; TrkA-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93860"
FT                   /db_xref="GOA:C7MLQ4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ4"
FT                   /protein_id="ACU93860.1"
FT                   /translation="MSNIIVVGCGRVGSQLANMLSENDDNVCVIDKNPDAFTGLGRAFN
FT                   GSVIQGVGFDEETLSRAGANEADCVAAVTQSDNANLMTAEVASRLFHVPHVITRLYNPG
FT                   HEHAYEQLGFDYVCGTSLVTEDIYAKISSGHGFHIDTFGEFEVLRFSLDLEGNNMKSIR
FT                   VSQLERPYEVRIIAFERADGRSCSLPTGDSVLGHGDAVLACVKHSALQDFSRWIQE"
FT   gene            160299..160976
FT                   /locus_tag="Ccur_01280"
FT   CDS_pept        160299..160976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01280"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="PFAM: TrkA-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93861"
FT                   /db_xref="GOA:C7MLQ5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ5"
FT                   /protein_id="ACU93861.1"
FT                   /translation="MRIVINGGGKVGEYLASVLLADGNDVVVIEEDRATADRLASTLTG
FT                   RYMVIWGDGCVSRYQEDAGIRQADLFVSTTGKDDANLVSCEIAMRVFNVPRCIARVNSP
FT                   KNLRIFREVGIECVSSTTLIATIIEEDAMLGGISVLSSLSHGNVALAEVTVPRMRHHDP
FT                   VEGVLAHDVPVPDGCVLVAVSRGDEGDMEVIGTTTRLHPGDMVVLATDAEMKAAALQTF
FT                   RQL"
FT   gene            161194..162537
FT                   /locus_tag="Ccur_01290"
FT   CDS_pept        161194..162537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01290"
FT                   /product="Adenylosuccinate lyase"
FT                   /note="PFAM: Lyase; Adenylosuccinate lyase C-terminus;
FT                   TIGRFAM: adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93862"
FT                   /db_xref="GOA:C7MLQ6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ6"
FT                   /protein_id="ACU93862.1"
FT                   /translation="MIPRYTRPQMGGIWQNENKFSIWKEIELLACEAQAELGASGITKE
FT                   EAAWIRAHADFTVERIDEIEAVTNHDVIAFLTCLAEHIDADIPEGQEKPSRWVHYGMTS
FT                   SDLGDTALSYQITQALGIIIEDVRAIGEVCRRRAFEFQETLCVGRTHGIHAEPMTFGMK
FT                   FGSWAWAMKRALVRLEEARKVAACGAISGAVGTYSSIDPFVEQYVCEHLGLSPDPLSTQ
FT                   VLARDRHAQVMSTLAVTAASFESIAMQVRLLQQSDVIEAEEPFKKGQKGSSAMPHKRNP
FT                   ITAERVCGLARTIKANAQVGYDDVALWYERDISHSGAERTSLADSFIALDYIAEKLRWI
FT                   LDGLQVYPEAMKANLNKTRGLVYSSKVLLALVQTGITREEAYAIVQRNAMATWHDVQQA
FT                   KVGPTYRDRLEADPECTLDARELDKIFDPWQFLTRKNVVFNRLEQLSF"
FT   gene            162627..163616
FT                   /locus_tag="Ccur_01300"
FT   CDS_pept        162627..163616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01300"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93863"
FT                   /db_xref="GOA:C7MLQ7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ7"
FT                   /protein_id="ACU93863.1"
FT                   /translation="MDIQAIEQQILNGAWCFPNYAIYQVGGAAGGECYLIVSNSGSAAL
FT                   IDAGYAWDAPATLANIRRVLTDVGASHLEWLLLTHSHYDHAAGAGYLAGHMPGLKVACS
FT                   AYAARVFSRPGALATMRTLNASEAYLHGLTDFEEVPASLTIDRVLEPGDTVRAADMDFT
FT                   VIAAPGHTKCSIAFWCADRRFLVSCETGCVYAGPLDAAFRDVLGNPAPQGLEVMADPAY
FT                   LVGYASSLDFIAREIDLHPDVLLVPHFGIMTGAAATSFLHAADYFSRYAADLIMQAHTA
FT                   GASNDEVIAQFKAVFYNDYVQAIQPEAAFDLNASYLVPLVIRELSDAQ"
FT   gene            163813..165078
FT                   /locus_tag="Ccur_01310"
FT   CDS_pept        163813..165078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01310"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93864"
FT                   /db_xref="GOA:C7MLQ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ8"
FT                   /protein_id="ACU93864.1"
FT                   /translation="MKTRDWMIDGAVMLVALFFAIVQMYVASSPVMFRDESFRNMAGVV
FT                   TRDPGIAAYVLLIATVLPLVLRRRFPWPVLVFTFTLFVMSQGLAPSYSFSIIGPAIALF
FT                   TIAVERPRTEIIIALAISIVVLFWMPPPGENDSIRLVVVIQNATYLALSAGIGVAYHMH
FT                   RSFLREVEQRVAEVERTREKEAARRVEEERVRIAREIHDITAHSLSAVSIQAAAAERLI
FT                   DRDPAAARGAIAEVRKTAKSALEEIRSMIGVLRNESQEVETNPTNGTDRLPDLCAYACN
FT                   AGLEATLETDGYDAHKVPAYVDVTVFGIAREALTNVVRHAQAKKVRITLSQEADQVHLR
FT                   IEDDGCGIPEGPSASMKASAPGSASGRKRSAHSQLDDISAGGHGLQGMEERVYVLHGSF
FT                   SAANRPQGGFAVDVRIPLQEGE"
FT   gene            165081..165866
FT                   /locus_tag="Ccur_01320"
FT   CDS_pept        165081..165866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01320"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93865"
FT                   /db_xref="GOA:C7MLQ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLQ9"
FT                   /protein_id="ACU93865.1"
FT                   /translation="MDDLLGGSQLYDDDYRRAQERLRRRSEQAVAEADLGVNTSETVDV
FT                   LIVDDQDLVRNGFKLILSSYDHVRVVGEASNGIEAYEQSLALRPQVVLMDIRMPVEDGI
FT                   AATRKIVGDTALAQTRVLVLTTFDIDEYVYDALQAGASGFMLKDAEPDDIVRAVRTVAA
FT                   GDALIQPSITRRLIETFVSSRPRTSAAAGGLVDLTDREREILRFVARGMSNEEIADDLV
FT                   ISPATVKTHLARIMGKLDAHDRAQLVVAAYESGLVQPGK"
FT   gene            166063..166350
FT                   /locus_tag="Ccur_01330"
FT   CDS_pept        166063..166350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01330"
FT                   /product="Co-chaperonin GroES"
FT                   /note="PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93866"
FT                   /db_xref="GOA:C7MLR0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR0"
FT                   /protein_id="ACU93866.1"
FT                   /translation="MNLKPLGDRVIVKQDEVEETTASGLFIASSAKEKPTTGIVLATGA
FT                   GKVAEDGKVLPMPVKTGDHVVYAKFGGTEIEVEGEKVIILRADDIYAVQE"
FT   gene            166512..168152
FT                   /locus_tag="Ccur_01340"
FT   CDS_pept        166512..168152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01340"
FT                   /product="chaperonin GroL"
FT                   /note="PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93867"
FT                   /db_xref="GOA:C7MLR1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR1"
FT                   /protein_id="ACU93867.1"
FT                   /translation="MAKEVLFDADARGGLADGVRKLSNAVKVTLGPKGRYVALEKSYGA
FT                   PLVTNDGVTVAKEIELENPVENMGAQLIREAAVKTNDAAGDGTTTATLLADAIVTEGLR
FT                   NVIAGSDALGIRRGVEKGVNAVVEAIKADAIAVSGKDQIATVGTISAGDPVIGEKIAEA
FT                   MELVGKDGAISVEESQTFGIDLEHVEGMQWSRGYISPYMATDMEKMEANLQDPYILLTD
FT                   QKVSNIQDMVGLLEQIMKSGRSLLIVAEDVEGEALATLLLNKLRGTLNVVAIKAPGFGD
FT                   RRKRILEDIAIVTGAQVIDKDFGMTIADATIDMLGHAKSVKVDKDNTLIVDGAGDKKAI
FT                   EERKEQIKAELERVESDFDREKLQERLSKLTGGVAVLKVGAATESELKEKKSRIEDALQ
FT                   ATRAAVEEGIVAGGGVALVDALPALEGVKAASKDEEIGVEIVRKALEAPMREIAKNAGY
FT                   EGSVVVEKVKGMKKGQGLNSATGEYGDMIEMGVNDPVKVTRTALQSAASVATLILITDC
FT                   TVNEIPKDPDPAAAAAAAAQMGGGMGGMM"
FT   gene            168323..169294
FT                   /locus_tag="Ccur_01350"
FT   CDS_pept        168323..169294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01350"
FT                   /product="conserved protein of unknown function BmrU"
FT                   /note="PFAM: Diacylglycerol kinase catalytic domain;
FT                   TIGRFAM: conserved protein of unknown function
FT                   cotranscribed with Bmr (bmrU)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93868"
FT                   /db_xref="GOA:C7MLR2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR2"
FT                   /protein_id="ACU93868.1"
FT                   /translation="MSASVTGEKVLLIANPSAQSGKGAIAANFAADVLERSLAESAVGS
FT                   YLAGAQLEVQFTKSAGDAYHFAFAAGGYRAVVALGGDGVIHDAVNGLMHLEAFDRPAFG
FT                   VIPSGTGNDYARALGVPLGTAEAVQVLLQARAPRAVDVGSCNGVYFAETLSFGLDAAIA
FT                   LDTMERRARTGQTGAKVFVASGIDQVLNHLRAYKYTGTFDDQSVQGQSITFAVQVGPYY
FT                   GGGFRICPDAQIDDGYFDICIAHPPVGPTRALYIFLRAKNAHHTKFRQIELRRAKSLSL
FT                   HFDEQPCVQIDGEPLVADSYEVRIHPHELQVLAPPMRGSTSR"
FT   gene            169432..170286
FT                   /locus_tag="Ccur_01360"
FT   CDS_pept        169432..170286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01360"
FT                   /product="rRNA methylase"
FT                   /note="PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93869"
FT                   /db_xref="GOA:C7MLR3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR3"
FT                   /protein_id="ACU93869.1"
FT                   /translation="MNIIEINSWDDPRLDAYARLTEAQLRNRLEPERGLFIAESPKVIA
FT                   RALAAGMQPLSFLMERQHLAAARTLIEGCTAEDGSDIPVFTGSTEILSRLTGFELTRGV
FT                   LCAMRRPALPSVEDLLANARRVAVLEGIVDHTNVGAAFRSAAALGIDAVLVTPTCCDPL
FT                   YRRSVRVSMGTVFQVPWTRIGQTPDDWPDRGLERLHACGFSTAAMALSDNSVSLSDAAL
FT                   NACERLAIIMGTEGDGLAKRTIAQCDFTVRIPMRHGVDSLNVAAASAVAFYQLCSSSNS
FT                   SGK"
FT   gene            170638..174261
FT                   /locus_tag="Ccur_01370"
FT   CDS_pept        170638..174261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01370"
FT                   /product="putative collagen-binding protein"
FT                   /note="PFAM: Cna protein B-type domain; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93870"
FT                   /db_xref="GOA:C7MLR4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR4"
FT                   /protein_id="ACU93870.1"
FT                   /translation="MRFGWVIRCRWRIALAGALICALACCGCFFVFHTTLEQAFASESA
FT                   SLEVGADIFYGGYSTNWLSVEGSMAYCAHPEKQTPPAGSYEKQEIVATNGRTDEVRADL
FT                   WFGFGGPGFDASWWPTTWYDGSAMTDERYAALTHIIVAEAYNDSAIAALKGTSQQFRTW
FT                   ARAEVLGYDEEGLVSNEQATARIIAAHLHDVPSAFTTFALHTGSSTQDIVSFAPVGSLE
FT                   LHKISSHESVSAGNPCYSLEGATYEVRAASGEVVGTLTTDADGYAHLEGLLAGSYTVKE
FT                   TTPSKGMALDRSEYSVEVVSGSTTLVNGSTVSDTPQMNPIEIALRKVDSSMGAGLSQGA
FT                   ATLAHARFSFQYYAGFFDTADAARASGVPLRSWVFETDSEGVCRYRTDDQVEGDALYTD
FT                   ENGTEALPLGTVVIEEVKAPLGYVLPSEAQRTFCVQITSDGVDSHVSSFAAPACPEQPI
FT                   RGDFRLIKEAPTALSDNPQEQQRVLVEGVLFQVINDNEQPVISPETGALCQTGEVVCTI
FT                   KTDESGQASTRASETNGWATPAGWTGALPFGTYRIHEVIPNQTADRFKAKYGKTLLTVP
FT                   DWKVSIQSDGAWDPPTLVLDRIPQTPLRIEKVDAESGKRIPLPCTFSLYKEDGRVVEYI
FT                   DRTTGQSKSEWTTNDAGEIQLPMLLEEGIYELHEIQAPEGYLINKEPIRFDVQGFRDWD
FT                   NPLTVTCVDNQPRARLRVVKTDSDTGQVVAGATYRLKAQKDIVSADGTIHANAGDEIGQ
FT                   MATDSQGVAIFDGLRLGSYAVEEVAPAAGYARDTAIKTVELAYAGQETALVETDCPVTD
FT                   SRTRVIVRKVSAKDTDKGLPQARFSVTKLDSGTVTEIETDESGNASLDGLSPGVYRVKE
FT                   EAAPHGYALDTEQERTFTVDNQGFVHLDEAAAHSSETTSVEHAPVAQLTLTFSNEPIEL
FT                   ASDASDQESGSHEGQARAEASIIDAVSYSGLEAGKNYRLVGTLMDCETGEVLSINGMPI
FT                   TAETTFSAQHSSGSVETVFSFDASGLAGKSVVAYETCFLGDSVVAMHEDIADTRQMVHF
FT                   IDISTAARDGGSDGSGTRSVIDAVSYRGLEPGKTYRMIASLVDADSAAPLTARDGLPAT
FT                   GEASFTPDAPDGSVDVTLSIREQEVSGKRAVVFERLVDEKGHVIATHEDIQSAEQTVSF
FT                   VDKPGFSLPKTGDYLIGILCVLSLAIGASLVLFVVRRRGIH"
FT   gene            174317..174392
FT                   /locus_tag="Ccur_01380"
FT   tRNA            174317..174392
FT                   /locus_tag="Ccur_01380"
FT                   /product="tRNA-Lys"
FT   gene            174438..174995
FT                   /locus_tag="Ccur_01390"
FT   CDS_pept        174438..174995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01390"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93871"
FT                   /db_xref="GOA:C7MLR5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR5"
FT                   /protein_id="ACU93871.1"
FT                   /translation="MARRHHAGGYELTKPVYFIGFMGAGKTSVSQYLAKTLGLASIDAD
FT                   EYLELLEDRIIADIFAEEGEESFRDLETQYLEELSRRSPRFIGCGGGVVKRPKNITIMK
FT                   THGYAVYLGVTAEEASHRIPNTDSRPLFKDIETARRTVAERIPLYEAAADAYVETTGYS
FT                   VPEIADQVEAILLENGILVKED"
FT   gene            175251..175469
FT                   /locus_tag="Ccur_01400"
FT   CDS_pept        175251..175469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01400"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93872"
FT                   /db_xref="GOA:C7MLR6"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR6"
FT                   /protein_id="ACU93872.1"
FT                   /translation="MGKEDVIELGGTVLEALPNAMFKVELENGHQILAHISGKMRMHYI
FT                   KILPGDKVTVELSVYDLDRGRITYRFK"
FT   gene            175622..175735
FT                   /locus_tag="Ccur_01410"
FT   CDS_pept        175622..175735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01410"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: Ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93873"
FT                   /db_xref="GOA:C7MLR7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR7"
FT                   /protein_id="ACU93873.1"
FT                   /translation="MKVRPSVKKMCDKCKIIRRHGKVFVICENPRHKQRQG"
FT   gene            175754..176122
FT                   /locus_tag="Ccur_01420"
FT   CDS_pept        175754..176122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01420"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: Ribosomal protein S13/S18"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93874"
FT                   /db_xref="GOA:C7MLR8"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR8"
FT                   /protein_id="ACU93874.1"
FT                   /translation="MARLVGVDLPRDKRIEVGLTYIYGIGLTTSQKILAETGVDPDTRV
FT                   RDITEEDLTKIRDYVNENLSVEGDLHREVSQNVKRLMEIGCYRGLRHRKGLPVHGQRTH
FT                   TNARTRKGPRKQIGGKKK"
FT   gene            176135..176533
FT                   /locus_tag="Ccur_01430"
FT   CDS_pept        176135..176533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01430"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93875"
FT                   /db_xref="GOA:C7MLR9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLR9"
FT                   /protein_id="ACU93875.1"
FT                   /translation="MAQKKNVRTRIKRSERKNITVGAAHIKSTFNNTIVSITDPQGNVI
FT                   SWQSAGTVGFKGSRKSTPFAAQMAAEAAAKTAMEHGVKKISVFVKGPGSGRETAIRSLQ
FT                   AAGLEVASIQDCTPIPHNGCRPAKRRRV"
FT   gene            176552..177145
FT                   /locus_tag="Ccur_01440"
FT   CDS_pept        176552..177145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01440"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: Ribosomal protein S4/S9 N-terminal domain; S4
FT                   domain; TIGRFAM: ribosomal protein S4, bacterial/organelle
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93876"
FT                   /db_xref="GOA:C7MLS0"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS0"
FT                   /protein_id="ACU93876.1"
FT                   /translation="MAVNRTPVLKRCRQLGIDPIVLGYTGKESKRQPKRRRKESEYGMQ
FT                   LREKQKAKFIYGVQEKQFRGYFRRAKSQSGITGENLMAILESRLDNIVFRLGFARTRRE
FT                   ARQTVTHGHITVNGNRVDIPSYRVRPGDLIAVAPKAKELLVIKSALVSNERVQVPAWLE
FT                   VDIEKLQGSVLSLPTREQIDLDINEQLIVELYSK"
FT   gene            177178..178128
FT                   /locus_tag="Ccur_01450"
FT   CDS_pept        177178..178128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01450"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="PFAM: Bacterial RNA polymerase, alpha chain C
FT                   terminal domain; RNA polymerase Rpb3/RpoA insert domain;
FT                   TIGRFAM: DNA-directed RNA polymerase, alpha subunit,
FT                   bacterial and chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93877"
FT                   /db_xref="GOA:C7MLS1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS1"
FT                   /protein_id="ACU93877.1"
FT                   /translation="MTEFMRPTITTEEVSDTVARFVVDPLERGYGYTLGNTMRRVLLNS
FT                   LDGAAATAIQIDGVQHEFATAEGVIEDITDIVLNVKGLVFSVFAEDAIEATAHVSAEGP
FT                   CTVTGADLQVPTEFTLVNPDHVIATVADGGQLDMTIRIGVGRGYVVAERNKRNEDPIGI
FT                   IHVDSLFSPVRRCALSVTDTRVGQSTDYDKLILEVETDGSLTPTDAVCQAANIVTQYMG
FT                   AFLSLNESEEEEEGEVPSIFAPEGEETNAELDKQIEDLDLSVRSYNCLKRAGIHSVRQL
FT                   VEYSENDLLNIRNFGAKSIEEVKDKLISMGLNLKQ"
FT   gene            178141..178884
FT                   /locus_tag="Ccur_01460"
FT   CDS_pept        178141..178884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01460"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: Ribosomal protein L17; TIGRFAM: ribosomal
FT                   protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93878"
FT                   /db_xref="GOA:C7MLS2"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS2"
FT                   /protein_id="ACU93878.1"
FT                   /translation="MRHYKKGRKLGTDASHTKAMKKSLVAALFTNDRIKTIEMRAKEIR
FT                   PDVDRIITWAKRGDLHSRRLAIRALGDKELVREVFEKVAQGQFADRNGGYTRIMKLGYR
FT                   KGDNAPMVIMELVTEPVAKKKAEKSSKAASGAKKTAPKKAAQKTEDAKESKAAAATDEA
FT                   KEEQSAVEEDKAVSEKATTKGASSKAKATKKTDAKESAAEKAVDGAAEGAAEQAALDAD
FT                   DAKVEKAAKEEKVDADKAAKEDAGE"
FT   gene            178979..180031
FT                   /locus_tag="Ccur_01470"
FT   CDS_pept        178979..180031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01470"
FT                   /product="Cobalt transport protein"
FT                   /note="PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93879"
FT                   /db_xref="GOA:C7MLS3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS3"
FT                   /protein_id="ACU93879.1"
FT                   /translation="MVKNAATYHGDTTPMHVLDARVKLVLLLVYSFSLLVVGTWGGLLF
FT                   FGVLLINAIATARFPWRLALRQLVPLGILLAFAILMQSFAIETSASVSASPSMGASVSF
FT                   NTNTSFFPPDKSLIFPGYPLVPLPVSFGGLSFSPAGCERGVFLALRIVLLVMSSLVFTY
FT                   TTADFSIARALEDMLHPFRGGRGHAQARDNRREHPKRGNEFGYQGHSKGKQPTSCDAGS
FT                   NRCLVRNYDVRSNRWQAFSRDAATVASLALRFIPVFMEESRSIVQAQRARGAHLNHGGI
FT                   QTRFLAWTTLLIPLFVGLYRHADTVAVAMDARAYGAGPSTRLSDTALTFSDYALVIVVS
FT                   LFCIGVAVVA"
FT   gene            complement(180089..180190)
FT                   /locus_tag="Ccur_01480"
FT   CDS_pept        complement(180089..180190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93880"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS4"
FT                   /protein_id="ACU93880.1"
FT                   /translation="MDVLRSRKLYTAVAAVAIEKKPEKGELVLKSFI"
FT   gene            180363..181616
FT                   /locus_tag="Ccur_01490"
FT   CDS_pept        180363..181616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01490"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="PFAM: MoeA N-terminal region (domain I and II); MoeA
FT                   C-terminal region (domain IV); Probable molybdopterin
FT                   binding domain; TIGRFAM: molybdenum cofactor synthesis
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93881"
FT                   /db_xref="GOA:C7MLS5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS5"
FT                   /protein_id="ACU93881.1"
FT                   /translation="MREMISPEEARQLVLDHVSPLDSEEVSLLEAVGRVAATDIASDID
FT                   VSPFAHSAMDGFALRANQLAGASVASPVTLNVIAEEGAGEVFTGTIGPNECVRIMTGAP
FT                   LPSDADSVVKYEVVTVVDGDGKTGSMVSFDAPIAYRKNVREAGEDARAGQRVVAVGDVI
FT                   SSAGVGFLASCGAVSVRTYRRPRVAVIATGTELVEPTEVPGPGKIRNSNSYAMAACVQQ
FT                   AGGIPNVLPIVPDSFEALSAAVASACKNYDLVLTTGGAANGDYDFIKQVVADQGDLFMT
FT                   TVNMRPGKAQTFGLIDGVPVFGLSGNPAAAYVGFQMLVRPVLRKMQGFSRFEHTCVRAR
FT                   LSKDVKKKDPRRIYLRSTIEKDENGYSVTPAGNQSSGLFGVIQRSNCLAIMPEGLESKK
FT                   AGDMVECLLLDIPEELVL"
FT   gene            181616..182137
FT                   /locus_tag="Ccur_01500"
FT   CDS_pept        181616..182137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01500"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="PFAM: Probable molybdopterin binding domain;
FT                   TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93882"
FT                   /db_xref="GOA:C7MLS6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS6"
FT                   /protein_id="ACU93882.1"
FT                   /translation="MSTATPDTSASHQRPALRIAVITCSDTRGIREDTAGAALEDLIRA
FT                   EGWEVIDRLVVRDERTLISSAIIRAADDLDADIIITCGGSGLSLRDVTPEATRDVCERE
FT                   VPGIAEAMRAYSLTITPYAMLSRALCMQRGRHLVINFPGSEKAARENWEGVKAVLPHAV
FT                   SMMAGEGHGK"
FT   gene            182154..183419
FT                   /locus_tag="Ccur_01510"
FT   CDS_pept        182154..183419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01510"
FT                   /product="alanine racemase"
FT                   /note="PFAM: Alanine racemase, N-terminal domain; Alanine
FT                   racemase, C-terminal domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93883"
FT                   /db_xref="GOA:C7MLS7"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS7"
FT                   /protein_id="ACU93883.1"
FT                   /translation="MDDTLNGFTGFSRKDDPLRYADADTQAASPVSFSKEALASIAGED
FT                   RRWAWVEIDRSAIRHNLHEAKRRLQPNCRLMAVVKADAYGHGAVEVSRTALNSGADALA
FT                   VATVDEGIALREAGLRAPILLLSEPPQAAIPLLLEYKIMPSVYRAEFALAYGEIADAHH
FT                   LKAPFHLAVNTGMNRIGVHAEDILEFERQISFHRALEQEGTFTHFATADCPENLDFRIQ
FT                   MKRFTEAIEALRLAGIDPGIVHAANSAALLRYPESHFDMARIGIAMYGFHPCEETRDVV
FT                   DLKPAMSVYARITDIRNVSVGEGVSYGLNYRSPGSVRICTIPLGYADGFNRLLSGKVNV
FT                   ILDGQYCRQVGNICMDQCMFEVDMRTYGTHPRLNPQLGDIVTVVGNQGDAITTITEMAY
FT                   LANTIEHEVAIGFAWRLPRLYR"
FT   gene            183456..184043
FT                   /locus_tag="Ccur_01520"
FT   CDS_pept        183456..184043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01520"
FT                   /product="uracil-DNA glycosylase, family 4"
FT                   /note="PFAM: Uracil DNA glycosylase superfamily; TIGRFAM:
FT                   uracil-DNA glycosylase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93884"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS8"
FT                   /protein_id="ACU93884.1"
FT                   /translation="MLITPQSLESLRRQVEACHACPLWQGRTNVVFGAGNPQARILIIG
FT                   EAPGKNEDLQGEPFVGAAGKKLDALLEIADLARDDVFIANVLKCRPPSNRNPLPEEITA
FT                   CAPFLREQTRTINPEFIVTLGNFSTKFVLKTQLGITRLHGQLQHAGRFKVFPIYHPAAA
FT                   IYDRTKQQALEDDFRTLGRLVKESNQNEVAAN"
FT   gene            184184..185584
FT                   /locus_tag="Ccur_01530"
FT   CDS_pept        184184..185584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01530"
FT                   /product="folylpolyglutamate synthase/dihydrofolate
FT                   synthase"
FT                   /note="PFAM: Mur ligase family, glutamate ligase domain;
FT                   Mur ligase middle domain; TIGRFAM: folylpolyglutamate
FT                   synthase/dihydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93885"
FT                   /db_xref="GOA:C7MLS9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLS9"
FT                   /protein_id="ACU93885.1"
FT                   /translation="MSSDETTSRSTFNTRGVPNVLGISDTIDTADAVDTFDPIAYLNEP
FT                   RWRSSRLGLERIESLMAALGNPQDKLTVVHVAGTNGKGSTCAMVASVLQHAGYRTGLFT
FT                   SPYIIEFTDRIRIDGQNVSLAALCAATQTVRRVAEQMDDHPTEFELMTAVAFVCFVAAG
FT                   CTMAVVEVGLGGRLDSTNVIAAPAVCALAPISFDHTDILGSTLAQIAHEKAGIIKPGAA
FT                   IVSALQRPEAMRVIENAALQVGSPVTVVDEQRLSGTPAHFSYRSYTDLSIPLKGSYQTH
FT                   NAALAIEAIDALIQKGITITEQDLREGLAQVSWPGRFQVVSHSPEFIVDGGHNPQGAQA
FT                   LVDSLEANYPARRTVLLIGVLADKDVTSMLRRVLPSGCGVVCITPPNPRALGAQELASQ
FT                   VVSLAKQLQNESIAIDERLLNPVCAPSIGQGVTCAQQMAGAEGLVCAFGSLYSIADIMA
FT                   ALDKHSAD"
FT   gene            complement(185716..187221)
FT                   /locus_tag="Ccur_01540"
FT   CDS_pept        complement(185716..187221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01540"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunit"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93886"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT0"
FT                   /protein_id="ACU93886.1"
FT                   /translation="MGTSITTRCHLTRRQFARIVIGGAAATSLGTLVGCAPQPAANRKN
FT                   NEHISRTVSCDVLVVGGGGAGVSAAAAAAGAQADTILIEKLPWLAGSSSLAIGTFYGAD
FT                   TNLQKAQGIDDNADDLLAYFLRRGGDKLDYDIQKFCADHFGETINWLADDLQVPFKDTV
FT                   SLKGTDTVPRGHNCKTSALDALDAVTQLARENGVKFHFSTAARELVIENGTVTGVIASD
FT                   ATGKLVRYQAKKTIMASGGFCRNDEMIAEYMPDYAGVYTEVGVGLTGEGLRMGLDAGAD
FT                   YIGHGGTNGILSCPIEPGQSKLISKTVMWVDSDGNRFVNEGGQTHDIYYTVARFPDKKF
FT                   FAIYDQAAYEALGDKQKNNLDRGVTDGLAAKADTLEAVCNAMGVNAQTAAITLASYNEM
FT                   AEAGVDTQFNKKADNLKALTQAPYYVIQMGVCTHGSFGGYRVNTDFQVLDTTGAPIENY
FT                   YAAGEVCCGTFIYDDYPSGGCGLNWSYTSGRFAGANAAQAALA"
FT   gene            complement(187297..187815)
FT                   /locus_tag="Ccur_01550"
FT   CDS_pept        complement(187297..187815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01550"
FT                   /product="PAP2 superfamily protein"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93887"
FT                   /db_xref="GOA:C7MLT1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT1"
FT                   /protein_id="ACU93887.1"
FT                   /translation="MCAYNAPMYTRTYARISAPFRRLKHGRLVVVTFDRMLVGLIAATY
FT                   LASIVWMVATGDDRALRLIMVPASSFIFVTVLRAALNAKRPYELFAIDPLIPRNRAGKS
FT                   FPSRHVFSAAIIACTLGYVYLPWGIAAFIAASIVACLRVIGGVHFPRDVLAALILALAC
FT                   GAIGFVLIP"
FT   gene            187936..188032
FT                   /locus_tag="Ccur_01560"
FT   ncRNA           187936..188032
FT                   /locus_tag="Ccur_01560"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            188153..188860
FT                   /locus_tag="Ccur_01570"
FT   CDS_pept        188153..188860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01570"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93888"
FT                   /db_xref="GOA:C7MLT2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT2"
FT                   /protein_id="ACU93888.1"
FT                   /translation="MDLVNIIIGLLHDPRAAIAGWIVALGPVLVYSPLFLIVFIETGVV
FT                   VFPFLPGDSLLFAAGVFSADGGGLNIAATLIVFYAAAILGNTSNYWIARFFGSRIIDSG
FT                   KVRALTPERMAKLDHFFARYGGLTIVITRFMPFFRTFAPFVAGTGHMNFGRFTLFNVIG
FT                   GTAWVSLFVLTGYFFGGISLVQDHFEVIVLGIVGISVLPAFISAVKTALSSRASKKSSA
FT                   EHPIHPSQNSEGK"
FT   gene            188865..191567
FT                   /locus_tag="Ccur_01580"
FT   CDS_pept        188865..191567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01580"
FT                   /product="DNA polymerase III, subunit gamma/tau"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: DNA polymerase III, delta'
FT                   subunit; DNA polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93889"
FT                   /db_xref="GOA:C7MLT3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT3"
FT                   /protein_id="ACU93889.1"
FT                   /translation="MAEALYRKYRPQVFGDVVGQEHIERTLKNAIEQDKVSHAYLFCGP
FT                   RGTGKTTMARLLAKALLCEKGPTSEPDGSCRECQEIAEGVHPDVYELDAASRTGVENVR
FT                   EEIIGRVNFAPTRGKAKIYIIDEVHMLSIAAFNALLKTLEEPPAHVVFILCTTDPQKVP
FT                   ETIHSRCQRFDFHRLSNEEIVSRLGAVCVAENVEFEGEALDLIAHRADGGMRNALTALE
FT                   QLIAFGEGKVTVAGAEDLLGSLDSSDLAEIMAAVGVRDAAACFSWVASYVETGADLAQF
FT                   TRDMAQQVRNLYVMSLAGTDAALDVTDAERRELASELKLFGPNRLTHLLSILGELSSEL
FT                   RTASNQRLAFEIALTRMIRPESDLTLEALAARIETLEEQLAQSKQPAQSTPSQREAVAQ
FT                   SESAAGIPVQASAHVPPVGASQPAQPVPVVVPQSPAATSVAAANPSTPAVSQTSVPVQG
FT                   AVQASMPASQSSATTATQSPTPATQSNSPVVQPTASVETAAGETAEIISNPAALQRVWR
FT                   QVVSIVKREKVSYGVLLVNASVQVQAGGQGVAILFPADNPLAFSMAQKPEVKEVLEGAF
FT                   RQAIGKDIPLALKQKPSSTTQGAASGEPLERSPLDSSANVTSSVESAPSAPPSASASVG
FT                   SLSMQQKSTTPPLSPIQAAAAAARARAREAAAAAAKGTAGEAAASLSTVQPAKSAELIT
FT                   SASMVVQPTERTAPVPTAAQPAESATVLSQSTESTASATAQISSVSNAADQEADASTVP
FT                   PAPTTFIEHAQRALAEAQRRAQGLPPSAAFTRESVAAADMPRTASNAVSNTASNTASSK
FT                   TARATSQQSTANSGAHQQESSGPDQGRSGNQQQSHSDVAAPQSLQNGMPQQPSEDESSQ
FT                   QSSADQADKLSKMLSDTMGLSIAFEEVDE"
FT   gene            191616..191921
FT                   /locus_tag="Ccur_01590"
FT   CDS_pept        191616..191921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01590"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="PFAM: Uncharacterised BCR, YbaB family COG0718;
FT                   TIGRFAM: conserved hypothetical protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93890"
FT                   /db_xref="GOA:C7MLT4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT4"
FT                   /protein_id="ACU93890.1"
FT                   /translation="MDMKKMMRQAQKMQAQLAAAQDEIKDMTYEASAGGGMVKATVTGE
FT                   MTLQSISIDPVAVDPDDTEMLQDMVLAAVNEALRGMADLSNTRLNAVTGGMNLPGF"
FT   gene            191955..192551
FT                   /locus_tag="Ccur_01600"
FT   CDS_pept        191955..192551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01600"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="PFAM: RecR protein; Toprim domain; TIGRFAM:
FT                   recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93891"
FT                   /db_xref="GOA:C7MLT5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT5"
FT                   /protein_id="ACU93891.1"
FT                   /translation="MYSAPSIQTLLDEFARLPGIGPKSAQRMVYWILNSDRASAERLSR
FT                   AIMEVKDTVHFCSRCFNYAEGDLCEICASPKRDQGIICVVSEPRDIPPIERTAAFMGVY
FT                   HVLGGALSPLEGIGPDQLHINELMRRLSDPQVTEVILATNPNVEGETTASYLARLIRPL
FT                   NIKVTRLASGLPVGGDLEFADEVTLSRAIESRRVI"
FT   gene            192605..193831
FT                   /locus_tag="Ccur_01610"
FT   CDS_pept        192605..193831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01610"
FT                   /product="dGTP triphosphohydrolase"
FT                   /note="PFAM: HD domain; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93892"
FT                   /db_xref="GOA:C7MLT6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT6"
FT                   /protein_id="ACU93892.1"
FT                   /translation="MVAENPLFSFTKEEAAFLREGQAEAQKALSPVATRDSEAIYERPD
FT                   TVDDDDALLRPAFTRDVDRILNNAFYNRCMDKTQVFPFYRNDDLTRRSFHLQLVAHISR
FT                   KISSALRLNGALTEAIALGHDMGHTPFGHGGERVLSDLYHARTGRYFNHNVHSVRLLRT
FT                   IAGRNLSLQTLNGILCHCGEKAFARYEPAACDTFAELDTLMEKCSTEAGASQTLRPSTL
FT                   EGCVVRICDMLAYLGKDRQDALTVKVFSDDDYPLFNSVIGTTNREIIHNVSVNLIKNSM
FT                   GHNYLSLDDEVFSSLVEAKERNAREIYASPAAHERLDQLIAPMMKRLYEQCIDDLKAGR
FT                   EESPIFRHHLNAWMMRNRDDYRNEETDDDKVVDYLASMTDEYFIALYNYLYPREAVSEE
FT                   DLYIPYFSH"
FT   gene            194441..195664
FT                   /locus_tag="Ccur_01620"
FT   CDS_pept        194441..195664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01620"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: Amidinotransferase; TIGRFAM: arginine
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93893"
FT                   /db_xref="GOA:C7MLT7"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT7"
FT                   /protein_id="ACU93893.1"
FT                   /translation="MTGVNVKSEIGPLKKVILHRPGKELLNLTPDTLERLLFDDIPFLR
FT                   VAQDEHDAFAQVLRDEGVEVVYLEDLMADVIRDNPALRDEFIAQWTQEAGIHTEKWQGI
FT                   IRDYLNSEYADPKALVEKTMEGINLAELDVDRSGSLIDLVSSPTKMVVDPMPNLYFTRD
FT                   PFAMVGTGVTVHRMYSVTRNRETLYGQYIFDNHPDFKGTPLYYRRDWAFHIEGGDVLNL
FT                   NSHVLAVGISQRTEPDAIDTLARGIFADETSSIDTILAFDIPNSRAFMHLDTVFTQIDR
FT                   DKFTIHPGILGPLTVFELTPAAGGEVSVKRLDSDLESILAKYVGCPVKLLQCGAGDRIA
FT                   AEREQWNDGSNTLCIRPGTIAVYERNEVTNDFLYKQGLELKVVPSAELSRGRGGPRCMS
FT                   MPAWREDI"
FT   gene            195888..197339
FT                   /locus_tag="Ccur_01630"
FT   CDS_pept        195888..197339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01630"
FT                   /product="amino acid transporter"
FT                   /note="PFAM: Amino acid permease; TIGRFAM:
FT                   arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93894"
FT                   /db_xref="GOA:C7MLT8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT8"
FT                   /protein_id="ACU93894.1"
FT                   /translation="MAEKVKGVGLFGLIGLVVSSCIGSGVFALTGQLANVAAPGSALVA
FT                   WLICGAGFLFLALSLANLGAKRPDIDGIYQYATAGFGPFSGFLSGWGYWLSAWLGNVGF
FT                   ATMVAQVFGSLMPGVFATETGDPNIAAIVCVSVFLWLLTFLVINGVESAAFLNAIVMVV
FT                   KIASILLFILFAIFTFKAGIFTEDFWGTMGRNATVMMVSDGEVELGDVSTQVTNCILIM
FT                   MWVFIGIEGATVMSKRAEKKSDVGKATIIGLIVLLVLYIGASVLPYGVMPYEELVAAPK
FT                   PATITVFEAMAPGWGGTFISVAIIISVLGSWLSFTMLPAETSSGMSEDHLLPASWNKMN
FT                   SKNAPRMALIIVAACTQVFLIIAFTAEDAYTFAISMCTVTIAITWAFAAAYQVKYALQN
FT                   HETSQLIFGIIALLFQVVGVLFTGWGFLLLACLGYIPGFFFYSQGRKEGGITAISGSEK
FT                   IAMVIISLLGVISIPLTAVGIIPVF"
FT   gene            197466..198584
FT                   /locus_tag="Ccur_01640"
FT   CDS_pept        197466..198584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01640"
FT                   /product="aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93895"
FT                   /db_xref="GOA:C7MLT9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLT9"
FT                   /protein_id="ACU93895.1"
FT                   /translation="MEIKTIGVEAFLNDYEHDAVWDIAQSTIASLEMSEILKLDGKDGE
FT                   TFYEQLNKQEMNYGWIEGSADFKNEVSKLYKNVDPANVLQMNGATGANLNVIMALVSPG
FT                   DHVIAEYPTYQPLYDLPAALGAEVEHWVIHEEDGWQPRIDDLKQLVRPDTKLICINNAS
FT                   NPLGTVIPTDLLGEIVEIARSVGAWILCDEAFYPLENPEVCTSIVDMYEKGVATNTVSK
FT                   DYSVPAARVGWTVCNKELADKLRVLRDYTMICSGVFNDALATYVLRHRDKIIERNVSII
FT                   QKNRAIVNEWIADEPRVSWIPPKGVSVSYIRLDIPEDDEKFCLDLLHDEGVLLVPGSRF
FT                   ELPRGARLGYCANEDILHGGLDRLSKYLKKYD"
FT   gene            198657..200195
FT                   /locus_tag="Ccur_01650"
FT   CDS_pept        198657..200195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01650"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain protein"
FT                   /note="PFAM: Cell envelope-related transcriptional
FT                   attenuator domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93896"
FT                   /db_xref="GOA:C7MLU0"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU0"
FT                   /protein_id="ACU93896.1"
FT                   /translation="MVQRGSKESSRTARGEYDRYSRSSRERTQGASRSRGRHTSDAAAS
FT                   LSRRGEKSTYSRRDGSARYSQQMHRKRRFSRIIKRTLITLVSLLVVGAIGAFAYMNYLN
FT                   GNLARGLGGLSNVLVKPSSNSQPFYMLLCGTDQSIQRDKDQSTGGTYRTDSMILARIDP
FT                   SSKTVTLISLPRDTKVELAGHGIQKLNAAYAFGGSELAVSTVAKISGVDISHFALVDMD
FT                   GLKEVIDALGGIEVDVPIDINDPDAGGHLSAGSQTLTGEQALILCRSRHAYDSYGDGDA
FT                   YRAADQRLVLQAIAKKLLSSDPVTIANTVTKLSDYVQTDMSVTDIAGLAQSMQGLDTEN
FT                   NLYTASMPTESVYENKTWYEEIVTDAWKAMMARVDEGLSPTDSTEIDKNTGVVLSNAGS
FT                   SEGSSSSSGGTSSVASADNKGGTVVVRNGSGKAGVASKVADKIKAAGYSVSDTGNADTF
FT                   NYKSTMVVYSDSANAQEAEDIAQVVGGGAIAKMNNGSYSMKGDFLVVIGSSYSG"
FT   gene            complement(200426..200878)
FT                   /locus_tag="Ccur_01660"
FT   CDS_pept        complement(200426..200878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01660"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Predicted SPOUT methyltransferase; TIGRFAM:
FT                   conserved hypothetical protein TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93897"
FT                   /db_xref="GOA:C7MLU1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU1"
FT                   /protein_id="ACU93897.1"
FT                   /translation="MLKITVIAPGKLKEQFWRNACAEYQKRLGSYVNLCVRELPDSTPE
FT                   KEGNAILAVIESLSGEVYTILLDIKGVPRSSEDIAAQLDKLAVHGISHVAFIIGGSEGV
FT                   SNCVRTAANERISFGPITLPHNLARVVLFEQLYRACKILRHEPYHK"
FT   gene            201239..202597
FT                   /locus_tag="Ccur_01670"
FT   CDS_pept        201239..202597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01670"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; Pyridoxal-dependent decarboxylase,
FT                   C-terminal sheet domain; TIGRFAM: diaminopimelate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93898"
FT                   /db_xref="GOA:C7MLU2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU2"
FT                   /protein_id="ACU93898.1"
FT                   /translation="MSLPTPKANAMADNRTTMELGAVLPATATVQDTHLFIGGVDMVEL
FT                   AHQQGTALYVYDEEDLRERMRAYRSSFNRLHPNSEVIYASKAFLNKAMARIAAEEGMSL
FT                   DVSGGGELAIARAAGFPADRVYVHGNNKTPEELEEAITAGVKCIVIDSRIELARVSQIA
FT                   ERHGITQDVFMRITPGVEADTHEYIRTGMEDSKFGFTMRDDFAFKCIDDVLAASHVRLA
FT                   GIHMHIGSQIFALHSYREAVAVAVDFIARIKKTYDYTIDVLDVGGGVGIAYQASDQPAS
FT                   IEEFATLVCESVDEECAKAGIENLRILCEPGRSIAAIPGVTLYTVGILKTLPGIRKYVA
FT                   VDGGMSDNIRTALYHADFEAVLANKADQPRTEVVTLCGKHCESGDAVVLDGSLQHPELG
FT                   DIVCVFGTGAYCQSMSSNYNGQVRPAVVFVRDGVARVVTRRQTYADLVACDID"
FT   gene            202732..204021
FT                   /locus_tag="Ccur_01680"
FT   CDS_pept        202732..204021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01680"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: Homoserine dehydrogenase, NAD binding domain;
FT                   Homoserine dehydrogenase; ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93899"
FT                   /db_xref="GOA:C7MLU3"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU3"
FT                   /protein_id="ACU93899.1"
FT                   /translation="MGVKLGLIGTGTVGGGCLDIINTHKQDFLHHYGIDLEVARVCSRN
FT                   PEQAISHGYGDCFTSDFHDIINDPDIDIVIELIGGTTTAKDIVMGALAAGKQVVTANKA
FT                   LMATSGEEILDLADKMHCEVAFEASVGGGIPIIVPLKHSLISNEVSSILGIVNGTTNYI
FT                   LTLMAESGINYSDALALAQEKGFAEADPTADVDGLDAAAKIAILASIAFNTRITMDQVY
FT                   HEGIRLILPTDLTAAQDMGYCVKLLALANRTDEGIDVRVHPTMVPLDHPLAAVNGVDNA
FT                   IYVKGDAVGETMFYGEGAGAGPAASAVMGDVLETARRLQAGCQPFVGCTCTDTLPLVPM
FT                   ENLTTRYYIRFEVEDRSGVLAATANVFSNHDVSVYSVIQRGKNEGGTVDLVYITHTARE
FT                   RDIRKVLSDIRCLEGVLVDDSEPTVIRVQK"
FT   gene            204214..205185
FT                   /locus_tag="Ccur_01690"
FT   CDS_pept        204214..205185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93900"
FT                   /db_xref="GOA:C7MLU4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU4"
FT                   /protein_id="ACU93900.1"
FT                   /translation="MSDEINSTPESATPASNPQQPSTAPATPLTPDQTVAAPATPPAPG
FT                   APQQSNSSNGKAIGALVCGILAILASGTIIFGVILGIVAIILAAQVAKDGTRDGKVTAG
FT                   KVCGIIGIVFSILYAIFAFVLGVSIFNAIQNGSINPSAFDNPSSNNVVNAIGSATGNDE
FT                   AAVRSAVDDIMNTLVGKEAVSAAADQADAGFSSVTGFSLDQIGIDKQEYANWALGGITY
FT                   SIDSVSIDGDTAKANLTLNVRDFGQFSDLFSDKLTEALTGSEITSQDLMYAQMGSAMKE
FT                   AMDETGTVPTAATLTLTRTNGTWTVDYSSVSSLSTSILSTLN"
FT   gene            205731..207692
FT                   /locus_tag="Ccur_01700"
FT   CDS_pept        205731..207692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01700"
FT                   /product="Glucan-binding protein C"
FT                   /note="PFAM: Glucan-binding protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93901"
FT                   /db_xref="GOA:C7MLU5"
FT                   /db_xref="InterPro:IPR013574"
FT                   /db_xref="InterPro:IPR036234"
FT                   /db_xref="InterPro:IPR041324"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU5"
FT                   /protein_id="ACU93901.1"
FT                   /translation="MQRSLFQRTGAIALSLLIAVALLPISPQQAAAVDPEKGIEVAVDS
FT                   SSLDAAVTAAKADGVTVTQDADVDKGSATSQAELDAKKAEITEDYNSQIEALKAAAQEA
FT                   RQKLAEYATKKAAYDTALAQYNTDKAQYDSDLAQYNTDLAAYNAAMEELERKKNEDGYM
FT                   KEPASQSLTFQSEPNATMSFPNGDQTYTQSEWKTYFDNNISSQLGSNPAYGANDFNYIN
FT                   SVANADETRVILHKDQPLKVQYTNLQNSYFNGKKISKVEYTYTLKNTGLPGVNSMPALI
FT                   EKDPTVTLWYLNFYGEADINMKVKFYDEDGNVIDPTGALLNFSSLNHGIGTSSTPKVDG
FT                   QDTVEKVRSFNGEFIEISGSSITKQPDGGAYASNNNEQKSAGSRFNTSEWDSDTNSNAW
FT                   YGAIVGKVTNPEININIGASKRGVVWFALNSKIKAIAAPPKPVEPTPPTPPTEPVKPVI
FT                   TASYHYDVLYVKPQVEKKVLDQDNKDIDTNTVKTGSIVKFELTTTPFPAGHETIDSVIF
FT                   RDTLPEGYELDLEATKSASPDYDVEYDETSRNLVFTGKDALITQINADRTKEAAVPAPM
FT                   VVGKVTKEGTTYENQFDLDINHTYSVKSNTVKVSTPEKPSVSPKTGDDTVLIPITLMVL
FT                   SAAALGARRVITRKNQSF"
FT   gene            208158..208604
FT                   /locus_tag="Ccur_01710"
FT   CDS_pept        208158..208604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01710"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: Ribosomal protein L13; TIGRFAM: ribosomal
FT                   protein L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93902"
FT                   /db_xref="GOA:C7MLU6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU6"
FT                   /protein_id="ACU93902.1"
FT                   /translation="MEETLKTYYAKPNEVEREWVLIDAKDQILGHVAVKAATILKGKHK
FT                   PQYTPHVDTGDFVVIVNADKVQLSGTKAAKKEYFRHSGYPGGLKSETFAEAMQKHPERV
FT                   IEHAVKGMLPKNTLGRAMGKKLKVYAGPDHPHAAQQPREIKMGE"
FT   gene            208608..209000
FT                   /locus_tag="Ccur_01720"
FT   CDS_pept        208608..209000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01720"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: Ribosomal protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93903"
FT                   /db_xref="GOA:C7MLU7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU7"
FT                   /protein_id="ACU93903.1"
FT                   /translation="MAGEAMYYGTGRRKNAIARVRLVPGTGKVTVNGRDAAEYFGRHQL
FT                   IDYATAPFKVTDTEDHFDVIARCNGGGISGQAGALRHGIARALLSAGEYRPELKKAGYL
FT                   TRDSRMVERKKYGLKKARKRPQFSKR"
FT   gene            complement(209643..210341)
FT                   /locus_tag="Ccur_01730"
FT   CDS_pept        complement(209643..210341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01730"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: B3/4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93904"
FT                   /db_xref="GOA:C7MLU8"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU8"
FT                   /protein_id="ACU93904.1"
FT                   /translation="MKLLVDESITQLGVENVVIGIAKNVDPSASLPDSFLKKQKDMEDW
FT                   ALSCTMDDVLDFPVVRGYTDLLQRAKRSIKKNPPTVPALIRNIQHRGSIPHINSVIDIY
FT                   NVESLHSLLAIGGHDLDKVDDYIEFTINKKEGVFLPILSTEKHVAETDYVYRDAKGIMA
FT                   WLDVRDGENYKFDDKTKNAIFIIQGNAKTSVEYRLEALERIQNDLTACMPNVRFKTYVV
FT                   HAGMELDVEN"
FT   gene            210483..212603
FT                   /locus_tag="Ccur_01740"
FT   CDS_pept        210483..212603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01740"
FT                   /product="glutamine synthetase"
FT                   /note="PFAM: Glutamine synthetase, catalytic domain;
FT                   TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93905"
FT                   /db_xref="GOA:C7MLU9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLU9"
FT                   /protein_id="ACU93905.1"
FT                   /translation="MAEIGEDRIKMSEIEQLYGSEVFNDGVMRDKLPSSIYEVLFRTIK
FT                   EGEPLDLEVANVVAHAMKDWAISHGATHYTHWFQPLTGITSEKHDSFLDPVGDGSAITK
FT                   FSGKELIQGEPDASSFPNGGLRATFEARGYTAWDPTSYAFIKDEVLCIPTAFCSYTGEA
FT                   LDKKTPLLRSMSVLSQQANRVLSHFGEDGHRVITTVGGEQEYFLISEADYEKRQDLMFT
FT                   GRTLFGAPPVKGQELEEHYFGAIRPTVNEFMKELDDELWRLGIAARTKHNEVAPCQHEL
FT                   APVFTNSNRAIDENLLTMEKMKLLASHHGLACLQHEKPFEGINGSGKHNNWSMSYGSTN
FT                   LLEPGDTPMDNLRFLIFMTCVIACVDDYQELLRMSVASAGNDHRLGAHEAPPAIVSIFL
FT                   GDELTGIVDALINDHPYQSAACVSMDLGVDVLPNFLKDNTDRNRTSAFAFTGNKFEFRM
FT                   PGAQVNLSDCNMILNTAMAYALKQFADAVEGLSGAAFEAAALEYIKHSLTEHQRIIFNG
FT                   NGYGDDWPIEAARRGLANNRNTAEALPCFVSQKSLDLFSEMGVLNEAEVRSRYEVKLEK
FT                   YVKTLNIECNVMQRMTRRNYIPAINAYATKIAKGITTVKDALAGADLSDQEELLERLLD
FT                   GLRTINVAHRNLLQAHQKAEAIVDKQEQANCYAEEVVPAMEALRVGVDAMEGITDHGYW
FT                   PVPTYNDILFYA"
FT   gene            212886..214679
FT                   /locus_tag="Ccur_01750"
FT   CDS_pept        212886..214679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01750"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunit"
FT                   /note="PFAM: FAD binding domain; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93906"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV0"
FT                   /protein_id="ACU93906.1"
FT                   /translation="MPTSFSLSRRNFLAGAGIAAASAAALGLSGCAQPKSASSKAQDSA
FT                   KGSSTASGSTVGYDGTGTMPWLGEKPSISDSDVEETLNADVVVVGLGAAGVPAARAAAE
FT                   AGAHVVALEASASLNSVASDMAIFGGQTQAKWGRGDGFLDKKTIVNMHMSECSHHCNQR
FT                   IIEKYYTESGKALDWFVEASKDLYFSPETYSEIPAESQSNYMYPYFVPMLPSYDYTKED
FT                   MPCYPTSVGFSSLKTVMQDNLQVAVDKGADVRYNTKGVELITDDSGAVTGVYAQESKSS
FT                   KYIKINAKSVIIATGDYLMNEDMMKFYAPQCIENGIKTLSLDMDSTGGYTNVGDGHKMG
FT                   VWAGAAIEQWHAPMIHHMGGGAGADGRGVIGNNGYLWLNLRGERFMNEDVAGQQLENQV
FT                   ELQPQRKAYQFFDASWPEQLQYFPAAHGVACYYLESELPDYTASGLKINCRTAADIDQA
FT                   VAENRCLKADTIDELLSKIDGMDVDTAKKSIERYNELAKAGSDEDFGKSSQRLFALENG
FT                   PFYAAECGTALTLGNLGGFDSDEDCHVYNTNREQIKGLYTCGATQGGRFNVQYPISLKG
FT                   LSCGMCMVYGKIAGENAAAGK"
FT   gene            214849..216489
FT                   /locus_tag="Ccur_01760"
FT   CDS_pept        214849..216489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01760"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93907"
FT                   /db_xref="GOA:C7MLV1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV1"
FT                   /protein_id="ACU93907.1"
FT                   /translation="MDETQQNGASSSRRRLTPIPLRATQVLGLCFYWAWVYLSFNSTSS
FT                   INLNLAIDTKLLWVHVASSSVGVLIYLLATVFSRAALRLFFDRRILLVAGIVMAVGTAC
FT                   YALPLSLPFPLVILGALLTGISSPVVLVNWGALFSGFSARAIVLSTAGAFFVANGVYFA
FT                   SLFLSPWGICLLEIVLPLCATLLIPDRELMDRYLGDRSHSIEQRGGQAFPAPSSTSMHG
FT                   ANGGARADGVVGISGVDGAGVDSANGGAADAGHATGMGGRANWSGTKRMLVLPRALPWR
FT                   VALGLFVIMLVYGGVRVYVGVADAQPGEGLFLTALLTGVSIVCFCIWGAFFQGENASLG
FT                   TIYKIMLPLLTCALLMLALFGQEYATLTAALVTTCNIVIELLSWILLADMARTTRMPAI
FT                   VVFAVGRGAVQAGMMIGQIIGWFMIDSIIPFAIVSVFALMLVMGFMFDAQDTLLVFEAP
FT                   TAAERDEVEQRTGQPLDSRLQKVAQTCGLTARETEIFMLWATGHGSKYIQDSLVISAST
FT                   VKTHVRHIYDKCGVHNRAEIIDLLENGNA"
FT   gene            216621..217790
FT                   /locus_tag="Ccur_01770"
FT   CDS_pept        216621..217790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01770"
FT                   /product="branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /note="PFAM: Aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93908"
FT                   /db_xref="GOA:C7MLV2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV2"
FT                   /protein_id="ACU93908.1"
FT                   /translation="MGIDSSGYIWLDGQIVPHVQALIPLDSPAVLSGAVIVESIACSTN
FT                   IPHETALSTVVGVDTSSTVEQPARGNSVTQQSGARESATQQPGERRFLFRVRDHFERFE
FT                   RSCRIAGIALPFDIDRLCVAAAEVVRMCSDMPACVQAVAYCGIPETHATKESLGVPNST
FT                   VHVALLPMKQSVRYSASDGVVDNTAIAGQTHSGGNKTSSSDDTFVLNVPESSGVHAEIS
FT                   SWRQLSPNALPVALQSIAARFHAELVLDQVRRSGFNEAILLDEAGRVSSVARGNLFIVR
FT                   DHYLSTPPASDGAPEGITRDTVLCLAEDLHHEFDLHILEESMTRADLYAADQAFACSTT
FT                   RGIRPIVSIDHRSLRGGPSTRGIVEALQERYRACLAGEIEEYRDWLYEV"
FT   gene            217891..218190
FT                   /locus_tag="Ccur_01780"
FT   CDS_pept        217891..218190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01780"
FT                   /product="TrpR-related protein YerC/YecD"
FT                   /note="PFAM: Trp repressor protein; TIGRFAM: TrpR-related
FT                   protein YerC/YecD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93909"
FT                   /db_xref="GOA:C7MLV3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV3"
FT                   /protein_id="ACU93909.1"
FT                   /translation="MSDLRTPSVEVLLDVLVGVADKDTAFALIEDLFTIREIRETSQRL
FT                   AVARMLDEGKPYVAIEEATGASATTIARVSKALNYGSGGYRHALDILQAQSGGQ"
FT   gene            218193..219017
FT                   /locus_tag="Ccur_01790"
FT   CDS_pept        218193..219017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01790"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93910"
FT                   /db_xref="GOA:C7MLV4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV4"
FT                   /protein_id="ACU93910.1"
FT                   /translation="MNRGTSDKQSSDQSTVSVNAPSSAGLSAGQMDLVNQEASAAQETP
FT                   TSWSASANRIASLPTPQLLRVDQVSDGWIKKYLLTYRLPDGKEFTYESISRKGLEAYRA
FT                   ELESFAHNALHPSRRLVADAVCIVPRTADDRLVLIREFRYPVNSWCIAFPAGLIDPGET
FT                   VEQAVERELREETGYALRRDVHGQAHVRTLSQPGFSSVGMSEESVQVVYVHVENEPTLG
FT                   QMTESVEYIQVFTVPVRDVPRFLNENALPIGTRAQLILEAFSNNVKRYGVAH"
FT   gene            219309..220736
FT                   /locus_tag="Ccur_01800"
FT   CDS_pept        219309..220736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01800"
FT                   /product="aspartyl aminopeptidase"
FT                   /note="PFAM: Aminopeptidase I zinc metalloprotease (M18)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93911"
FT                   /db_xref="GOA:C7MLV5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV5"
FT                   /protein_id="ACU93911.1"
FT                   /translation="MGKKNAWKSYDAADEAQLNQLNNDYIDFISTCKTERECANRAIEM
FT                   AREAGYISLEEARIQKRPLAPGAKVYASVYGKTVMLVHLGKRPLEEGFNILGAHIDSPR
FT                   LDIKQNPLYEAQGFALLDTHYYGGIKKYQWVTLPLAIHGVVVKPNGESITVNVGEDATD
FT                   PVFCVTDLLIHLGADQLEKKGGKVVEGEDLDLLVGSRPFVLDKQDIKDAAEGSLEEMAA
FT                   TSPVKAALLSLFQDKYGFTEEDFLSAELEVVPAGRARSCGFDASMVLGYGQDDRVCAYT
FT                   SLIAQLEAEDIQRTAICLLVDKEEIGSVGATGMTSLFFENTVAEIMELAGQGGDLARRR
FT                   ALAASDMLSSDVSAGLDPLYASAFEEKNAAHLGCGLVFNKFTGARGKSGSNDANAEYMA
FT                   KIRAIMDGGAVRFQTAELGKVDQGGGGTIAYILAKYGMNVIDCGVAVLSMHAPWEVASK
FT                   ADIYEAKKGYIAFLQQA"
FT   gene            220856..222373
FT                   /locus_tag="Ccur_01810"
FT   CDS_pept        220856..222373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01810"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /note="PFAM: IMP dehydrogenase / GMP reductase domain;
FT                   TIGRFAM: inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93912"
FT                   /db_xref="GOA:C7MLV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV6"
FT                   /protein_id="ACU93912.1"
FT                   /translation="MAYIFEEPSRTFNEYLLVPGYSSSENRPENVSLKTPLTKFKKGEE
FT                   PAISLNIPMISAIMQAVSDDGMAVALATEGGMSFIYGSQTIADEAAMVARVKAYKAGFV
FT                   VSDSNLTPQMTLGEVVALAEKTGHSTMPVTDDGTAHGKLVGIVTERDYRLSRMSLDEKV
FT                   ADFMTPRAELITAPADTTLKQANDIIWDNKLNSLPLIDTDDKLAYMVFRKDYDSHKSNP
FT                   NEMLDEHKRYMVGAGINTRDFAERVPALVDAGVDCLCIDSSEGYSEWQALTLKWIRDHY
FT                   GDSVKVGAGNVVDAEGFRFLADAGADFIKIGIGGGSICITREQKGIGRGQATATIEVAR
FT                   ARDEYFKETGVYIPLCSDGGIVYDHHITLALAMGSDFVMLGRYFARFDESPSNKVMVNG
FT                   SYMKEYWGEGSARARNWQRYDLGGDKQKMSFEEGVDSYVPYAGSLKDNVGLTLSKVKST
FT                   MCNCGALTIAELQDKAKLTVVSSTSIVEGGAHDVLQKDKTPYVSNAN"
FT   gene            complement(222392..222844)
FT                   /locus_tag="Ccur_01820"
FT   CDS_pept        complement(222392..222844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01820"
FT                   /product="rrf2 family protein, putative transcriptional
FT                   regulator"
FT                   /note="PFAM: Transcriptional regulator; TIGRFAM: rrf2
FT                   family protein (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93913"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV7"
FT                   /protein_id="ACU93913.1"
FT                   /translation="MQISTKGRYALRFLLDLCQHQGTGPVPLKDIAQRQGISKKYLEQV
FT                   IALLNPTGILQVTRGYQGGYRLAKAPRDITVADVLAVTESGFTAGAASTGTNVDTTERS
FT                   ASLLSSNETMLEPIWEGLEQTVNDYLAEISLQDIIDRYTPTIEYFI"
FT   gene            222983..224146
FT                   /locus_tag="Ccur_01830"
FT   CDS_pept        222983..224146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01830"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93914"
FT                   /db_xref="GOA:C7MLV8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV8"
FT                   /protein_id="ACU93914.1"
FT                   /translation="MGAGASEFIYLDHAAATPLDKQVRAAMEPYESRLFFNPSSPYMPG
FT                   VQVRRSFEAARADLAHAIGAKPDEVVITAGATESINLAFDSFEGHVVIPEVEHASVLAS
FT                   ATRHDCTQVAVGHHGRVDPADIARAIRPDTELVSVGLANNEIGTVQPLRAIAQVVSEER
FT                   QRRLQAGETTPIWLHTDASQGAGQVNTDVATLGVDLMTLNSAKVYGPKQVGLLWAARTV
FT                   RLRPQVVGGGQERGLRSGTENVSGAVGFACALSMAVTHRKAEAVRLSALRDTLQSALTE
FT                   AFPQAVVSGHRKHRLPGFLHISFPGLDAERVVFLLEDVGVLVGTGAACAANKETGSHVL
FT                   AAIGLPPDLANGSLRLTLGRLSTADNTARAAQLIIEAVRSEYERMAR"
FT   gene            224251..225435
FT                   /locus_tag="Ccur_01840"
FT   CDS_pept        224251..225435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01840"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93915"
FT                   /db_xref="GOA:C7MLV9"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLV9"
FT                   /protein_id="ACU93915.1"
FT                   /translation="MSKSAPKHAQVAEALDPTVDAAEADALAATKDDLYQFAHMFQRDH
FT                   QRIPRVLVGLSGGVDSSVCAALLVETGWDVCGAYMKNWTMDVPGMRCPWADDLADAKRV
FT                   AVRLGIDFRVYDFQEAYKREVVDYLVDEYRAGRTPNPDVMCNQQVKFGLFFDAAQDDGF
FT                   DYIATGHYARASHDPVRLLRAADTHKDQTYFLYRMSSDAVAHTIFPLGGLLKTQVRAAA
FT                   EQRNLSTAHKADSQGICFVGEAGICDFLSLYVHPQPGPIIDDDTGETVGYHDGAIFFTI
FT                   GQRHGLGIGGGRRYRVVRKDMDHNILYVHDGPLAPVQDSLLELDRVRWIADVPPQEGAC
FT                   EVRTHHGEKLLAATLLATATTATVQLEADHDAVASGQSVVIYRGQECLGGGIVR"
FT   gene            225753..228338
FT                   /locus_tag="Ccur_01850"
FT   CDS_pept        225753..228338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01850"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="PFAM: tRNA synthetases class I (I, L, M and V);
FT                   Anticodon-binding domain; tRNA synthetases class I (M);
FT                   TIGRFAM: leucyl-tRNA synthetase, eubacterial and
FT                   mitochondrial family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93916"
FT                   /db_xref="GOA:C7MLW0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLW0"
FT                   /protein_id="ACU93916.1"
FT                   /translation="MKEYNPHEIEPRMQQAWAAADLFHVTEDADKPKKYVLEMFPYPSG
FT                   DIHMGHVRNYSIGDVVARYNGMRGFNVLHPMGWDAFGLPAENAAIKHHSHPATWTYANI
FT                   ETQKASFKRMGFSYDWDRTVVACDPEYYRWGQWMFLQFWKRGLVERRNSPVNWCPSCKT
FT                   VLANEQVVDGRCWRCGSVVEKRDLTQWYLKITDYAQELLDDLDQLTGWPDRVRQMQANW
FT                   IGRSEGAEVDFILCDKGGAVPENPSDHDRITVFTTRADTLFGCSFFVLAPEYKGLIDLV
FT                   VGTEYEQPVRDLIDATAQVSAVERAQGDREKHGVFTGRYVINPINGEKVPVWVADYVVA
FT                   DYGTGAVMAVPCGDQRDFEFARKYDLPIVPIILDKDDELYNQLKDEHGRVVTTVDWDAA
FT                   FAAEGWLVQSGKYTGLKGGKHSEGESAIVADLEARGCGRRKVEFRLRDWLISRQRYWGN
FT                   PIPAIHCPTCGVVPVPEEDLPVRLPEDIDLAAGETLATHEGFVKCTCPRCGGEARRETD
FT                   TMDTFTCSSWYYLRYTDPHNDTVPFARDNANRWMPVDQYVGGIEHAILHLLYSRFFTKM
FT                   LRDMGMLDFNEPFTNLLTQGMVKDAHGETMSKSKGNVIAPEDMIAHYGADAVRTYILFM
FT                   APPDKDLQWDEEGLAGIYRFLTRVWRQVNDLMGKAGESTLFDPTAQNAGKASSVEQAAK
FT                   VLRRERHRVVGKVTNDMERNSFNTAIAAIMELSNAVGSYVRVASAEMRAADPELAALDR
FT                   EVAEVLVKLLSPMAPHWADELWETVLDNQGYLYGCVWPTFDAQAAQADEVELAIQINGK
FT                   VRAHITVGADAAEDEVREQALAAIKDQTEGQTVAKAIVIPGRLVNIVVR"
FT   gene            228607..229683
FT                   /locus_tag="Ccur_01860"
FT   CDS_pept        228607..229683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01860"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93917"
FT                   /db_xref="GOA:C7MLW1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLW1"
FT                   /protein_id="ACU93917.1"
FT                   /translation="MASQDTPAIKETGHTQRYEAHRARKIVLIAFCVALLVVLFVLGLA
FT                   VGRLQVPPADVVGILSQRFFGTDGSWSQAAINVVCDIRLPRVIAALLVGAALAISGASY
FT                   QGLFKNPMVSPDILGASAGASFGAALALLMDGSNRVVQIMAFAMGFIAVMLTYFSARRI
FT                   GRGSNQILLLVLCGLIVGTLFQAFVSIIKYTADPTSKLPEITYWLMGSIAKVTWDDLKI
FT                   FAVPFVVGCAPLLLLRWRLNMLSFGDAEAESLGVNVSLMRAIYIFCATLLTSAAVSIAG
FT                   VVGWVGLIIPHLVRFIFGPDNRIVLPLSLVVGAAFMVLVDMVCRTLMASEIPLGILTSV
FT                   IGAPFFFAILLQTQRGQR"
FT   gene            229680..230648
FT                   /locus_tag="Ccur_01870"
FT   CDS_pept        229680..230648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01870"
FT                   /product="ABC-type cobalamin/Fe3+-siderophore transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93918"
FT                   /db_xref="GOA:C7MLW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLW2"
FT                   /protein_id="ACU93918.1"
FT                   /translation="MSENKAVQSETLEQKTTQIETTHGAVRHNEPIQVEPMRSAAGQGT
FT                   PMQPTVSQTELPSSEIYLRASDVSCGYAGKAVLSGVSLDVSAGDITCLLGPNGVGKTTL
FT                   FKALLGFLPLMEGTVQVCGHDRASLSRRELARLLAYVPQIHVPPFSFSVLDVVLTGRSP
FT                   HLGVFSSPTKSDYALADHVLEELEIFHLRDRVYTELSGGEAQMVLIARALMQDTSLLIL
FT                   DEPTAALDFGNQVHVLRRIKDLARDGRGIVMTTHNPDHAFLCGTKAVLLSRSGKVRSGT
FT                   VDDVVTEENLAAAYGIDVRVVESRAEDGSPVKTCIPSLGSG"
FT   gene            230701..231819
FT                   /locus_tag="Ccur_01880"
FT   CDS_pept        230701..231819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01880"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /note="PFAM: Periplasmic binding protein; TAT
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   TIGRFAM: Tat (twin-arginine translocation) pathway signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93919"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLX9"
FT                   /protein_id="ACU93919.1"
FT                   /translation="MKSKNELILDEVSRLSRRDFLKLAGIAGLTAATGGMLAGCGNGNG
FT                   GSNSSDSSNQATTQMVTDMNGNQVEVPLNPTKYADGWYAHNEITIMLTGAEGLVATHCD
FT                   EKSFPWMYKVCSNMSKATATFGNDFNFEDLVALEPQVIFDSKESLRDKCEEVGIPLVNC
FT                   NFQTYETMQQSIELTAQVFGGKAPEIAKKYNDELSSTVSAVKAKTDKLSDSDRPRVMHG
FT                   NSVYTFILDGTETIIDTWIQAAGGVNAVAESTKGNAQAQFSLEQIIAWDPEVIITGKAA
FT                   EVDQILSDPNWSSISAVKNNKVYVNPKGVFGWDRYGVEELLQIQWVSALLHPDLFPDLD
FT                   IRTKVKDFYATYLNYQTTEDDIDRIMGAQNPA"
FT   gene            complement(232071..233036)
FT                   /locus_tag="Ccur_01890"
FT   CDS_pept        complement(232071..233036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01890"
FT                   /product="DNA-binding protein, excisionase family"
FT                   /note="PFAM: Prophage CP4-57 regulatory protein (AlpA);
FT                   TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93920"
FT                   /db_xref="GOA:C7MLY0"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY0"
FT                   /protein_id="ACU93920.1"
FT                   /translation="MALESDALTAQEVAELLQVSRNTVYNLVKKGVLTSYSVGRKMRFS
FT                   MSDVDHYIEAARNCSASSAPAEVLSSTAPAVSHTATMPTQQMGTPVLRIGGTDMTADIV
FT                   ANYLGTSGIAVQRSYEGGYQALCAMYLQGAEAAVIHLYDRKTNRYNIPSIQRIVPGTPL
FT                   VAIHLAKRRVGFLVQNGNPHHIRSWRNLLNPAITIANRPVGTEERVLLDEMLVNLEAGE
FT                   NRPRGYQHEFTSVLAAAGFVKAGAADVCIGDERTFHQVEGIDFLPLAEESIDLAIRKTD
FT                   TTREVIRFLRGMVKSRLFKEELARNIGYDTFRTGEIIYEV"
FT   gene            233281..233706
FT                   /locus_tag="Ccur_01900"
FT   CDS_pept        233281..233706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01900"
FT                   /product="molybdenum-pterin binding domain protein"
FT                   /note="PFAM: TOBE domain; TIGRFAM: molybdenum-pterin
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93921"
FT                   /db_xref="GOA:C7MLY1"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY1"
FT                   /protein_id="ACU93921.1"
FT                   /translation="MKISARNQLKGTITNVAEGAVNGVVTISLGDERVKADITMESIEK
FT                   LGLTEGKPACAIIKAANVMFATGSERITNISARNQLPGTIVSVKKGAVNGHVSLKMADG
FT                   NVVSGSITNAAIEDLGLEEGAAALAIIKATDVIVGVE"
FT   gene            233927..234616
FT                   /locus_tag="Ccur_01910"
FT   CDS_pept        233927..234616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01910"
FT                   /product="uncharacterized membrane protein"
FT                   /note="PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93922"
FT                   /db_xref="GOA:C7MLY2"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY2"
FT                   /protein_id="ACU93922.1"
FT                   /translation="MVRFLKNTGRRLAKIIVAVFIVAVAVVVIPNVVEFATQQSNVKPS
FT                   DEIASSRKTYDCILVLGASMLPNGQPSTVLKDRLDVAVNLYRKGVAPKIVMSGDDSRAL
FT                   SYDEVTNMKKYAVEQGIPSEDIFCDHAGINTYDSMYRARYVFNVESMVVVTQTYHQYRA
FT                   LFDASSFGIDCVGAPSDLNSYEKKLIFEIREMGARVSDMRKVIMRENATHLSEPVSLQQ
FT                   SGDVTTW"
FT   gene            234984..236333
FT                   /locus_tag="Ccur_01920"
FT   CDS_pept        234984..236333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01920"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93923"
FT                   /db_xref="GOA:C7MLY3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY3"
FT                   /protein_id="ACU93923.1"
FT                   /translation="MDGSTVSAGSIDAISEEEKRRTLNRVAFSSFLGNFIEWFDYASYS
FT                   YLATVLAVVFFPGEDKVVATMSTFAVFALAFLVRPVGAIFWGNMGDKKGRKWALSISIL
FT                   LMSGATFLIGCLPGYAVLGVGAPILLLLLRMVQSFSASGEYAGASTFIAEYAPKQRRGF
FT                   FCSFVPASTATGLLIGSLAATLMFSVWGASSDFVVNWGWRIPFLVALPLGYITHYIRVH
FT                   LEDSPIYAQMQDAIDQKSAEAEDHPIRALFTKHGRKTIISFGACVLNAVGFYAVLTYLP
FT                   NYLEVTLNYDSAAASTITTIVLVLYIAFIFTAGRISDKVGRKRMLITACVGFIIFTIPA
FT                   FHLLASQDFIVILLVELSMCMLLTINDGSLASYLTETFPTEVRYSGFAFSFNLANAIFG
FT                   GSASYIGFALINATGDPVAPAYYLVAIAAIALVAMLLSHEHAGKDLSHVK"
FT   gene            236363..237511
FT                   /locus_tag="Ccur_01930"
FT   CDS_pept        236363..237511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01930"
FT                   /product="N-dimethylarginine dimethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93924"
FT                   /db_xref="GOA:C7MLY4"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY4"
FT                   /protein_id="ACU93924.1"
FT                   /translation="MAKIVSSWNDWDPLKRVIVGRCDNSMIPPEEPATSEKVPVDSAMR
FT                   GMWGPRPLETVERGNECLENLVKVLEDHGVIVDRPTPLQWNQAIGTPDFRNDSMMTCMP
FT                   PRDILLTVGPEIMAAANSFRCRYFEYLAYWPLMEQYFEEDPEFLWTQAPRPRLTDKSYK
FT                   HNYYDESISLEERLKRTAAKDFVTTEVEPMWDAADVMRMGKDLFIQHGLTTNRAAMEWF
FT                   QRYYRDFRVHAVNFPGDPYPIHIDATFVPLRPGLIINNPVRPLPEEQRAIFDANDWQIV
FT                   DAAQPAHTEPPALCYSSVWLSMNCLVLDPKTVIVEASEVHQLEQMDKLGMNVIPCDLRD
FT                   AYPFGGGLHCSTADVYREGDCLDYFPNRVKDPTLVRPELWND"
FT   gene            complement(237713..238960)
FT                   /locus_tag="Ccur_01940"
FT   CDS_pept        complement(237713..238960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01940"
FT                   /product="Mn2+/Fe2_transporter, NRAMP family"
FT                   /note="PFAM: Natural resistance-associated macrophage
FT                   protein; TIGRFAM: NRAMP (natural resistance-associated
FT                   macrophage protein) metal ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93925"
FT                   /db_xref="GOA:C7MLY5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY5"
FT                   /protein_id="ACU93925.1"
FT                   /translation="MSALADRLKNIGPGALVAAGFVGPGTVTTCTVSGASYGTTMLWAL
FT                   LFATVSTIIFQEMAARIGIATQEGLGENIRDNIKNPALKWIAIIIVIVAIFIGNIAYET
FT                   GNITGGILGIQSIYPDASMIAIAIVVGAVAFGLMWAGSYDLVEKVLTAIVVFMGVVFLV
FT                   TALASPVDWGAVLAGLFSPQLPTNDNKGLLTAIGLIGTTIVPYNLFLHASGAAERWSDP
FT                   KQIADARFDSILSIGLGGVISMAILICAAANLQPLGIQVKNGADMALALQPLLGNWATW
FT                   MIALGLLAAGVSSAITAPLSAAYAVNGVLGWKKGLKDIRFKTIWGIVLVAGVVMAVALG
FT                   KSPTQLILVAQAANAILLPIMAFFVMYCANSKKLGPVRNHLFANVAGVVIILITLFICY
FT                   RNFSSFVTSLQSLLGA"
FT   gene            complement(239063..239830)
FT                   /locus_tag="Ccur_01950"
FT   CDS_pept        complement(239063..239830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01950"
FT                   /product="uncharacterized lactam utilization protein B-like
FT                   protein"
FT                   /note="PFAM: LamB/YcsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93926"
FT                   /db_xref="GOA:C7MLY6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY6"
FT                   /protein_id="ACU93926.1"
FT                   /translation="MSENLHIDLNSDLGESFGRYNLGMDSEIIPLVSSVNIACGSHAGD
FT                   PVVMRDTVQLAAQAGVAIGAHPGYPDLQGFGRRDMHLSPDEAYCFVLFQLGALAGFCQA
FT                   QGVRLVHVKPHGQLYNTAAKDAELARAIASAVYDFDPTLTLVGLAGSYLVQAGRDAGLP
FT                   CVGEFFVDRNYTDEGALVPRNQPNALIEDADFAVKRLCTFVQTGTVESVSGNIISIDAQ
FT                   TACVHGDSPQALDFVRTCRHALAQAEISVCANR"
FT   gene            complement(239872..240642)
FT                   /locus_tag="Ccur_01960"
FT   CDS_pept        complement(239872..240642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01960"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF1445)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93927"
FT                   /db_xref="GOA:C7MLY7"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY7"
FT                   /protein_id="ACU93927.1"
FT                   /translation="MTPREMRYRIRTGEFDQPTSGLCPDYAQANLIVLPREEAFDFLLF
FT                   AQRNPKPCPLLEVLDPGVRQTNICAQDCDIATDFPRYRIYRDGELTDEVTDIAHLWRDD
FT                   LVSFVIGCSFSFESELIEAGIEMRHNTQGRNVSMYKTNIACRPAGMMSGNMVVSMRPIP
FT                   AEQVVLACQISGALPAVHGAPVHIGDPTVIGIKDLSQPDFGDAVDINPGEVPVFWACGV
FT                   TPQSVVMNVKPHFAITHAPGCMLITDTKNIDLKF"
FT   gene            complement(240644..241993)
FT                   /locus_tag="Ccur_01970"
FT   CDS_pept        complement(240644..241993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01970"
FT                   /product="biotin carboxylase /acetyl-coenzyme A carboxylase
FT                   carboxyl transferase subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: RimK-like ATP-grasp domain;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   Biotin carboxylase C-terminal domain; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93928"
FT                   /db_xref="GOA:C7MLY8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY8"
FT                   /protein_id="ACU93928.1"
FT                   /translation="MFDKILIANRGEIAVRIIRACRSMGIKTIAVYSTADRHALHVYLA
FT                   DEAVCIGPPAPRDSYLNIAAIISAAKGCGAQAIHPGYGFLSENSTFAKLCRENGLVFIG
FT                   PSPEVIDRMGNKSAARRTMMKAGVPVVPGTKRALHEADEALAAARDIGWPIMIKASSGG
FT                   GGKGMRVSESEDDFAEMFAIAQRESVNAFGDNSMYLERAIVNPRHIEVQIIADSHGNVI
FT                   SLGDRDCSVQRSHQKMIEESPSPFIDNDVRQHLFDDAVRAAQAVGYVNAGTIEFLVDED
FT                   RNYYFMEMNTRVQVEHPVTEMITQVDLVREMIRVAAGEELSLSQDRVYMHGHAIECRIN
FT                   AEEPEKGFLPSPGKIEQMHLPGGNGVRVDSATYDGFEVTPYYDSMIAKIIVQAQDRTEA
FT                   IEKMSTALDEMVIIGVKTNLDFQYAILQNETFRAGGADTGFIERFMKGEA"
FT   gene            complement(242009..242494)
FT                   /locus_tag="Ccur_01980"
FT   CDS_pept        complement(242009..242494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01980"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="PFAM: Biotin-requiring enzyme; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93929"
FT                   /db_xref="GOA:C7MLY9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLY9"
FT                   /protein_id="ACU93929.1"
FT                   /translation="MDKKAIEELIEIMDKADLTALRLDEGGTKIELERTHTTVGLGSPS
FT                   LLGVAERVGALLDGKNRSHEDAAAPEADDDSDGTTIVRSPMVGMFYVSPSPDEEPFVKP
FT                   GQEVLSGQTLAIVEAMKMMNEITAPTAGVITAVLAANGDQVEYDQPLFRITPSQDVR"
FT   gene            complement(242494..243591)
FT                   /locus_tag="Ccur_01990"
FT   CDS_pept        complement(242494..243591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_01990"
FT                   /product="biotin-dependent carboxylase-like protein"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; TIGRFAM:
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93930"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ0"
FT                   /protein_id="ACU93930.1"
FT                   /translation="MGIMIRKPGVATTVQDTGRFGYMGSGFSPSGVMDRRALRLANLLV
FT                   DNDPDDCVLEFALAGPTLRFTTDTFIALTGADFSARLDGAEAPLYRALPVHRGSKLSFG
FT                   APRRGVYGYIAFAGGSLSVAKVMGSRSTNLKCSLGGWHGRTLAPNDYIPFAQKETDYLP
FT                   MQASHELPYDDIYPKPGEIVELRVIPGPQEELFTDAGIKTFYEQTFETTVKSDRMGYRL
FT                   DGPAIETIAGSDIISDGIAFGAVQVPSHGRPIIMLADRQTTGGYAKIATVASVDIPKLV
FT                   QSTPGTAISFKLISVGEAQCLYREQEKYYAHLEKVVTRPTAGGTSPRRTARRLTPILER
FT                   QALASRGKSLWIDTPSAHSATKENG"
FT   gene            complement(243593..244321)
FT                   /locus_tag="Ccur_02000"
FT   CDS_pept        complement(243593..244321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02000"
FT                   /product="conserved hypothetical protein TIGR00370"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; TIGRFAM:
FT                   conserved hypothetical protein TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93931"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ1"
FT                   /protein_id="ACU93931.1"
FT                   /translation="MAAFNITIAGDSALNLVFSDTISEETSTLIRLASESLSSDPIPGV
FT                   IEVVPTFCSMMICYDPLILTADELTEKLRNGLRGVGEVDLSVRRIVHIPVCYGGEYGPD
FT                   INTVAEHAHLSADEVIAIHSGRDYLIDMLGFLPGFAYLGGLDPRLHTPRLAVPRTSIDA
FT                   GSVGIGGAQTGIYPLPSPGGWQIIGRTPLAPYDPNRAEPILYKAGDYLRFEPISAQEYA
FT                   ALQTQLAAGTYSCQITIEER"
FT   gene            244556..245737
FT                   /locus_tag="Ccur_02010"
FT   CDS_pept        244556..245737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02010"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93932"
FT                   /db_xref="GOA:C7MLZ2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ2"
FT                   /protein_id="ACU93932.1"
FT                   /translation="MYNETMLALGQAPSAIRELFAYGARRKAEIGTDAVFDFSIGNPSV
FT                   PTPQAVTRAIVEATQDDPVKVHAYTQSPGDPVARQAVADSLNRRFGTSYTAQNLYLSCG
FT                   AAASISMTLKALIEPGDEIAVIAPFFPEYRVWVETHGATLTVIPACSSDFQLDFKALEQ
FT                   AITSRTKALIINTPNNPVGVVYPRASLERLADLLRQKSLEAGHPIFLISDEPYRELVYG
FT                   GLEVAWVPSLYDDTIVCYSWSKCLSLPGERIGFVLVPPAAHESRQIMAAVSGAGRALGF
FT                   ICAPALFQRVIAACVDEPAQMAIYEENRRLLTGMLDELGFEYVNPDGAFYLWVRALEAD
FT                   AQAFSDRARTHELLLVPSDSFGAHGWVRLSYCIDAQVIKNSKDAFAALMADYR"
FT   gene            complement(245938..246633)
FT                   /locus_tag="Ccur_02020"
FT   CDS_pept        complement(245938..246633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93933"
FT                   /db_xref="GOA:C7MLZ3"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ3"
FT                   /protein_id="ACU93933.1"
FT                   /translation="MATILATHYCINCGAQLHPNARFCMNCGAAVPHMPIPPVQLGATA
FT                   QAFSRPDLRSPSMSAPLTQPIPPTSSTSPATSTSSEADLSGFDVPVRDPFEWEDSSEEF
FT                   DPSLGYTATPSVWPPTDSVKQTGRGGTEVMNPLEVPNASDYTQASGAAIFSSDHVAAPS
FT                   GTGAKIALGVGIFLVLCSIIYFVQFNPYFFENIVFRMTTWMQTQGMALLTNVVTFFHDV
FT                   ILQIANTIR"
FT   gene            complement(246879..247406)
FT                   /locus_tag="Ccur_02030"
FT   CDS_pept        complement(246879..247406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02030"
FT                   /product="NifU-like protein"
FT                   /note="PFAM: NifU-like N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93934"
FT                   /db_xref="GOA:C7MLZ4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ4"
FT                   /protein_id="ACU93934.1"
FT                   /translation="MYQTQAEEGVRGYSDRLLTVVANFRNSGIPEGCNARGMAGKSKHG
FT                   EVACQIFAVIDPATYTIDRIGFRSRGCLAMTACASQLCVMAHGLPIERALTITVADLKR
FT                   TLDGVPTEKQDTPAFAIEALHSAIGDFLLEQGGLDLLDTIAPCDRDGINCLLCEHCSLR
FT                   DQRVDWMIDHRD"
FT   gene            complement(247605..248681)
FT                   /locus_tag="Ccur_02040"
FT   CDS_pept        complement(247605..248681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93935"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ5"
FT                   /protein_id="ACU93935.1"
FT                   /translation="MNQNSRISSAPRDVLDGPSEALSGANSEEFSEVNGAEPLRATETS
FT                   EASHQVEQTRQMGVDCQMEVSQQAEIDHLAEEGTQQREADRQGDVDHQMATAYQTEENH
FT                   LDIEAEALQRVFDDIRAESANSQLVLPQRWSDQDFIPDHLTSQEFIDLVYSVLEGNHRQ
FT                   QMPDADNDTNTVEISEADGATPATETQTADETVHIAETQSPFSEEGTAEVASPRTVLDA
FT                   IAAGTITIPTDDITSLEGRDTMYLYSTDHMTDTYAHWAFLAAEDDRVATFVDIVREESR
FT                   IYPRPMVYRALANPPFNLSEDDVLDVWKTIQETDSYPDIESCEASNGDVYFFSTTYLSR
FT                   AYAESLAEYNSVERFLCP"
FT   gene            249002..250627
FT                   /locus_tag="Ccur_02050"
FT   CDS_pept        249002..250627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02050"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93936"
FT                   /db_xref="GOA:C7MLZ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ6"
FT                   /protein_id="ACU93936.1"
FT                   /translation="MRENRTAMSQDEKLYTQNSKTIRQNEAAEAASAPQHPALRDAVAQ
FT                   GLQTYRGFWATVLGLACARCSIIIGSYGSYAATDEGLYTDGATIVALFVLLIALVMMVA
FT                   RNKRIEKRQVLRLFFAMVIVQLVVLTAMVGAYLVGNAALAMGLALHAVNTICGIALMSF
FT                   WLRFIRGSSMKTIVVLVFSALAVSELIIFPCALLPYQVDFAVALLATAACFPLTAVMRR
FT                   HERAYDIEPSGRRGVFQMFVQQNVSNSRFLVIMGVGIAFMALVIGLLRGYPDGMPIPFS
FT                   LASRVGVLVVIELICIGFIVGGLVGWERLMAVDIWVVLRMMAVVAIVAYAAAPSDLQLG
FT                   AVVTTALNALMVAFMWYAIVSFMSYGWRDAYYYAIGGFTAFLLPRAIARTAEGFIAQAG
FT                   VSETLMLGIMALGLVISAEVSFVQYIDLYRQSHLRKERSERSFINRFMGIDNDQVPESL
FT                   EDLRFAAMKSNAQKVGEQFLLSEREVEVLAFYAMGHTQQRVAEELFISPGTVHAHIKRI
FT                   YSKTGLHSRQEVLDYLQRYANDGM"
FT   gene            complement(250712..252829)
FT                   /locus_tag="Ccur_02060"
FT   CDS_pept        complement(250712..252829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02060"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /note="PFAM: Aldehyde ferredoxin oxidoreductase, N-terminal
FT                   domain; Aldehyde ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93937"
FT                   /db_xref="GOA:C7MLZ7"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ7"
FT                   /protein_id="ACU93937.1"
FT                   /translation="MADQKSFGWTGKMLRVNLTTHATTTESTEPYKDYIGGMGLANKIM
FT                   YDEVPAGTDPLSPENKIIFAVGPFTASGVPLAGRTTIASLSTYTTDHLVVDAHCGGMIG
FT                   ARIKQAGWDAIIIEGASDKPVYLSVVNDKVQIKDASFVWGMGTRDATSALARVEGTRAC
FT                   VATIGQAGENLLPYSCIINSRNHSAGAGAGAVMGSKKLKALVVEGDMPVYVKDPKAVAE
FT                   LSDYMLREIIGSNNNHVVPSTQQEWAEYYDEGSRWTAAKGLNWELAEGGPIETGEPKPG
FT                   EINTVGYRCMKSTKDLGPAAAKYTIKMNGCHSCPIHCYSDLRNQASEDAEGFEIAGNTC
FT                   VPNFPWLYMEGILKTGISQKEDPDNYITWNNVIGTVVDDLGLWCNYAQLYRDIAHCIKD
FT                   GVFQRVLPAEEYALFDWSKFNKETQDASVMAQILRHIAKNDNEMSYVAHGPIVWTKRWN
FT                   DESWFDTKASQLINYRGWPVHHANECFAQVGLLYNMIFNRDDMIHSAVNFQGCGLPMDI
FT                   KRQIAAEVWGGEDAIDANKNYTPMNEHKAKFAWWSIVTDVLHDSLTLCNWVWPMTMSPT
FT                   KSRDYRGDLDLEAKFYKAVTGIEVTTDDLYKAGEKITTLQRCNTMRGMGTDDFRGVHDT
FT                   VTEWPFTMDPDKQPFTEGTIKMEKSDWQTALTMMYECFGWDTQKGCPTAEYLEENGMTD
FT                   IEDDLKAHGLL"
FT   gene            253174..253932
FT                   /locus_tag="Ccur_02070"
FT   CDS_pept        253174..253932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02070"
FT                   /product="Fe-S-cluster-containing hydrogenase subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93938"
FT                   /db_xref="GOA:C7MLZ8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ8"
FT                   /protein_id="ACU93938.1"
FT                   /translation="MSDGHLSGDAPQATVELPVENKESTGNKETTAHAGKRPITRRDVL
FT                   ALCGCGVVGLVAGGVLAKWGVTEEMIASGRIDLSTTPQKMIVTDRGRCSGCQRCELMCS
FT                   LRNDGWASQQTSRVRVWESYQFGRGVDTTDGIYKSCEFTIRSCKQCAEAQCVKNCPVHA
FT                   IGADPKTGARVVDEKKCIGCGMCHEACPWNMPQVSSLTGASTKCISCGRCAEQCPNGAI
FT                   LFIDWQDIADEAIAQGVVSTVELTGNFVRP"
FT   gene            254027..254665
FT                   /locus_tag="Ccur_02080"
FT   CDS_pept        254027..254665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93939"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLZ9"
FT                   /protein_id="ACU93939.1"
FT                   /translation="MNERKADVFETVAACFAPYPEKDWDELTSYASWARFLAMCEQQLR
FT                   GRGSIEADLNEILANHEIDAMKNPPSFAEKADFAARHFTGGLPTSALPIESLNGKPDPR
FT                   TGEVAYGGPSAAYMAHLIDVLGITVPNEFSSYPDHLSMECGLAALLYRSDPHLAARFVS
FT                   ERFDWLATYRMKLVLMGDQRKCFYCALIDVVLAIVEAEAQAVKDNEISE"
FT   gene            254684..256888
FT                   /locus_tag="Ccur_02090"
FT   CDS_pept        254684..256888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02090"
FT                   /product="anaerobic dehydrogenase, typically
FT                   selenocysteine-containing"
FT                   /note="PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; Molybdopterin oxidoreductase
FT                   Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93940"
FT                   /db_xref="GOA:C7MM00"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM00"
FT                   /protein_id="ACU93940.1"
FT                   /translation="MSENALTRRGFLATSAGVLSAAALSGYVGFEAWERAYADDADEKN
FT                   GTVSVVHSLCNGCSNKCGFAGYVVDGRLHKMIGDEAHPTGKGKLCARGYAYANIAYDKD
FT                   RLTDPLKKNERGEFEAITWEEAFEEIGAQVKDILADKGPSALAIVEDPRPSGDYYSRRF
FT                   MNALGSANIYTHAAACNLSCRSGAFLAIGANEWSSDIAHSKMTMFIGRSYADGIRPAQI
FT                   TAMQNGFDAGAHIVIVDPRYSNSQRFADEWVPIKPGTDLALVLAMSNVIVSEERYDTAF
FT                   IEAYGEGFEEYAATVREYTPEWAASKTGIDAVTIRRLALEMADAAPACSIVAGWRGPSG
FT                   CQYKNSGELGRAVALFNALLGTYGAKGGSKISAKFAAGKLDAGKFPSVPKPEVKQVGAD
FT                   EYPLARTNMGSALAAAKAAHEGKLSGMFFYNCNMVGGYANPAYLSEAVESLPLSVCIDV
FT                   QMSETAMACQYVLPDTSYLERDEVPAFNGGSTPSVSLRSKVIEVVHPNTKPCDEIFTGL
FT                   AKACGVGQYFEFTVQELAQAQLASVGVDYEAAKRIGTVGVPQAAPKASAVLTWGTPSGK
FT                   VMFANQKCVDAGLTAAPSWIEPEVMPYGNELRLIEAKQPIHSHTMTANNEFLMSLTHRY
FT                   DLTRAWISVKTAESLGVSEGDEIEISNTQHTGRIRAHVTNRIVDSAIYLPSAYGRNVKD
FT                   QHTADGVGLCPADFVKFQIEPAYGSAMSHEACVTVKKVGA"
FT   gene            256888..257427
FT                   /locus_tag="Ccur_02100"
FT   CDS_pept        256888..257427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02100"
FT                   /product="Fe-S-cluster-containing hydrogenase subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93941"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM01"
FT                   /protein_id="ACU93941.1"
FT                   /translation="MARYGMLINTKKCIGCYTCVSACQRQNDLKPAQQFIRFEEKESGV
FT                   FPQVSFETVPLQCMHCEDAPCAAVCPTGAAHIGADGIVAVDEGRCIGCKYCMAACPYQV
FT                   RVCDEETGTVDKCRFCTVSAKDGTAMCSCVEACLTGARIFGDLDDPESEISKEIARTNA
FT                   QPIAGDLTKSKVYYVR"
FT   gene            257434..258327
FT                   /locus_tag="Ccur_02110"
FT   CDS_pept        257434..258327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02110"
FT                   /product="formate-dependent nitrite reductase, membrane
FT                   component"
FT                   /note="PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93942"
FT                   /db_xref="GOA:C7MM02"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM02"
FT                   /protein_id="ACU93942.1"
FT                   /translation="MQFEPIWDVPIALYLFLAGLGGGAFITSALVAWKHPDAHTARKIG
FT                   RFIAPVVVAVGLLLLMTDAKAGLFNPLRFALLLHNLGSVMTWGVIFLAVFEVVALVVAI
FT                   LELTKRAVPRWLDIVGVVSGVAVGAYTGCLLGVVHTFPLWNNSILPVLFLVSALSTGAA
FT                   SVVFGTLIAAPKEAERLTVVKGAHYWLPLVELVLVAAMLFIVNTAGATAHTTVMGLLAG
FT                   KFALPFWLGFIAIGLVGPACIETYERFCAKEKGSAQGSRALGIVSEGGVLVGGFLLRWM
FT                   IVVAALPVTLVVPAVM"
FT   gene            258458..260089
FT                   /locus_tag="Ccur_02120"
FT   CDS_pept        258458..260089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02120"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /note="PFAM: Methyltransferase domain; tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93943"
FT                   /db_xref="GOA:C7MM03"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM03"
FT                   /protein_id="ACU93943.1"
FT                   /translation="MKGSVHPIALCHNRDMSRQKKKRSTKDTQRAKRTTKMRSRDRNRA
FT                   GSQKRAGNATRSGGHNQASNRNRASAQIQTDDQIKTRNRKQSSGHVRADEQNRADNYVS
FT                   HPRVCPLSAECGGCSHIEEPYAHQLKRKQYFIAELFADEIKAGCTLEPIIGMEDPFGFR
FT                   NKIASPFAPVRSSRTGKRVRHTKSGDATLQQDTAARQRKTSVNSLSRSRSTSSAVSSMR
FT                   YGLYAAGTHRLIRADKCPVEHPIGRRVVAATAQLMRKWDIAPYDEDAGTGFMRHVIVRV
FT                   GHESDEVLVTLVTNGKVFPSGKNFARHLKKHCPEITTVVQNVNMRSTNAIFGGEEQVLY
FT                   GPGFILDTLCGLSFRISSHSFYQVNAVQTEVLYRTALEMAACTSSHQALTILDAYCGTG
FT                   TIGLVAASQVPNSQVIGIDNASSSIRDARQNAVHNGIANATFLCEDATDFLLHRAAASD
FT                   SIDVLMMDPPRAGSTSEFIEAACALAPERVVYISCNPATQKRDVRLFARGGYHLVRLRA
FT                   VDMFPHTDHIETVALLMRNAEFFAQS"
FT   gene            complement(260115..260885)
FT                   /locus_tag="Ccur_02130"
FT   CDS_pept        complement(260115..260885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02130"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93944"
FT                   /db_xref="GOA:C7MM04"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM04"
FT                   /protein_id="ACU93944.1"
FT                   /translation="MIQFSHIRNLRDVGGMPAEGGALLRKRRIYRSAELFDATASECIR
FT                   LTDRFNLGTVIDLRTSLECNRRPDPIMPGVESVHIPLMPASALGISFQDGNLRELLTGT
FT                   WNPDTYDVCTIYRSMVDKRLADKWQQLFRTLLASNGKAVLFHCTNGKDRTGVAVSIVLL
FT                   ALGVSYSDVMHDYLRTNRSLPALQARIQAKMARGIKPGLSDKIGPLLEARPEYLNAALD
FT                   AIDDNYGGMAGFLEDACGLSIAEDDQLRELFISA"
FT   gene            261166..262119
FT                   /locus_tag="Ccur_02140"
FT   CDS_pept        261166..262119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02140"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   cysteine synthases; cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93945"
FT                   /db_xref="GOA:C7MM05"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM05"
FT                   /protein_id="ACU93945.1"
FT                   /translation="MADSDEIISAVGQTPLIELKRFSQQVQARVLVKYEAANPGASIKD
FT                   RAARSMIERAEQRGEIEPGKSVLIEPTSGNTGIGIAMIGAARGYRVVLTMPESMSRERR
FT                   ALAAAYGAQLELTPAALGMRGAVDRAAELASQIEGGWVVGQFTNPDNPLAHEVTTAPEI
FT                   EQQLGSAPDVLIAGVGTGGTISGCAHYFQQHKAPTRFFGVEPAESAIIAQALAGEDITP
FT                   GPHGIQGIGANFIPETLDLAVLAGAIAVPTAVALDYARRIAREEGLLVGISSGANLAAV
FT                   ERLVQHDESARGKTIVTFAVDSGERYLSTPLFDGVA"
FT   gene            262129..263265
FT                   /locus_tag="Ccur_02150"
FT   CDS_pept        262129..263265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02150"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="PFAM: PP-loop family; TIGRFAM: tRNA(Ile)-lysidine
FT                   synthetase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93946"
FT                   /db_xref="GOA:C7MM06"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM06"
FT                   /protein_id="ACU93946.1"
FT                   /translation="MVESLPILDRVLQTIDDRALVLPDQPVLLMVSGGSDSTALAYLTS
FT                   DLSAAGRVGPLALVHVNHCLRGDASDGDAAFVRHLAEALELPYFQYDIDIAALVEQTGE
FT                   NLEAVARSERYAAAQEALSNFCAQLNFPTSSGRIFVAHTRNDRVENFYMRSIVGCGPGG
FT                   FRSMRYINGCIVRPLLDVSRDDLRDYLRRRALDAQNDASVVLVRDKDGSLWREDATNAH
FT                   TDRFRAYVRTTMVPAALERNPRVLEVLCRTMNLIADEDDMLAEMAEHIMTSDVQWRDDE
FT                   TCLIKPSFAQHQQPIQRRVAFQILQRLLTAEARVESAAVEAVLNAFSPDGPRSGYVANI
FT                   QGNLALSANKRGLLIEPMNSFRVRRRKDTTKFCKQPKE"
FT   gene            263269..263895
FT                   /locus_tag="Ccur_02160"
FT   CDS_pept        263269..263895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02160"
FT                   /product="MAF protein"
FT                   /note="PFAM: Maf-like protein; TIGRFAM: MAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93947"
FT                   /db_xref="GOA:C7MM07"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM07"
FT                   /protein_id="ACU93947.1"
FT                   /translation="MSKIEVVLASSSPRRRQLLGEAGIRFRVQAADADESLDDDLRADP
FT                   ARAARTVAERKAAMVVQQVIADSLTHTTAVIGADTMVVLDGQIFGKPQNFSAACGMLRK
FT                   LSGRTHQVITGVSVWMLEPTADGEVSIGRRTFSEVSEVTFKDLSDDDIKTYVHTGEAYD
FT                   KAGSYAIQGEGARLVAHWEGDWRNIVGLPVETLLYLVPALCESDT"
FT   gene            264125..264670
FT                   /locus_tag="Ccur_02170"
FT   CDS_pept        264125..264670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02170"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93948"
FT                   /db_xref="GOA:C7MM08"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM08"
FT                   /protein_id="ACU93948.1"
FT                   /translation="MQVMHEDIDKILFTEDDLRARVSEMGHQITADHQGESLLVVSVLR
FT                   GAAIFMADLVRNITLPLEMDYMAISSYGNGVKSSGIVRILKDLSSSVEGRHVLIAEDIL
FT                   DSGLTLSYLMRNLESRNPASIEVATLLRKKTRAQADIDCRYVGFECPDEFIVGYGLDYA
FT                   ERYRNLPYIGVLKKSVYC"
FT   gene            264816..267095
FT                   /locus_tag="Ccur_02180"
FT   CDS_pept        264816..267095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02180"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); Peptidase family M41; FtsH Extracellular;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93949"
FT                   /db_xref="GOA:C7MM09"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM09"
FT                   /protein_id="ACU93949.1"
FT                   /translation="MALIFMFLASQFIGLGQAGQSQKTDTLITSDFVTAVKEERVINVT
FT                   FDAGSNSVSGSYYPAATAGNGAASAFNTAFRALNAALSTQQMVSDTASAGVSTEDIASS
FT                   TLGEARKYTATWVGQDSLGELMADHPSIQYEVKLPSGILSAVLSYLPMILLAVFFVWMF
FT                   YQMSKANNSQMSFGKTKAKMASEERPDVHFSDVAGVDEAVEEMQEVRDFLANPKKYQDI
FT                   GAKIPRGCLLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFKQ
FT                   AKEAAPAIIFIDEIDAVGRQRGTGLGGGHDEREQTLNQLLVEMDGFEANSSVVLIAATN
FT                   RSDVLDPALLRPGRFDRQIVVDVPDVRGREKILAVHAKGKPIAQDVELDKIAKLTPGFT
FT                   GADLANLLNESALLTARRNKQVISMQEVTESMERVIAGPERKGRVMDDDTKRTIAYHES
FT                   GHALVGHTLPKADPVHKISIVSRGRALGYTLSIPKEDKVLNSRSEMLQELAVLLGGRVA
FT                   EEIFCEDITTGASNDLERATKIARQMVTQYGMSSELGTQIFGQPNHEVFLGRDYGNTQD
FT                   YSEETARRIDDEVARIMKQAHDTAYEILSVHKDQMDLMASVLLERETVDGDACQALLDN
FT                   TWAEYLAHEQSEEGRAQREAAATTVAHDISAEASTTVAVPVSTAPAAPTASTVSMSAPA
FT                   TGNAANENGAAAATTSANGSGAVNPSTALDTNAAAVVDSSSIHSTDEANPSHNTNSSGE
FT                   DAEDSR"
FT   gene            267092..268402
FT                   /locus_tag="Ccur_02190"
FT   CDS_pept        267092..268402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02190"
FT                   /product="dihydropteroate
FT                   synthase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   Pterin binding enzyme; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93950"
FT                   /db_xref="GOA:C7MM10"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM10"
FT                   /protein_id="ACU93950.1"
FT                   /translation="MIWKCGNYSFDTQVPVVMGILNVTPDSFSDGGSYASFDDAIAAAC
FT                   RMRDEGALIIDVGGESTRPGAAEVSEDEELHRVLDVVRALAANDICVSIDTRHASVAAA
FT                   CVDAGASIINDVSGFRDPEMVRVAASCDAGLVVMHMRGEPRTMQQEPQYDDVVVEVRDY
FT                   LLAQAHMLESAGVDRARICIDPGPGFGKTAQQTVELVRNIQEFVRTGYPVMIAVSRKSY
FT                   IGALYSIEVPQDRDKASAEEALMACELGACVVRTHNVAATVARLADVRPYAFIGLGCNV
FT                   ALVGSAEESQQSKIAQLEHAIAEICLIPDTQLIDVSGFYESEPAYLEDQDTFVNAVALI
FT                   RTGITPRDLLHYLQAIEDSLGRVRTVKNGPRTCDLDILDYQLYLSSDEELTVPHPLLAE
FT                   RDFVVKPLLELAPFHILANGKRLTADAVKVGHAVRIR"
FT   gene            268591..269991
FT                   /locus_tag="Ccur_02200"
FT   CDS_pept        268591..269991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02200"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="PFAM: MatE; TIGRFAM: putative efflux protein, MATE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93951"
FT                   /db_xref="GOA:C7MM11"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM11"
FT                   /protein_id="ACU93951.1"
FT                   /translation="MGTESIPRLIAEFSIPSIIGMLANGAYNVIDSVFLGQAMGEIGLS
FT                   AVTAATPVMIIFLAIALLVGNGGNALAALRLGQGDRLGAERALGNTVSLSVVFSLAVAL
FT                   IAFMPPSIETLLTLSGATVETWDAARIFIQILSAGFILQCIGMGVNNFIRTAGAPNRAL
FT                   GTMVIGAVVCIVFNYLFVIVCNLGVVGSACATLVGQAASCVCVLWFFTITKNVPMRLHV
FT                   RELVFQARTVGTILALGFASFALQAAAAIVSFVLNNMLVKYGVQSAIGSDGALASIGVV
FT                   QRVALFTVFPLIGVAIAIQPLLGFNYGAHLFARVRTTAKDGILTATAISVFMWVIVHVF
FT                   PNQIVGAFGIVDADLVSFTVFALKIQLLMLPFIGFQIIGSNYFQATGQPFKSSFLSLSR
FT                   QVLFLIPLYLVFPEVLPQIAPQLTSLDALYCAVPVADFLSIFTTALFFFVESKRIKRLE
FT                   AGKAVARF"
FT   gene            270116..270700
FT                   /locus_tag="Ccur_02210"
FT   CDS_pept        270116..270700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02210"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93952"
FT                   /db_xref="GOA:C7MM12"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM12"
FT                   /protein_id="ACU93952.1"
FT                   /translation="MQARQNNQSLQRTRSITFIGLSVALLAVSAWITIPLGPVPFTMQT
FT                   FVEVFVLLALRSRESIATAVAYLVLGSLGLPLFSSMRGGIGVVAGPTGGFLIGFVIGTL
FT                   AAVLFLKLLGNRRSIVVEYAAAVILLIVCYTCGWLQLSFVTGMGPAAAFVAGIAPFIII
FT                   DLVKVALAVPVARAVRKAVGHDRAVTLPSKG"
FT   gene            complement(270678..271637)
FT                   /locus_tag="Ccur_02220"
FT   CDS_pept        complement(270678..271637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02220"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: His Kinase A (phosphoacceptor) domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93953"
FT                   /db_xref="GOA:C7MM13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM13"
FT                   /protein_id="ACU93953.1"
FT                   /translation="MFIFARVSNWTDWRIIVPLAMLASLIFLLSLLIGHFIAQPLADLR
FT                   EKIRLYRTGDTTIDFSPQGSLQEADDLAGDFKDLLDSSYAQAADLARQEKQQLQFVGDV
FT                   AHELRTPLTAIHGNAELLADPDLPPEMREKFGHTVVTESERLTRLVNDLLSLQHIEGDS
FT                   YVLNFTRVDLRPVAQEAVDALAPVLQERGAHCVVIGEAPDVLGNRDRLKQVVSNLVDNA
FT                   SRFIEPGGHIRVELYGVGGNSIIAVKDDGTGFGDVDPKMLFERFFRTDFSRARNTGGSG
FT                   LGLSIVKSVVEAHDGTVEAYNLPEGGACFIVAIPSMGA"
FT   gene            complement(271737..272426)
FT                   /locus_tag="Ccur_02230"
FT   CDS_pept        complement(271737..272426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02230"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93954"
FT                   /db_xref="GOA:C7MM14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM14"
FT                   /protein_id="ACU93954.1"
FT                   /translation="MNEKPSRILVVDDEQTITDFVSYALQKENFESDVVHNGEDALEAA
FT                   KKTDYDLFILDIMLPGMDGYELCRRLRSFTSAPVLFLSARDTELDKVVGLEIGGDDYLS
FT                   KPFGLRELIARVRALLRRGSGQMETGHAITASGITLDEDAHTATGDSGPIDLTPREFEL
FT                   MAALMKHAGNVVSREDLLRDAWGWEYLTETKTVDTHIKRLRDKIAAAGYDPSVVETVRG
FT                   YGYRFRQ"
FT   gene            272556..273329
FT                   /locus_tag="Ccur_02240"
FT   CDS_pept        272556..273329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02240"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /note="PFAM: Bordetella pertussis Bvg accessory factor
FT                   family; TIGRFAM: transcriptional activator, putative, Baf
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93955"
FT                   /db_xref="GOA:C7MM15"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM15"
FT                   /protein_id="ACU93955.1"
FT                   /translation="MLLTIDVGNTHTVLGTWHDDELTYRWRVRTDASQTADQARIMLNS
FT                   LFALDGIVPRDVEGVILATVVPALNRLWSKVALDLCGRKALSIDSEMVGSLLNVSTYEG
FT                   RIGADRIADAVAARAHYGDPVIVVDLGTATNIEVIDTQGRFCGGVIAPGVETSLNALIS
FT                   HTALLPAIEMTDPGTAIGSSTVQAIQVGMMYGEVDRIDGLIRRIWKQLGYQTAVVATGG
FT                   FGRAIATLSQTVTAVDPDLTLRGLHAIYKAVSPLE"
FT   gene            273419..275086
FT                   /locus_tag="Ccur_02250"
FT   CDS_pept        273419..275086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02250"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: Formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93956"
FT                   /db_xref="GOA:C7MM16"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM16"
FT                   /protein_id="ACU93956.1"
FT                   /translation="MLTDIEIAQQASIRPISEVAAVIGVPEKYQEQYGKNKAKIDYNLL
FT                   REVDTTPGKLVLVTAINPTPAGEGKTTTTVGLADAMNRIGKKTVVALREPSLGPVFGIK
FT                   GGAAGGGYAQVVPMEDINLHFTGDFHAIGAANNLLAALLDAHIHNGNELGIDVRKITWK
FT                   RAVDMNDRQLRHIVCGLGGKADGVPREDGFDITVASEIMAVFCLASSITDLKERLGRIV
FT                   VGYTFDDAPVTAHDLHAEGALAALLKDALKPNLVQTLEGTPAFIHGGPFANIAHGCNSI
FT                   MATRMALALGDYAITEAGFGADLGAEKFLDIKCRLTGIRPDAVVVVATVRALKSHGGTA
FT                   PDALNTEDLVALEAGLPNLLQHVENITQVYGLPCVVAINAFPTDTPAELALIENKCREL
FT                   GVNVALSEVWARGGAGGEELACEVVRLCEQPNDFTFAYELEGGIADKIEAIARRVYHAD
FT                   GVDIAPKAQKEIARLESLGFSSMPVCMAKTQYSFSDNASLKGAPRGFRITIREVRVSAG
FT                   AGFIVALTGSIMTMPGLGKSPAAFKIDVDETGRITGLF"
FT   gene            complement(275249..275677)
FT                   /locus_tag="Ccur_02260"
FT   CDS_pept        complement(275249..275677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02260"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93957"
FT                   /db_xref="GOA:C7MM17"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM17"
FT                   /protein_id="ACU93957.1"
FT                   /translation="MDNKGKKVKVHYIGTLDDGREFDSSVKRGEPIEFTCMAGQMIKGF
FT                   DEAVKNMAQGETKKVRIPAAEAYGERDESLIQKVPTEQIPNAEKLPVGETIFMRGPGGQ
FT                   SFPVKVLSVEDGVATFDLNHEMAGKDLNFEITLVEVED"
FT   gene            276035..276427
FT                   /locus_tag="Ccur_02270"
FT   CDS_pept        276035..276427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93958"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM18"
FT                   /protein_id="ACU93958.1"
FT                   /translation="MKAEVKNIAPDSAISSDSLTERRSGEKATLIQMVGIYCAGQHHNE
FT                   VAPVVINGYEARLCPSCRELVEYAFDRIDRCPHMETKTFCSACKTHCYQPQMRERIRQA
FT                   MAYAGPRMLFVDPKGAIRHLLSRFER"
FT   gene            276736..277170
FT                   /locus_tag="Ccur_02280"
FT   CDS_pept        276736..277170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02280"
FT                   /product="arginine repressor"
FT                   /note="PFAM: Arginine repressor, C-terminal domain;
FT                   Arginine repressor, DNA binding domain; TIGRFAM: arginine
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93959"
FT                   /db_xref="GOA:C7MM19"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM19"
FT                   /protein_id="ACU93959.1"
FT                   /translation="MKKRMQRHDIIREIVRDNEIRTQRELASKLQAKGHECTQATISRD
FT                   ITDMGLLKSSEGIYVLPEDMRLHHMVAELVEEVYTAGYLVVVRTFPGGAAGVAGSIDNA
FT                   GLVGSLGTVAGDNTIMIAARTPEDAESIREILDGLRRHRS"
FT   gene            277321..279453
FT                   /locus_tag="Ccur_02290"
FT   CDS_pept        277321..279453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02290"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain; Transglycosylase; TIGRFAM: penicillin-binding
FT                   protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93960"
FT                   /db_xref="GOA:C7MM20"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM20"
FT                   /protein_id="ACU93960.1"
FT                   /translation="MASRAMKKRHGTRNKRRSIPLLYILAVLFGLIIAGCVSGYALCQS
FT                   WLQDLPEYQDASAYNLAQKTRVYASDGTTLLAEFYLENREPLTSLDDVSAFVKDGTIAT
FT                   EDARFYEHSGVDLWGIARATVMNLTGSSHEGASTLTQQFVRNTVLSKEASEQTLKRKVR
FT                   EAYISLKLEEAYSKDEILLMYLNTINYGSGAYGIEAAAQRYYSVNAKDLTLAQAALLVG
FT                   IPQSPTYNNPITYPDNALQRRNTVLNRMLTRGRITQEQYQEAINEPLNLNPSEPTENGI
FT                   AAYPYFTSYVRQVLLDKYSEAEVFKGGLTVTTTLDVKAQDAAEAAAKKKLSQVESDVEV
FT                   AMVAVDPETGFIRALVGGRDYDESQYNLATQAQRQPGSSFKTFTLAAAIEEGVDPNSTY
FT                   VNCSSTAKIGTWNVENYGKADYGTRSIASAFAVSSNTGFARLCDMITPEKVVDMAKRMG
FT                   IESELEAVPSITLGSEGVTVREMAAAYATIASGGIQHDAVAIERITDANGNVVFQADTT
FT                   GKRVMSGEVAHASEKVMESVITSGTGRQARLSSGQIAAGKTGTSQNWRDKWFCGITPQY
FT                   AVACWEGVPEERQMSSYGSVTDMFSLFLNELITRNDIETFVMDNASMPAYRVLTAEEKA
FT                   KLGTGSYNPNGISDSERKKSETLRNDHESGESTSDTNSSTDTQSTTSETEATTTVTPTL
FT                   SGGSESTATTTTPTAG"
FT   gene            complement(279517..279759)
FT                   /locus_tag="Ccur_02300"
FT   CDS_pept        complement(279517..279759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93961"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM21"
FT                   /protein_id="ACU93961.1"
FT                   /translation="MSVSYFPFIVGAPLALKIDQLCNRALFQRMRFCSILGFDLLSKAH
FT                   HELVIMPSLHKLSMVLLVKLSNTALFKLSKQHQIT"
FT   gene            279747..280262
FT                   /locus_tag="Ccur_02310"
FT   CDS_pept        279747..280262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93962"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM22"
FT                   /protein_id="ACU93962.1"
FT                   /translation="MKRSSTSSSAFTWGMTLVVVAALAFALAGCSLNRTAASDGDQASD
FT                   NRQYMASLNQQMSDLQTEMDAFQKAVAAGDVVSMRAQQQAVDGTITAVKAADAPERLQS
FT                   VKDNYVDALDTLDGALDGYVSLYSDVQRGAVSSDGYDQRLSAVQDAYNSGIEKVKAADA
FT                   AVSEIASE"
FT   gene            280287..282773
FT                   /locus_tag="Ccur_02320"
FT   CDS_pept        280287..282773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02320"
FT                   /product="collagenase-like protease"
FT                   /note="PFAM: Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93963"
FT                   /db_xref="GOA:C7MM23"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM23"
FT                   /protein_id="ACU93963.1"
FT                   /translation="MNNAVELLAPAGNMTCLHAAVRSGADAVYLGIDRFNARRGADNFT
FT                   MDTLAEACDYAHLRGVRVYLTANTVILPSEASAALEMVRQAYRRGVDAFIVQDIGLALE
FT                   IHRTLPQAELHISTQMNIHNAAGIEAVHKLGAARVTLARELELAEIDHLSQVAHSFGME
FT                   VEVFAHGALCICYSGQCLMSSLVGGRSANRGMCAQACRLPYELHNRAQRKPLSSPGEHL
FT                   LSPKDLCTIDLLPELVTCGVTSLKIEGRMKSPEYVSAVVGVYRAVLDRTLAWCAQRAAS
FT                   SSTTELFSASIPQEVRATANEQRILSEAFSRGFTTAYLTHDDGNDMMSFGRPNNRGIFI
FT                   GRVSSAHDGAVVVEAERKLFVGDVVEFWTNRGHFAQPINRLEPVGKQGVRLEVSRKVGK
FT                   GDRVFRVRSAQAAFADDALLPKVPLDIQVTVHEGQPLSVSLQSASGVRVQAQGAVVEQA
FT                   RTKALVADEVIEHVDRMGNEPFVLQSIEVDLGENVGVGFSQIHKVRATACEMMQEALLA
FT                   PYHARKLTRITDRSQSSKSLVSGNTCEVVVWVTNASCARAAHKAHADAIFVPALNYQRG
FT                   ESLIAGQLSETVAQAGYPKQVGIALPAIDHDPLEGTRENRFAFDPWRYVKRGRTVLVDN
FT                   MGQLDRALACGANVETGPHIPVLNAWTADGLVAAGAQRVWLSPELTLGQIQQIGEETQA
FT                   PLGLVVSGATELMVTEHCLLMSQGPCNRNCTTCVRRKSPHYLKDRKGYEMPVITDCCGR
FT                   SHIYNAVPLDIVHTLPDLIAAGVTAIMVDATLLTVDETTKAVSRAVRARDIALRGADTV
FT                   AKVPGATTGHLFRGVS"
FT   gene            282878..284089
FT                   /locus_tag="Ccur_02330"
FT   CDS_pept        282878..284089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02330"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="PFAM: tRNA synthetases class I (W and Y); S4 domain;
FT                   TIGRFAM: tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93964"
FT                   /db_xref="GOA:C7MM24"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM24"
FT                   /protein_id="ACU93964.1"
FT                   /translation="MLPAEEQLRIIKSGTAQIVPEEALLEKLKRDRPLNIKLGVDPTAP
FT                   DIHIGHAVPLRKLRTFQDLGHQVTLIIGDGTALIGDPSGRNSTRPQLTSDEVAANAQTY
FT                   IDQAFKILDPQKTTLRHNAEWLLDLNLEGLLKIASNFTVARILERDDFHNRYTQNLPIS
FT                   VHEFLYPIMQAYDSVVIDADVELGGTDQLFNLLAGRELMEKMGKEPQVCLTLPLLEGTD
FT                   GVRKMSKSYGNYIGLTDAADDMFGKVMSIPDELMVKYYRLASTESVDEIDRLEEGLAAG
FT                   SLHPNQVKRALARNIVAAYHGDLAAIEAEVSFDRLFKNHDMPEDIPMFTGSLQPDEQGM
FT                   VYLPKVLHEASLAKSAGEGRRLIDGGGVKVNGTPLAAKSYQIAAGDLEGAVIQVGKRRF
FT                   VKLA"
FT   gene            complement(284585..284701)
FT                   /locus_tag="Ccur_02340"
FT   CDS_pept        complement(284585..284701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93965"
FT                   /db_xref="UniProtKB/TrEMBL:C7MLE0"
FT                   /protein_id="ACU93965.1"
FT                   /translation="MLTFMLKRHLFEDHDDLGVHLSYSYKLISPMSDKPIPA"
FT   gene            284732..286235
FT                   /locus_tag="Ccur_02350"
FT   rRNA            284732..286235
FT                   /locus_tag="Ccur_02350"
FT                   /product="16S ribosomal RNA"
FT   gene            286705..289726
FT                   /locus_tag="Ccur_02360"
FT   rRNA            286705..289726
FT                   /locus_tag="Ccur_02360"
FT                   /product="23S ribosomal RNA"
FT   gene            289858..289968
FT                   /locus_tag="Ccur_R0003"
FT   rRNA            289858..289968
FT                   /locus_tag="Ccur_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            290058..290657
FT                   /locus_tag="Ccur_02370"
FT   CDS_pept        290058..290657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93966"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM26"
FT                   /protein_id="ACU93966.1"
FT                   /translation="MSERQEADELVEGALTDASVLQSTIEELSGPSRRSRQNAAQIIAA
FT                   VAKRDAQLVLPFADDLIDALNRPEAQTRWECLDALTCLVDIGSRSCDKALAGAEASLFD
FT                   EDNGPVRLAAMRFLCKLGATTESRSEKIWPLINEGIQCYHGDLEFQDMLVAVIGFSEGK
FT                   LSAAVKKSLAERMEFDAANSKGALKSRAQQIIDNVS"
FT   gene            290921..292015
FT                   /locus_tag="Ccur_02380"
FT   CDS_pept        290921..292015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02380"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.41"
FT                   /note="PFAM: Isocitrate/isopropylmalate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NAD-dependent,
FT                   mitochondrial type; isocitrate dehydrogenase,
FT                   NADP-dependent, prokaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93967"
FT                   /db_xref="GOA:C7MM27"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM27"
FT                   /protein_id="ACU93967.1"
FT                   /translation="MAQHTVTLIPGDGIGPEISEAMRAVVAASGADIAWEQAEAGLPAI
FT                   EQYGTPLPASTIEAVRKNKVAIKGPVTTPVGTGFRSVNVALRKELKLYANVRPARTLPG
FT                   LPNRFTDVDMVIVRENTEDLYVGIECEQGSPAAAHLARVIEQEGLGTIASDAGISVKPI
FT                   SVSASRDIVRYAFDYAVSQGRSKVTAVHKANIMKHSDGLFLRVAREVAREYEGRVAFED
FT                   RIVDAFCMNMVTNPSQFDIVVLPNLYGDIVSDLAAGLVGGLGIAPGANIGREEAVFEAV
FT                   HGSAPDIAGQGKANPTALILSAAMMLDYLGEMDAAAAIREAIEAVFSEGRTLTADIRAM
FT                   SQGGAVASTKEFTAAVVEKLQTRR"
FT   gene            292023..294863
FT                   /locus_tag="Ccur_02390"
FT   CDS_pept        292023..294863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02390"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: Aconitase C-terminal domain; Aconitase family
FT                   (aconitate hydratase); TIGRFAM: aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93968"
FT                   /db_xref="GOA:C7MM28"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM28"
FT                   /protein_id="ACU93968.1"
FT                   /translation="MSRRATDETRLAADADTWMSEGIPATLTVADKHYTYWPVSSVSHA
FT                   NRLPYSLRILMENILRCAPTNEARKQSAQRIIEAAAAHSVGEEVEFSPARVLFQDFTGV
FT                   PVFVDFAVMREACKQLGGDPAQINPHVPCDLVIDHSVIADEFGCAGALNQNTALEFTRN
FT                   RERYAFLKWAQRSFQNVRIVPPGQGICHQLNIERFATVATVRSADDNPVPATTTQVPES
FT                   NPATARATESNLAPVAATQSTKSKDALLPSDSSLDPGVFFDTLVGTDSHTPTANGIGVL
FT                   GWGVGGIEAEAAALGQPITILVPQVVGVRFTGSLSEGVSAMDLSLHMAALLRAEGVVGC
FT                   FVECFGPGVAHLSATQRTCISNMTPEYGCTCTLFPVDDRTLDYLRVTGRSSDQVELVEA
FT                   YAKAQGLWNSDAVRDYAKVLEVDLSQVERGIAGPSRPHEHIAWSEVPQTIARINEQRGL
FT                   DKQCVTVELDGKAHQIGQGALAIAAITSCTTATDPAMMLACGLLARNAVHKQLHPKPWV
FT                   KTILAPGSKATELLLERAGLVDSLRELGFYTCGFGCMSCIGNSGPILEPLHAIASQVEL
FT                   ASVLSGNRNFEGRISPDVSQNYLSAPAGVVAYALAGRIDFDFEHEPLGQDSAGHDVFLC
FT                   DIWPSDDEVAMLQKHIVNQALFNDGAQGLYEGDTSWRQLEAAESDLFSWDSTSTYVRRA
FT                   PYFDGMQRTLEAPVPIRGARVLALLGDFITTDHISPAGSIAADSAAARLLREAGVASQD
FT                   FNTYGARRGNHEVMMRGTFANVKLKNSLAEGRLGGWTRDHIDGQVKLIFDAAQHYRTEG
FT                   IPTVVIAGKMYGSGSSRDWAAKGPALLGVRAVIAQSFERIHRSNLVGMGILPLQFEEGQ
FT                   SASSLGLTGTEVFDIAPIDFSAGMPNPAEVAVTAQRTNGEVVRFNALVRIDTPTEGAYF
FT                   RSGGILAYVLRNLMDQ"
FT   gene            294995..297088
FT                   /locus_tag="Ccur_02400"
FT   CDS_pept        294995..297088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93969"
FT                   /db_xref="GOA:C7MM29"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM29"
FT                   /protein_id="ACU93969.1"
FT                   /translation="MDKKDMEEYFRMVGFEPPSGDSAGTAAESGGSAQSRQNTSQQSAQ
FT                   DAQAKTSRTSSARGRSAKRGRRIRWDEAKKAASRGDAPSFGGIPIDFSSIFGGGNGGNR
FT                   GTGGSSSGTVNPDLSLPLFSRRSIVMLSIILLVVVAAAYWWFHPPINIHSADCWTFLVV
FT                   FVIAPSFITFRVLSRSYTKGEGKRERDPKRARRYRVASFIPAAVAILGLIGAAASYSIW
FT                   PGNAEKYSHLLEIQDSNFAQDIKEVDYDSIPVIDRDSAVLLGNRTLGEIPDYVSQFEIA
FT                   NTYSQINYQGRPVRTSPLNYADLFKWFYNKDSGIPAYVIVDMASQDTQVVRLDKPMYYS
FT                   ESEPLERNIDRYVQLKYPFYMFEEKSFEIDEDGTPWWVCPVQTRTIGLFGGETISRVVL
FT                   VNASTGETYDYRIDECPEWVDRAYPSDLVVQQYNWYGSLKSGWLNSWLGQSGVVQTTPG
FT                   TNGQAGYNYIVKDDDVWLYSGVTSATSDNAIVGFVLINQRTAETHFYSVAGATEDSAMA
FT                   SAEGQVQNLHYNATFPLLLNINGQPTYFMALKDGAGLVKKFAMIDIQRYQNVAIGDTVS
FT                   QAQKSYKALLASNGVGSDDAETATTQSAQGVVHTTAQAVIEGNSHFYLTLQGDSRIFDA
FT                   PLPAVTEVLRVAPGDTVTLHFTEGDPTCTVQSIEITGAPTSTDRAVSDQKTTDQGTSSE
FT                   AVS"
FT   gene            297453..297974
FT                   /locus_tag="Ccur_02410"
FT   CDS_pept        297453..297974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02410"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93970"
FT                   /db_xref="GOA:C7MM30"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM30"
FT                   /protein_id="ACU93970.1"
FT                   /translation="MPNAQNKEALAKIKEELDGVSAVWVVDYRGLTVKDAQQLRREIRE
FT                   AGAHLVVYKNTLMHIALEESGLPTMEDILEGPNAFVFTEADPAAAAKAIKEFSEKNENL
FT                   VIKGGIMDGAEYDAAQVVSIASLPSREELYASMAAALSSIARGLAVTINGVPQGLAQAT
FT                   RQVAEQKPAA"
FT   gene            298053..298433
FT                   /locus_tag="Ccur_02420"
FT   CDS_pept        298053..298433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02420"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="PFAM: Ribosomal protein L7/L12 C-terminal domain;
FT                   TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93971"
FT                   /db_xref="GOA:C7MM31"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM31"
FT                   /protein_id="ACU93971.1"
FT                   /translation="MAVTKEEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAVA
FT                   GGADAGAAAEEKSEFDVVLEGFGDNKIAVIKVVRELTGLGLKEAKELVEGAPKAIKEGV
FT                   AKEQADEMKGKLEEAGAAVTLK"
FT   gene            complement(298574..299122)
FT                   /locus_tag="Ccur_02430"
FT   CDS_pept        complement(298574..299122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02430"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93972"
FT                   /db_xref="GOA:C7MM32"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM32"
FT                   /protein_id="ACU93972.1"
FT                   /translation="MYYGNIKYNDIANGTGVRTTLFVSGCTHHCKGCFQTQTWCFSFGE
FT                   PFTDEIARQIIDSLHDPWIDGLTLLGGEPMEPSNQEALLPFVKQVRDAVPEKTIWMYTG
FT                   DIYEDLTDPASPRHTQYTDELLSLINVLVDGPFMQERKDITLRFRGSSNQRIIDLAATR
FT                   ATGKVVLWHDDPQYETHTM"
FT   gene            complement(299271..301493)
FT                   /locus_tag="Ccur_02440"
FT   CDS_pept        complement(299271..301493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02440"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="PFAM: ATP cone domain; Glycine radical; TIGRFAM:
FT                   anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93973"
FT                   /db_xref="GOA:C7MM33"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM33"
FT                   /protein_id="ACU93973.1"
FT                   /translation="MKVIKRNGSEVIFDVTKIVNAIAKANEEVVPENRLSQAQILTAAN
FT                   NVTTECEACGHAPAVEEIQDMVEDQIMALGCFEVARKYIIYRYLQNQKRASNTTDDKIL
FT                   SLIECNNEEVKQENSNKNPAVVSVQRDYMAGEVSKDLASRMLLPQDVVWAHENGLIHFH
FT                   DSDYYAQRMHNCDLVNLEDMLQNGTVISGTLIEKPHSFSTACNIATQIIAQVASCQYGG
FT                   QSISLAHLAPFVDISRQKIRRAVIAELNDLGLEATGDRLDTVVEARVRDEIRRGVQTIQ
FT                   YQVVTLMTTNGQAPFITVFMYLNEARNEQEKHDLAMCIEEMLRQRHQGVKNEAGVWITP
FT                   AFPKLIYVLEDDNIEADSPYYYLTQMAAKCTARRLVPDYISEKKMKEYKLSAGEEAGNG
FT                   DCYTCMGCRSFLTPDRSGNGYNNVANVANWDPTKPKYYGRFNQGVVTINLVDVALSSEG
FT                   DINKFWEVFDERLELCHKALLCRHNRLKGTLSDAAPILWQYGALARLEKGETIDKLLYG
FT                   GYSTISLGYAGLYECTKYMTGKSHTNPEATPFALEVMQHMNDKCNTWKEEHDIDFSLYG
FT                   TPLESTTYKFSKCLQRRFGIIEGITDKGYITNSYHVHVAEEIDAFNKLKFESQFQPLSP
FT                   GGAISYVEVPDMQDNLEAVMKVLHYIYDNIMYAELNTKSDYCQVCGFDGEITIIEDDGK
FT                   LVWECPHCGNRDQTKLNVARRTCGYIGTQFWNQGRTQEIKDRVLHL"
FT   gene            301766..301861
FT                   /locus_tag="Ccur_02450"
FT   CDS_pept        301766..301861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93974"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM34"
FT                   /protein_id="ACU93974.1"
FT                   /translation="MSAVEPYAVVGAVMICDEMFIRFAADYKKEF"
FT   gene            301866..302432
FT                   /locus_tag="Ccur_02460"
FT   CDS_pept        301866..302432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02460"
FT                   /product="PAP2 superfamily protein"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93975"
FT                   /db_xref="GOA:C7MM35"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM35"
FT                   /protein_id="ACU93975.1"
FT                   /translation="MDLAILHMIHTLSVVPLLNSVMVGFTSLGEYGAVWLALAVMLTLT
FT                   KKYRAWGICLVAAVGLTWVLGDVVLKPLVARPRPFMVDSSIALIITPPSGFSFPSGHSG
FT                   ASFAAATIFFLSPARRLAKVAVAILAIIIAFSRLYLFVHNPTDVLAGALLGIVCACVVV
FT                   VAYRRLNSMAESRGWRIPSFFDEQV"
FT   gene            302737..304512
FT                   /locus_tag="Ccur_02470"
FT   CDS_pept        302737..304512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02470"
FT                   /product="membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /note="PFAM: Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93976"
FT                   /db_xref="GOA:C7MM36"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM36"
FT                   /protein_id="ACU93976.1"
FT                   /translation="MPNTSDTSRSRRSVRAIRKAAQKRETTRSDDVQIDKTTRDASRGK
FT                   TTRESSRKQRMIRSGKVRRSKTIQSKTSRSDDEQNGKYASDRFIGSAARYLNEERLANQ
FT                   ASYGYFKSSREIEDEQGHRARRQPGRLRKLISDWGDRLLGAVSDKTFSGQEELYDGGRT
FT                   KLDYVWNTAGLTTWGMVFPLLTIVVTQLSGVEAAGMFSFAFVAGTLLMILANYGARTFQ
FT                   VSDLKEAHSFRDYQINRWITCLLMLLVGWAFCTVRGYDGEMLLMTTCVFIYKMIDGLAD
FT                   VYEGRLQQKDKLYLAGVSQAVRSVAVFILFTLALLITRSIGVAAMVMAVVAVLSFLLVT
FT                   LPLTLFETPRSGKLSLSGVADLFKQCFPMFIALFLYALVDNMPKFVMEGTLTYDNQLYF
FT                   SALYFPAQAILLSVGFIYKPLLVRMAEAWVDPDRRSRFDLFIIAFIGIIVGITLFMEFM
FT                   MSWIGIPIMSVLYGVDFEGFRNLATLMIAAGGITAGIDFLYQVVTVMRHQKSVTQIYLV
FT                   TFVFSLFIPWMLIHVSGLSGAVIGYLIVMAMLFVMLLMDYVSVRLLYRRHPEDDPAYAE
FT                   LQAAVEARRRTSSRG"
FT   gene            304655..305614
FT                   /locus_tag="Ccur_02480"
FT   CDS_pept        304655..305614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02480"
FT                   /product="Mg-dependent DNase"
FT                   /note="PFAM: TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93977"
FT                   /db_xref="GOA:C7MM37"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM37"
FT                   /protein_id="ACU93977.1"
FT                   /translation="MDSRDYQGAAMHEVSPSAIERAARFDAHCHWAFTSNVQAVAQQAE
FT                   NDGLHVLSCTVSPMEYQQHTQQMDSFPQVRVGLGLHPWRFSDIQLTQPSGHQGQSVQQM
FT                   QPSNQLDQPTNRLNRSVGEAQSASQLGQPLYQPAEQDEFLELFPSAYFIGEVGLDFGRA
FT                   HAATRDEQVAFFSRAMREVAVQARRGVGHVVSIHAVAAAGAVMDAADVVCAQEGCCCIL
FT                   HWFSGTSSELTRAIRSGYYFSVGERMLATRRGRAYAQAIPADRLLLETDWPSKPEDPFE
FT                   YVDYRARLVRAAQTLADLRGEDILNQIVATNARVLGAE"
FT   gene            305634..306308
FT                   /locus_tag="Ccur_02490"
FT   CDS_pept        305634..306308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02490"
FT                   /product="haloacid dehalogenase superfamily protein,
FT                   subfamily IA, variant 3 with third motif having DD or ED"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93978"
FT                   /db_xref="GOA:C7MM38"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM38"
FT                   /protein_id="ACU93978.1"
FT                   /translation="MTASFDIDRISGVIFDCDGTLIDSMDAWNRAEAYLISHGQGPLSP
FT                   EDMEAVRALPILQAAQIFHRYGIGKDPDDVLTLLDEALLGFYRNEACLLPGARELVGTL
FT                   TTAGVPCVVVSSSPMRYLHAGLSRNDLFDTFVKVISTDEVGISKQESRIYHLAADVMSS
FT                   DLETTWGVDDALYAIRAMRDAGLHTVGIYSCDETAESFDALAAASDICIRSLDELLQVH
FT                   TS"
FT   gene            306374..306449
FT                   /locus_tag="Ccur_02500"
FT   tRNA            306374..306449
FT                   /locus_tag="Ccur_02500"
FT                   /product="tRNA-Phe"
FT   gene            306936..308108
FT                   /locus_tag="Ccur_02510"
FT   CDS_pept        306936..308108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93979"
FT                   /db_xref="GOA:C7MM39"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM39"
FT                   /protein_id="ACU93979.1"
FT                   /translation="MQAGYYSSAWSDIKNSPGWFGKMCLMALLLFIPIFGPIVVNGYLY
FT                   GWARDIAWDVKSPMPKSLFNNADGRLYSRGFFILVLGFVLSFVTAAVYLLCDGLTTGAL
FT                   ITANRNPSALILASLIGLIILAVMIVAAILVEIFSWVGSMRISIYGNISSGFQFGKIWK
FT                   MIRHDIGGIARIFLIDIVASLIVGVVFSIVFMIFFLFIGIGVFMPFIDLLSSDLGFTSH
FT                   TMTMADNGAVISAFFSAIAAFGVFVLVFCYITLVASVFINTVVTRALGYWTRQFNVAQW
FT                   GPQEAPMPFEMEQAQQSAAYQAMYQQQPQQYTQQSQQYAAPVVTQQPPAQNPAASVQPV
FT                   QAQPAAADTPVADVAGGDAATQSADTATSDSSASGASGNDDGDPAEKPNA"
FT   gene            308325..308792
FT                   /locus_tag="Ccur_02520"
FT   CDS_pept        308325..308792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02520"
FT                   /product="phosphoribosylaminoimidazole carboxylase, PurE
FT                   protein"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93980"
FT                   /db_xref="GOA:C7MM40"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM40"
FT                   /protein_id="ACU93980.1"
FT                   /translation="MATSNQPLVGVIMGSQSDMPVMEKCFAQLDEFGIPFEVKVASAHR
FT                   KPLEVHEWAASASERGIRVIIAAAGKAAHLGGVVAAYTPCPVICVPMKTSDLGGLDSLL
FT                   SMVQMPSGVPVACVAINGAKNAAILALQMLGIGDKTYRDQMAAYKKEMADA"
FT   gene            308785..311052
FT                   /locus_tag="Ccur_02530"
FT   CDS_pept        308785..311052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02530"
FT                   /product="indolepyruvate ferredoxin oxidreductase,
FT                   alpha/beta subunit"
FT                   /note="PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain; 4Fe-4S binding domain; Pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding
FT                   domain; TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93981"
FT                   /db_xref="GOA:C7MM41"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM41"
FT                   /protein_id="ACU93981.1"
FT                   /translation="MPSKLLMGNEAFAWAALEAGVRVVAGYPGTPSSELIETVARLHAQ
FT                   GIARGVHVEWSTNEKAALEVLAGASASGARALFTCKQVGLNVASDALMSLNYVGVRGGL
FT                   VLYVADDPGPISSQTEQDTRRFADFAKVPVLDPATPDQGYEMMHHAFDLSEKYATPVIV
FT                   RPTTRICHASTFFEMPSSTTARPIPEGGFERDSKWVIFPRRSYQAHGEINRRLPDIAAQ
FT                   ESRGVFNPSTECGTNSQRGIVAGGVSVQYVKEALSRWEQRLAAVGKVMPAYKFMQVGTP
FT                   FPFPEEAALRFIDGLSELLVFEELDSVIEDGLLALVGAHHLSVDIKGRRTGDTLDRGEN
FT                   TVEDAETRLGVFLGLTDLIEEKGAASFSSSSSASSLSASSPSATSRSSSTESSASSAHS
FT                   SSASSLAEEVHPPLRPPVLCAGCPHRGAFFALKRALRGRKHVFCGDIGCYTLGNAKPLE
FT                   AVDTCLCMGAGITMAQGMATVEPDRACVAFIGDSTFFASGLTGIANAVYNQHDITVCVL
FT                   DNSTTAMTGGQPHPGTGTTLMGQVGEAIDIEGVLRALGMKCVTRANPLYVRESVKAAKE
FT                   ALDFKGPSAVLFESPCTQIVPPEPAALVDPARCTACRVCIESIGCPAMSMIPRADVLAT
FT                   EDAPASGDVPAASDASAADGTSAVGSLPTTDKDPGQSSAPAASSHNGKAAQAYTSIMNI
FT                   DPTLCYGCGLCVDVCPYHAISAAVRNEGRLPFAQACEKGRLRLADSAGLSRGAQQKEGR
FT                   HA"
FT   gene            311045..311671
FT                   /locus_tag="Ccur_02540"
FT   CDS_pept        311045..311671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02540"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /note="PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93982"
FT                   /db_xref="GOA:C7MM42"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM42"
FT                   /protein_id="ACU93982.1"
FT                   /translation="MLNVLITGIGGQGSVLAAKILAQAAAHRGWQVRTAETIGMAQRGG
FT                   NVMSHVRMGNDGEEVLAPLISQGSANCVIALEVGEGLRALPFLSPQGLMVCSTAAIPSV
FT                   AESLASNPYDAQVLQEAVQARVPRVVMVDDDAICRAVGSRKVANVAMLTAALIALQSLE
FT                   GGLGTAISLDEMERAMEQCVKPRFVELNQNAIRTTQRFQVLKEKE"
FT   gene            311674..312912
FT                   /locus_tag="Ccur_02550"
FT   CDS_pept        311674..312912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02550"
FT                   /product="phenylacetate-CoA ligase"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93983"
FT                   /db_xref="GOA:C7MM43"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM43"
FT                   /protein_id="ACU93983.1"
FT                   /translation="MQITDEQFDLLTHQLTNLKDRSAFYARKFADIDLSDVRTQADFEK
FT                   LPFSEKADLREAYPLGIQAVPDEEVVRIHSSSGTTGTPVIIPYTAQDVQDWAQMFARCY
FT                   QVAGVTPTDRVQITPGYGLWTAGIGFQLGCERLGAMAIPMGPGNTDKQLQMMQDLKSTV
FT                   ITATSSYALLLAEEVNKRGLRDKISLRRGVIGSERWGEKMRRRIENELGIEIFDIYGLT
FT                   EIYGPGIGISCEAHAGMHVFSDYIYMEVIDPKTGRVLPDGEVGELVLTTLRKQGAPLIR
FT                   YRTHDLTRIIPGVCPCGRGEHPRIDTLVGRTDDMIKVKGCNMFPAQIEECLQFVEGASS
FT                   EYQVMIESISGHDVLTLLFETGLSGADREHCEQELAMVFKAKIGCTPDAKGVPLGELPR
FT                   SEKKTRRIFDSRY"
FT   gene            313194..313269
FT                   /locus_tag="Ccur_02560"
FT   tRNA            313194..313269
FT                   /locus_tag="Ccur_02560"
FT                   /product="tRNA-Arg"
FT   gene            313515..313715
FT                   /locus_tag="Ccur_02570"
FT   CDS_pept        313515..313715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93984"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM44"
FT                   /protein_id="ACU93984.1"
FT                   /translation="MEKALDINGNEIDFEAAVNLMDDEIREELHEKMAPCSNQEFLEAY
FT                   AKAHAEKFDGEEFAPYYGEAW"
FT   gene            314235..314423
FT                   /locus_tag="Ccur_02580"
FT   CDS_pept        314235..314423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93985"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM45"
FT                   /protein_id="ACU93985.1"
FT                   /translation="MQTPAQKRARAKYEREKTKQYKIRLSTISDADMIAYLDGLDNRQG
FT                   RLKELIRADMAHSQNPR"
FT   gene            complement(314561..315580)
FT                   /locus_tag="Ccur_02590"
FT   CDS_pept        complement(314561..315580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02590"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="PFAM: Putative cell wall binding repeat;
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93986"
FT                   /db_xref="GOA:C7MM46"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM46"
FT                   /protein_id="ACU93986.1"
FT                   /translation="MDINHDYTAHSGNYTPGGNRCEYIAVHYTSNSAPARSEASYAQNS
FT                   QHSSSYHYVLDGYECYQLLNDTDTAWAVGTWPGYTQLISNRQAISIEVCNAGGSFSDAE
FT                   RDQLRELVALLMERHSIDADHVVRHWDCHTGRKECPEYYAGAKSNEWSELHDYITGGGT
FT                   VSEYGWQHDDGGWWYKWYQDNGGYSYQKDEWQIIDDKWYYFDSDGYALCNAWHVEDGTW
FT                   YRFGDDCALLSGWQFIDGYWYHLHTEHDGTFGAMDTGWYTEGGEAFWLTPDDEGNHVLG
FT                   AMVIGWHKPEGSWAYFDESGAMARDTIKRIDGKWYIFEPGGSLVEGTFSTDENGALQL"
FT   gene            complement(315654..315905)
FT                   /locus_tag="Ccur_02600"
FT   CDS_pept        complement(315654..315905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02600"
FT                   /product="holin, phage phi LC3 family"
FT                   /note="PFAM: Bacteriophage holin; TIGRFAM: holin, phage phi
FT                   LC3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93987"
FT                   /db_xref="GOA:C7MM47"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM47"
FT                   /protein_id="ACU93987.1"
FT                   /translation="MINWEIRMKSKTFWLGLIPAVLLLVQAIAVPFGYTWDFAELGSQL
FT                   TGIVNAAFALLAILGVVVDPTTPGAGDSERALSYGHEE"
FT   gene            complement(315902..316303)
FT                   /locus_tag="Ccur_02610"
FT   CDS_pept        complement(315902..316303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93988"
FT                   /db_xref="GOA:C7MM48"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM48"
FT                   /protein_id="ACU93988.1"
FT                   /translation="MEQSIIEIAIAVARDSPALATAGLIVVAALAIWIRISPAVVDYYT
FT                   RRTEREEAREVRKREESEDRAKLEGQWLESQKRATAAIETSNQLVKRMVDKIDDDKSRS
FT                   ERIEGRLAKIDGEMGQMATEIHLIKEIVK"
FT   gene            complement(316313..317131)
FT                   /locus_tag="Ccur_02620"
FT   CDS_pept        complement(316313..317131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93989"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM49"
FT                   /protein_id="ACU93989.1"
FT                   /translation="MKIVNGYSGSEHVTAAMDGALYAGVFGSGNYVMDVGKRLEAVMSD
FT                   ANHVQVSDGDLIMGGRHGIIAQGKTDTLTVDSGQTGWKRNDLVTARYTLNTQTSIETIN
FT                   LMVLKGAKTQGTPADPTYNKRSILEGATTADFPLYRIALDGINPKLEKLFTVAKPLEAL
FT                   ATATEQTKWSEVWVTSDGAIDARVCRIGDTVYFRASCFDGFTPSTDLDNPSSFTTLPAW
FT                   ARPKLEWRAPIMYISDNQTGYARFKTDGVVTLSGFSNSRYWYVCTSYPAI"
FT   gene            complement(317128..317358)
FT                   /locus_tag="Ccur_02630"
FT   CDS_pept        complement(317128..317358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93990"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM50"
FT                   /protein_id="ACU93990.1"
FT                   /translation="MAKTEGVTLYECDRCGAKEYIKPGSSGGHFWHTITRIDAEGVQTS
FT                   RLLCEACYQDYTGLIKQQDEEFQSFMKGGKK"
FT   gene            complement(317377..318357)
FT                   /locus_tag="Ccur_02640"
FT   CDS_pept        complement(317377..318357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93991"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM51"
FT                   /protein_id="ACU93991.1"
FT                   /translation="MELDLVYTDTRHVPRGILSGYALDLSFGGDENRFELVCPADTRLD
FT                   PGALVGAYGTEYGGIVDETEPADDGYTITYMGRTWHGLLVERIIEPDAGAGHLHWQGEA
FT                   HAMIRMLVSRCGLSSLFEVPGSSGIAIPSLDFDRYTTVWDGMTKALSKAGARPYISWDG
FT                   GRVVIKAVKAKTVEIDSDTHPVHIVSVHRSVNHLICLGKGELADRTVIHLYTDASGSIS
FT                   TSPTFTGVDEIAEVYDYSSAEAEELEKKGREELAKRHKASSAELSSLDDLGDIAAVGDT
FT                   FHAIERTTGIEAHATITKKIVKVRYDGTVEVRYETGEKRATGDAE"
FT   gene            complement(318348..319175)
FT                   /locus_tag="Ccur_02650"
FT   CDS_pept        complement(318348..319175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93992"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM52"
FT                   /protein_id="ACU93992.1"
FT                   /translation="MIKYTNHYGESVEFGHWPLRHSETDVNDVEWTCDDLNGRTVSSRR
FT                   EARDYTISAKLRGGTAEDRQRLDDIFEADTAENVDGTLTVRGWSLRCRRTKSSKGLWWI
FT                   DDGILNDEITLHAARPVWERSTEYSFLIRDEHTASSLKCKYPHGWPYAYPLDRRIQQLD
FT                   NPSISSCGLTLRIFGACADPYVIIGGNRYGARVTLAEGERLEIDTRHGHKTAVKISHDG
FT                   TQANVFDALVNGAKGSGSYAFEPIARGKSDVTWPGTFAFDVVVHEERSMPAWS"
FT   gene            complement(319168..322455)
FT                   /locus_tag="Ccur_02660"
FT   CDS_pept        complement(319168..322455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02660"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="PFAM: Phage-related minor tail protein; TIGRFAM:
FT                   phage tail tape measure protein, TP901 family, core region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93993"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM53"
FT                   /protein_id="ACU93993.1"
FT                   /translation="MADVGEVRVRVLYDANQVTSGVARTKSELKGLSWKGILEGDKAAQ
FT                   ALSSSLRGVGTALTVGVTAPLAAVGGLSTSAAVKFESSFAGVRKTVDATEEQFQALSQA
FT                   ARDMAKSKPVNVNDVNLIMELGGQLGVAQENLVKFADVVSDLDVSTDLGVEQASTQLAQ
FT                   FMNITGQSYDNVDRLGATLVALGNNSATTESAIMNMGMRIAGAGHQIGLTDDQILAVAA
FT                   SLSSVGIEAEAGGTAISTIMSNIDKEVATNGKHLEDWARVAGMSSEEFKAAWSSDALGT
FT                   LTTVFRQMGDSGDNLNVVLDDLGITSLRQSDTMKRMSGAADLMAASVQTASQAWEENTA
FT                   LTNEASRRYETTESKIEVFKNKLNDVGISLGGSFADALTGVLDAAEPLIDMLSRGAEAF
FT                   AGMSKEQQQAVIQMALVAAAIGPITNGAGRLVGSIGNITSAFKTMTEGVKIANVAMGAL
FT                   EGVLGVAIVVALGTLYDKFKEWKTHCDNMTASTSGAREALSLFGKSIQDQGDSASGAST
FT                   SLDGMRGKIDEVVNSARSAAEDGAKFTQSMKDSFTEVGQNAGVVQQYADKISELAGNCG
FT                   GSAEKVAELKGAVEQYNKLTGDNIKVIDEQSGKISESTGKVKENTDAWVANAWAQAGQE
FT                   KLTEAMKLRMDLAEKLNKEKEAYAKWQKSQRPGVGREQKQNAQHDSQDQAFKDSIAGLE
FT                   KQLDSADESIATLTEHTTEYMQKADEAAKRSKSFAEALNKAEDSGEAFSSLAERLGVSA
FT                   DDLSSALDASGISAEEFASLGSENFARLYQEAQGDMSKIRDAVDLTNELHINPKHLHVT
FT                   DDGTIADEAGRVWDLDAQTIDGKHFTVNDDGTISIENTNVDHLDANTIADKDFVITDNG
FT                   TAATAEGNADSVNSAVRSIPYDKTVTISVATEAAMSALSGLSSRIASIASQAIHLNTTG
FT                   YASGGMFGYPLKVYKHADGGLNGIAVRPVMTNAGLVGEDGAEAVLGNKVVPLTNRRYTR
FT                   PFAQTLAQEMTGTLSTDIAQKVAKRLVDSPALRTVDWSAPPAMATSSVLWPNGQQEKTE
FT                   PVEVNVDARDPEATALLRAILEAIPDEYVMKVDRTEFARLCRKAVND"
FT   gene            complement(322458..323063)
FT                   /locus_tag="Ccur_02670"
FT   CDS_pept        complement(322458..323063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93994"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM54"
FT                   /protein_id="ACU93994.1"
FT                   /translation="MQLNRRETVVDGRHCALVTVGGHEIAVRDDLTTSLDVMSALEDDS
FT                   TPAERIERVLSLMLPDLASLEYLADGDILRLVWELYGIDLAGEHTAECAGARVFDWNED
FT                   ASLVRAALLSEYGMTVAEASQRASYMDICALVGLVSRDTPLGQALYYRSAPEPEGERER
FT                   REFRRMRAHWALKERENADDYARMSAEADRAFSALARS"
FT   gene            complement(323044..323469)
FT                   /locus_tag="Ccur_02680"
FT   CDS_pept        complement(323044..323469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93995"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM55"
FT                   /protein_id="ACU93995.1"
FT                   /translation="METLSIHRAVEEIRLSDAPDAPVARMSMDAASINEAAQKIAAMQK
FT                   QFAELKAKIAKGEVSDKDAKRIAKVYRDVLDACLGQTQRLAIYKWLKGGAHIPDAEVNH
FT                   LISPLVVWCQQNVLDAVMPHVQAEAFAELTDNAAQQA"
FT   gene            complement(323518..324213)
FT                   /locus_tag="Ccur_02690"
FT   CDS_pept        complement(323518..324213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02690"
FT                   /product="Ig-like domain-containing protein"
FT                   /note="PFAM: Bacterial Ig-like domain (group 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93996"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM56"
FT                   /protein_id="ACU93996.1"
FT                   /translation="MDIAFALNYTNLYMIDTTPEEKTPTWARVGAGINSVKWDGNEKSS
FT                   DDDYYDGEGQASTEVTGGQIVGSFSGHRKFGDPAQDYIASLAVKYGAKRHTNFKRIAPD
FT                   GTVTTGDVTLANISEGGGDPNSKGDFSFEARFNGLPVIEPGNKHSFPESITASVVTVKI
FT                   GQKVKATATVTPATASDALLYAVEDDTVAKVAIDGTVTGVKAGKTNLTVKSAVLPSVGK
FT                   TVEITVTAA"
FT   gene            complement(324216..324605)
FT                   /locus_tag="Ccur_02700"
FT   CDS_pept        complement(324216..324605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93997"
FT                   /db_xref="InterPro:IPR024411"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM57"
FT                   /protein_id="ACU93997.1"
FT                   /translation="MRLIDADEAVLAAIKAAGIEAHITALDAFTGNEGVVVQALPATVT
FT                   STDFDGTQHLGAKVQIIARYFGRNKAREAVERIVSLLDGIPLPSPSGRYTWEETEIYTW
FT                   PQRMDDSKYDTWEVKINVQIARERR"
FT   gene            complement(324602..324937)
FT                   /locus_tag="Ccur_02710"
FT   CDS_pept        complement(324602..324937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93998"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM58"
FT                   /protein_id="ACU93998.1"
FT                   /translation="MSLDITHNLAGFDKLLDACKDGIQEELAERVAKDMEPYVPKDTGA
FT                   LRGTVKVSKDEIVYPMNYAAPVYDMPDGTHWTTAGTGGKWFEEAKSHHMNDWNGTVAES
FT                   IARQIRR"
FT   gene            complement(324934..325257)
FT                   /locus_tag="Ccur_02720"
FT   CDS_pept        complement(324934..325257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU93999"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM59"
FT                   /protein_id="ACU93999.1"
FT                   /translation="MIAPIPAELLSETAEVRVMTEGGGYETEPRRIEGVRFQGALSLGH
FT                   GVSVADGAEGILFIDAANSLGAFAIPEGSLVRLDGGRWRAAIKVEELHGLYGQLHHWEV
FT                   HIG"
FT   gene            complement(325254..325565)
FT                   /locus_tag="Ccur_02730"
FT   CDS_pept        complement(325254..325565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM60"
FT                   /protein_id="ACU94000.1"
FT                   /translation="MKAPSYSRYQSLGGQLPEASYDALKLSAADLVRYVVGINPTTDEE
FT                   ALEHAFMAALGELSHGEGGFTLGSFRMNERTGQEMNNRAIDAVMRALAGTGMSYGGIA"
FT   gene            complement(325565..326374)
FT                   /locus_tag="Ccur_02740"
FT   CDS_pept        complement(325565..326374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94001"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM61"
FT                   /protein_id="ACU94001.1"
FT                   /translation="MPTTFTSFPVAYSNALDEVLVASTYASKYSVPGAEFLTAKQVSVP
FT                   DLSFGASPAPVAYNRFKSAEGDIKVDRKVYTLAHDDEKVFYIDAVDAINEAAVPITKAI
FT                   SEYQRTILAPEIDKDFFAVAKAKAATKGTTALTAANIKAEIRKARTQFTQAGLHGGDLY
FT                   MTSAALGLLEDATNRQWSNETSITDTVGSYNGFNVYEVADSILGADFTAISGGNRTMQY
FT                   ITKRAALYLFAPGSHTNGDGWLAQNRWVYGSIVPANKAAGVYTSKKA"
FT   gene            complement(326384..326893)
FT                   /locus_tag="Ccur_02750"
FT   CDS_pept        complement(326384..326893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94002"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM62"
FT                   /protein_id="ACU94002.1"
FT                   /translation="MDDENKTEPQENTEPETEPKTEPQTEPTGDEGGKPDAAKAAEKYK
FT                   AQRDEARQQIADLEKQMAEYKGNDEIITKLQADLKKTREEAEAQAKKAEADRVNSNRLT
FT                   KAGCVDVDVALGLLDENGDVDKLMEQKPYLFTKKGSTGLPPSGQGGDAASIARAREAAG
FT                   LPPIKD"
FT   gene            complement(327074..327412)
FT                   /locus_tag="Ccur_02760"
FT   CDS_pept        complement(327074..327412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02760"
FT                   /product="VRR-NUC domain-containing protein"
FT                   /note="PFAM: VRR-NUC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94003"
FT                   /db_xref="GOA:C7MM63"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM63"
FT                   /protein_id="ACU94003.1"
FT                   /translation="MSEADEQKAVVAYLKMRDIPFYHIPNEAKRNPKTASHLKALGMVA
FT                   GVPDLCIPVARGVYHGLYIEMKAGRNKPTESQMRWLSLLQEQGYAATVCWGADEAIATI
FT                   GEYMHARA"
FT   gene            complement(327573..327932)
FT                   /locus_tag="Ccur_02770"
FT   CDS_pept        complement(327573..327932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94004"
FT                   /db_xref="InterPro:IPR018597"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM64"
FT                   /protein_id="ACU94004.1"
FT                   /translation="MSSDDFDVIVYKVLAYIMACAKADVVPSIAKAREISKAGSVYWAM
FT                   VARSMVADGLIVGVSVETYYDGTSEVTAGTDFGITQRGAQYLRDSSKMREAAHLLGSAF
FT                   TESLPILIEATKALL"
FT   gene            complement(327940..328140)
FT                   /locus_tag="Ccur_02780"
FT   CDS_pept        complement(327940..328140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94005"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM65"
FT                   /protein_id="ACU94005.1"
FT                   /translation="MALDLYSERPFYDEEVKLCKEWAEDGLTVDLDEYIHSHGTPEYIE
FT                   YYDQGLKELEELHRQSPDEMW"
FT   gene            complement(328131..329948)
FT                   /locus_tag="Ccur_02790"
FT   CDS_pept        complement(328131..329948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94006"
FT                   /db_xref="GOA:C7MM66"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM66"
FT                   /protein_id="ACU94006.1"
FT                   /translation="MLEPEEIETAAGGMDSELEDYQRELLTIEAAGLLAASTLAGYHAA
FT                   RDRITRQMMTAAAKHAPRLRKAAARTYSQALRYSAVEDAEAARMSESVRQYHVAEARMR
FT                   AEQAAEAFRAEPLAREMARSASNDMMRRATGLAVARASSGAAGYERAVASAVADLSARG
FT                   VTAFTYTRVVDGIPRTVRMSADAYVRQRLLTDIKRETYESTLSAAGISGANLVAVSCTI
FT                   TCRDTHAPWEGRIYQLNGSGKYPNFYERTMYVYGTNPNWTEGLGGYNCNHSFRIWHPGI
FT                   KRDDPLKDTGYTRHEAAEIVGRQRTLERGIRASKRQREVMRANGLDTSIVGARLRRQTA
FT                   ALNQLIADHPQILRREIWRERTGEAIRRAQGTEGVVHLNATAAAEVRRQAAITQAARAA
FT                   KRKPYEWTNPAVSALSKPEDVARYLSSNFGIEARESFQALPLDTQRASTAGIARAAELY
FT                   GEIDVTYIKAMAKNHEKIGAYTTTPGTIHIAENADDAYAVSLHEAIHAADAYKSSKMRE
FT                   FASTSGIRAYNIHSKKVLAAALKDMGWRSNSRGYINELTRIFGNNPMLANEYKNKHWEV
FT                   IAHAIERNETGRSSEFTKAVARRFAEQWH"
FT   gene            complement(329952..331346)
FT                   /locus_tag="Ccur_02800"
FT   CDS_pept        complement(329952..331346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02800"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: phage portal protein, putative, A118
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94007"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM67"
FT                   /protein_id="ACU94007.1"
FT                   /translation="MERYTVPAHVQDFIKAQGYPFPASDMDTYIQAWWELLHAQGDFWD
FT                   YNDRSGGVYRRVHRRSIRPAKRVAKEWATLMLDEKTTVDCGEQTCTDWLAAYYGRIGFF
FT                   ARAQRLVQQAFALGTGAWALWLDTERGAMQVRRYSGSAVLPLSWDDDGVSECAFASQAS
FT                   VGGKMVDQVQMHLRRDDGYHIVSHLWDARTGHEIEIEGVAEDLPTGCPTPTFAIVTPGT
FT                   DNTCVELSPYGESVYADAIDTLQSVDLCYDAVMNEVDLSKMRVFISDLLIDYQRDGEQV
FT                   VAIPFGRDNVVFRNVATGANSSVKDSIEVSAPSMRTAEQLQAYRAALQSMGDACGFGLH
FT                   YFDIDQTGGIRTATEVSSDNSQLMRSIATHENALGASLAQISRAVLHCARSVLNISLPA
FT                   EGDLRVIFDDSIIQDTQALKQQDMAEVTAGVMSPWEYRVKWYGEDETTARERVPEQGIE
FT                   PSMSLG"
FT   gene            complement(331349..332629)
FT                   /locus_tag="Ccur_02810"
FT   CDS_pept        complement(331349..332629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02810"
FT                   /product="phage terminase, large subunit, PBSX family"
FT                   /note="PFAM: Phage terminase large subunit; Protein of
FT                   unknown function (DUF1545); TIGRFAM: phage terminase, large
FT                   subunit, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94008"
FT                   /db_xref="GOA:C7MM68"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM68"
FT                   /protein_id="ACU94008.1"
FT                   /translation="MINAARLIISHFHSILADVFAECGHHEYWLEGGRGSTKSSFISLV
FT                   IVLLVATFPWVNAVVFRRQANTLRDTVYGQFLWAIGALGLDGCFYTSKSPLEIVYLRTG
FT                   QKIIFRGLDDPKKRKGAVFPVGYCAVQWFEELDEFNGWDDISSTLRTYRRGGSRFWTFY
FT                   SYNPPRSLWSWVNKKALEMQRKRGCVVDHSTYLDVIDGGHSDWLGEKFIEDADYEKEEH
FT                   PTGYRWEFLGEITGTGGSVFENVVQVSLSDKEVESFDNLRCGVDWGWFPDPWRFVMCEW
FT                   QPARRRLVLFRELSANRTTPQDTGAMVREALTYRDARHKEPTYHRDAVWCDSAEPSSID
FT                   IYRRQCGLNARAADKGGMRRVSYQWLEGLREIAIDPERCPRAWEEFTLCEYAKDRAGRW
FT                   LDDYNDGNDHSIDAVRYAMMRECVRGA"
FT   gene            complement(332622..333071)
FT                   /locus_tag="Ccur_02820"
FT   CDS_pept        complement(332622..333071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM69"
FT                   /protein_id="ACU94009.1"
FT                   /translation="MPKTKTGKYHRWITPEGLAQIENWSAKGCLDKEIAHNLGIALGTL
FT                   YEWKIKHAEIAEAIKTGRAESIVAIENTAFKLATGTVEEQTIVKVRDAEGSERVEMRKR
FT                   RLKPDTAMLIFMLKNRAGYSDNPNAKPTESAPTIILGVKPKAIDD"
FT   gene            complement(333058..334290)
FT                   /locus_tag="Ccur_02830"
FT   CDS_pept        complement(333058..334290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02830"
FT                   /product="ParB-like nuclease"
FT                   /note="PFAM: ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94010"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM70"
FT                   /protein_id="ACU94010.1"
FT                   /translation="MRPQPDLEIHTAAVSDLVPYAHNAKLHSQLQVGQIADSMREFGNC
FT                   DPIAVWHNPQGDMEIVEGHGRVLALQRLGIDTCPVIYLDHLSDEQRRAYTHVHNQLTLN
FT                   SSFDMSVLESDLDSLDFDWGSFGFDDGESWFENRKKWDDQKGDSAEHDAFVEKFENKKT
FT                   TDDCYTPDNVYEAVAKWVTSEYNIDRASMVRPFYPGGDYESYSYPEGCCVVDNPPFSIL
FT                   AEILKFYCKNGMRFFLFAPTLTLFSPTQPELCYLPCGAQVVYENKANVNTSFITNLDEA
FT                   RIRTVPTLYEAIETANKANIKEESKELASYEYPNEVVAAAQAARLSKYGIELSIAKDEC
FT                   VKVTALDAQKEEGKAIFGGGFLVSKQAAAKQAIASEAAAKRAAVKEVTYWELSERERAI
FT                   IEKLGGAHAED"
FT   gene            complement(334416..334799)
FT                   /locus_tag="Ccur_02840"
FT   CDS_pept        complement(334416..334799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94011"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM71"
FT                   /protein_id="ACU94011.1"
FT                   /translation="MGEIKTYNYNFPPYDNGDIDITSQIGKIIKEVGEVNKACDNTEQV
FT                   AIECMDVIVTCETLLRMLPEGYTDAAKQMVYAKIARRGKWEEDTTEQTAEQATDTDRPH
FT                   PSAFVLSMKLTPSMVNIRRIDDE"
FT   gene            complement(334948..335379)
FT                   /locus_tag="Ccur_02850"
FT   CDS_pept        complement(334948..335379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94012"
FT                   /db_xref="InterPro:IPR037216"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM72"
FT                   /protein_id="ACU94012.1"
FT                   /translation="MYDTDEAVFPSGVRVYANIIKNGGGKVPWYRHSQHGVMGDGDTRV
FT                   ACYKQGWPTIYHWEKGADKPEEFDFDKLSRMLGLDDFEEYDGTRYAPDEYDHEFILYGW
FT                   RFRFWGDLNGGTPKYGAVMQRDEEYWECTYDYCYGAGFE"
FT   gene            complement(335764..335988)
FT                   /locus_tag="Ccur_02860"
FT   CDS_pept        complement(335764..335988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94013"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM73"
FT                   /protein_id="ACU94013.1"
FT                   /translation="MKKDKKVIRCAECSNAAWRQHVGFHGTNELYCMERSGTVEPDDGC
FT                   TFGCEGKPRWAAIEYEISLGDDAAKHGNW"
FT   gene            complement(335995..336207)
FT                   /locus_tag="Ccur_02870"
FT   CDS_pept        complement(335995..336207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94014"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM74"
FT                   /protein_id="ACU94014.1"
FT                   /translation="MIPTLKLRERILAWLLWHLEARHGFGGGFDVPIDGARWQFSKPER
FT                   ASLLYTYALLNDYYMIKASRLFREK"
FT   gene            complement(336204..336569)
FT                   /locus_tag="Ccur_02880"
FT   CDS_pept        complement(336204..336569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94015"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM75"
FT                   /protein_id="ACU94015.1"
FT                   /translation="MSEDDKTEQTPFVEELLKALPKKASYAMTEETERSRLLDDARKVV
FT                   CCDREIKYGFVEDNFWDIARMWGVYLGVDLERRDVANMMILLKVARNNHAHPDDPGHRD
FT                   NWVDIAGYAACGAEVDV"
FT   gene            complement(336553..336732)
FT                   /locus_tag="Ccur_02890"
FT   CDS_pept        complement(336553..336732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94016"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM76"
FT                   /protein_id="ACU94016.1"
FT                   /translation="MSEMDDFIYDAIDAAQELAETLQNPATTLDDALVWIDDTAVELKK
FT                   IVVGMKGLEYERGR"
FT   gene            complement(336729..337094)
FT                   /locus_tag="Ccur_02900"
FT   CDS_pept        complement(336729..337094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94017"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM77"
FT                   /protein_id="ACU94017.1"
FT                   /translation="MIRDDYSDGLLDKPDADDGIHCAICGRPATNRHHIVQKGAGGVSD
FT                   EMERRIPKARLCGSGTTGCHGLVHAGKLHIAWDETRGWVWLYTMTPAKDRECWRDYRDD
FT                   YRPMAWAETPRVIGGRK"
FT   gene            complement(337091..337447)
FT                   /locus_tag="Ccur_02910"
FT   CDS_pept        complement(337091..337447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94018"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM78"
FT                   /protein_id="ACU94018.1"
FT                   /translation="MSDVDGFELSAALNDTMNQAYGANRRARVEGRRAAEARADYKAAL
FT                   ASEMARLRADGTPASMAEKLAQGAKRVRDLAVAAEMADVDYQADREEVNLRKREADILR
FT                   EQIQRDYAEARFRA"
FT   gene            complement(337444..338010)
FT                   /locus_tag="Ccur_02920"
FT   CDS_pept        complement(337444..338010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94019"
FT                   /db_xref="GOA:C7MM79"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM79"
FT                   /protein_id="ACU94019.1"
FT                   /translation="MQRAHTVGSVPQRYRDAKLSDARQEVQDFAAAFLRGENPSGLLLT
FT                   GSYGTGKTHDACSVLNRCQPETYRLLVFVNVPDLLDEIRDGYRHYSHSGEKLFDVITGK
FT                   CRLAVLDDLGSESATDWAVERVQSIINARYSKCLPTIVTTNYGAAGLIEHYGKAMEGTS
FT                   ARRMVSRLSEMCQTVVYSGQDRRLA"
FT   gene            complement(337985..338665)
FT                   /locus_tag="Ccur_02930"
FT   CDS_pept        complement(337985..338665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94020"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM80"
FT                   /protein_id="ACU94020.1"
FT                   /translation="MPEKLTMFSSYYEAAKLLPEERQGGFVMAIMAYAFEGAEPLFDDP
FT                   MEQMAWVLISPNIDKSIGLEQAGRKGGRSKVKSTSESTLASTQESHPESTLKSHLLSHP
FT                   ESHKESTSESTLDKPDAKLKEKDKEKDKDRNRSRSGSVSACKATRFHPPTTDEVDHFAR
FT                   GNDLSIDSQRFCDYYTAQGWRLSNGNAMKDWKAAARNWARRDTPSKTNHGKEVMADATS
FT                   AYGW"
FT   gene            complement(338658..338885)
FT                   /locus_tag="Ccur_02940"
FT   CDS_pept        complement(338658..338885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94021"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM81"
FT                   /protein_id="ACU94021.1"
FT                   /translation="MQIQKLRIEAYMKAHGSITSREAMEELGVMRLASRISDMKRDGMR
FT                   INKETVQVFNRYGEKCNVTRYSLAEEVCDA"
FT   gene            complement(338895..339392)
FT                   /locus_tag="Ccur_02950"
FT   CDS_pept        complement(338895..339392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02950"
FT                   /product="single stranded DNA-binding protein"
FT                   /note="PFAM: OB-fold nucleic acid binding domain; TIGRFAM:
FT                   single stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94022"
FT                   /db_xref="GOA:C7MM82"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM82"
FT                   /protein_id="ACU94022.1"
FT                   /translation="MSSINRVFITGNLSRDPELRTTASGSAVLSFGVAVVDSVKNQQTG
FT                   EWEDRPNWVECTLFGSRAQAISGYLHKGSKVAIDGRLHWSQWERNGEKRSKLEVIINDI
FT                   QFLSPREGAQGAPQQPQYQQPAPTYQQPAPTYQQTAQQPPQQPQTAPQYASASVYDEDI
FT                   PF"
FT   gene            complement(339395..340069)
FT                   /locus_tag="Ccur_02960"
FT   CDS_pept        complement(339395..340069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02960"
FT                   /product="phage recombination protein Bet"
FT                   /note="PFAM: RecT family; TIGRFAM: phage recombination
FT                   protein Bet"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94023"
FT                   /db_xref="GOA:C7MM83"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM83"
FT                   /protein_id="ACU94023.1"
FT                   /translation="MPQEIAKVEYTAADGQEVRLTPGVIAKYIVSGNGLASEKDIYSFM
FT                   ARCQARGLNPLAGDAYMTVYQGKDGNTSSSVIVSKDYFVRTATAQDSFDGMEAGVTVLN
FT                   GQGQIQKREGCEFFPSLGEKLLGGWAKVHVKDREHPSKAAVTMDEYDQHRSLWKSKPAT
FT                   MIRKVAIVQALREAYPGQFGGVYDRDEMPPSQEPQQVPVEVYEAPEAYETPDNQNRATE
FT                   EF"
FT   gene            complement(340054..340323)
FT                   /locus_tag="Ccur_02970"
FT   CDS_pept        complement(340054..340323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94024"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM84"
FT                   /protein_id="ACU94024.1"
FT                   /translation="MLREVDKIPRRKAPNSLRQWAREQVEKFAESDMEIARVEGDKSHR
FT                   PEKMKQRSVYQTFYQVAKRYENIGVHTIHGDIYLRKETKKCRKK"
FT   gene            complement(340324..341277)
FT                   /locus_tag="Ccur_02980"
FT   CDS_pept        complement(340324..341277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02980"
FT                   /product="Protein of unknown function (DUF1351)"
FT                   /note="PFAM: Protein of unknown function (DUF1351)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94025"
FT                   /db_xref="InterPro:IPR009785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM85"
FT                   /protein_id="ACU94025.1"
FT                   /translation="MTEKLKAEVVETTAIEKFEVAHGAPAIEFSPAVITADFDAMATAL
FT                   DKLMEPYEGMTLEALVEMPEKELKAVRANVNSIIKNVDGARKAVKKAYSEPLKAFEERV
FT                   NTLLAPAHEKADMLASAVNEKERLRKAAKYEQIEDAYLEYAPALAPVVTFEQLLDPKWL
FT                   NKTPSLPKAIEELYAKVDEIAANWEALKKQLPSMKFAQEAEAEFFRTLDLGAAISLNSA
FT                   REAEQERIEAMRAEVEANRQAQIPEPMPEPEPTTEADYSAVSKAVQHAEEVEPDPAIKY
FT                   RLTIWLTPTEREALKGWLTDTGIGTTDGHKRILEAV"
FT   gene            complement(341289..341576)
FT                   /locus_tag="Ccur_02990"
FT   CDS_pept        complement(341289..341576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94026"
FT                   /db_xref="GOA:C7MM86"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM86"
FT                   /protein_id="ACU94026.1"
FT                   /translation="MQRTTKAARHTQRRAVSGGGRGRQNYVIESEIVEITSICLRKCLL
FT                   PGQSTRLHRILTKNSAQMATNTLKEDLLIALWFGVPTGLLVAWMILDTLA"
FT   gene            complement(341853..342059)
FT                   /locus_tag="Ccur_03000"
FT   CDS_pept        complement(341853..342059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94027"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM87"
FT                   /protein_id="ACU94027.1"
FT                   /translation="MEFEEPQTIRVIAAMTNGSVSQEYIRAACHRAEGYHPLPHIESGE
FT                   KRPVIKIRWSVFCRWFEEEQEQV"
FT   gene            complement(342068..342436)
FT                   /locus_tag="Ccur_03010"
FT   CDS_pept        complement(342068..342436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94028"
FT                   /db_xref="GOA:C7MM88"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM88"
FT                   /protein_id="ACU94028.1"
FT                   /translation="MRLAEKKQPIKAGLVRGRHELPVDTYIFDEIVDVFNFDGMYDKAA
FT                   AFISDEVGVSRVAGRAINAASYTDDEIYRGDSVLVVYVTGLTAALAAVIAACAAYGVPL
FT                   VLMHYDRERGDYRPQTIF"
FT   gene            complement(342448..342669)
FT                   /locus_tag="Ccur_03020"
FT   CDS_pept        complement(342448..342669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94029"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM89"
FT                   /protein_id="ACU94029.1"
FT                   /translation="MNRELTENKTKAAQGMSFDELKDRIRDRCGFDSDTNTGSTCAFIC
FT                   MSLTVDGIGWYWDLESDSFCRAPAFDTK"
FT   gene            342882..343568
FT                   /locus_tag="Ccur_03030"
FT   CDS_pept        342882..343568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03030"
FT                   /product="SOS response transcriptional repressor,
FT                   RecA-mediated autopeptidase"
FT                   /note="PFAM: Peptidase S24-like; Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94030"
FT                   /db_xref="GOA:C7MM90"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM90"
FT                   /protein_id="ACU94030.1"
FT                   /translation="MAQVSRSVFGKNLRAFRESRGITQQQIADVTDTTNVTVNKWENRG
FT                   VQPRRKIVDDLLAYYSLDEDDLLSDVSGLYAQIHGLTSAPAGAIAAKKPRRAYAPLLGR
FT                   VHAGEAVEPDILDSEIPIPYEVWEHHQSGYFLQVEGSCMNRVYPEGCYVFIDPDMTPQD
FT                   GSIAVSSIDETDYIMRRLHMGATTMILSPESFDEQWEDLIITRDSGKTVSFQGVVVWYQ
FT                   PQEEMN"
FT   gene            343586..344125
FT                   /locus_tag="Ccur_03040"
FT   CDS_pept        343586..344125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94031"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM91"
FT                   /protein_id="ACU94031.1"
FT                   /translation="MKKVVLLAVAAALSVLAIASFSGCALSALSSQSKPADVDDGMTTV
FT                   EHDGYSFKCPSDWEWEKYTDDSFVCRFTDEEKSGFIFIQEVTAKYGDPSGAISLDEIYD
FT                   TWLADDSEKTYKGIEEFSVGGYDWVKAIEKRNDKKGQIAIGSVSSSKYLVIDYVYYDQP
FT                   KHKADFDKMLDSIKLI"
FT   gene            344213..344776
FT                   /locus_tag="Ccur_03050"
FT   CDS_pept        344213..344776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94032"
FT                   /db_xref="GOA:C7MM92"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM92"
FT                   /protein_id="ACU94032.1"
FT                   /translation="MAARKVSKRNGGGNDDFGAIDDARSRRVEEDPEDARGERAQHGDD
FT                   AGAQTLSSDGSQSGELAETILSKIEQLPPNDFIGLMLAAQSSEWHGLLPPPDDYNKYPE
FT                   DAKRRMLAWNDAQIVDGAKRNDKLANAEIKQGAREQWLSFILNALFISAAFFAFVITGN
FT                   AASLSFLAVPGVTVAVNIYRRKGK"
FT   gene            344897..345889
FT                   /locus_tag="Ccur_03060"
FT   CDS_pept        344897..345889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03060"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94033"
FT                   /db_xref="GOA:C7MM93"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM93"
FT                   /protein_id="ACU94033.1"
FT                   /translation="MTFKTVKVGTYEKSISDCPVKSLCKGRNLAIESSVKEVLFDLSGT
FT                   DFFSISCTAALAEAIMAYQGRQQVSVSEPPGSVADYLSRMNFYSLARIEHNECFSRHEP
FT                   HDRFIPLCELSYSNDPGKTADLMESMLKKNIADVDGSVTNLANYAFGEIMDNVLQHSET
FT                   AVSGLAAAQYYPKLGYVELVVADAGQGIVASMADNISYSGMSSDELIEKAFEAEAGQYI
FT                   GKTNFSDGKASMGMGLNIASKFTRALKGYLWVVSRDSAAVISSCGFKKIPGLFYPGTVV
FT                   CMKLPLQSSAKILESEIFEGGRNEPLLWSIEEGGFHCKSDIIGDDHVLW"
FT   gene            345982..346290
FT                   /locus_tag="Ccur_03070"
FT   CDS_pept        345982..346290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94034"
FT                   /db_xref="InterPro:IPR025474"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM94"
FT                   /protein_id="ACU94034.1"
FT                   /translation="MIVKMNGFGHSLVSRAAGRVAYNRIVSLPTWGTEKTVFDFSGVGS
FT                   ITNSFADEVFGRMAFEMGMEAMRKKTSFKGINPFMARIVRTTIDARADQSEFLKTTV"
FT   gene            346331..347476
FT                   /locus_tag="Ccur_03080"
FT   CDS_pept        346331..347476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03080"
FT                   /product="site-specific recombinase XerC"
FT                   /note="PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94035"
FT                   /db_xref="GOA:C7MM95"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM95"
FT                   /protein_id="ACU94035.1"
FT                   /translation="MRSFHGGITKLDNGRWQVRVEFPRDRITGKRRQISKTIRGTRRKA
FT                   ERVKADMLAEAGKADVTCDATLREYALEEYLPSKEAECKQSTIDGYRCRLENHVLPYLG
FT                   DIALEDLRTATIRRWLDRLDKSQSVKREAYKILDQVCKHAMYRDMMQSNPCDRIRVPKV
FT                   KRYEPVVLTAEQAIAYLDHFEGSSIEIAVLLALGCGLRRGEIAALNVSDINWETGAVIV
FT                   DDSYVTTSKGTIRSTTKNGRARTVHMPESLLARLHKIAPKSGALLQWDGRRYRPHSITE
FT                   AYERKIQSLPEGLPRIPLKNLRHTSLTLAYDSGARITDVRDRAGHSSEAVTERYYVRPK
FT                   ISRDAEIAQAVDSMLSEHFTKFHKCTEYDYIESDYSNHEIA"
FT   gene            347917..348600
FT                   /locus_tag="Ccur_03090"
FT   CDS_pept        347917..348600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03090"
FT                   /product="cAMP-binding protein"
FT                   /note="PFAM: Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94036"
FT                   /db_xref="GOA:C7MM96"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM96"
FT                   /protein_id="ACU94036.1"
FT                   /translation="MSFTIDQALSQSEIFKGLSKSQWETALGELDAYTKSYKAGDLLIC
FT                   IGDRISKAGIVLRGLARIEFYDEAGSSSIIADVGEGTSFAEAIAAGGIPSVVQVSAVYD
FT                   TDVLWVDVGRLLSADAVSQSPVAATILVNAVRMLSRKNMLLNKKMQMIAQKRLRDRIKL
FT                   YLLMQRSAREEGRVTFSFNRSDLARYFSSDRSALSRELARMSSEGIIALDDRDIILLKS
FT                   DFLDR"
FT   gene            348797..349006
FT                   /locus_tag="Ccur_03100"
FT   CDS_pept        348797..349006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94037"
FT                   /db_xref="GOA:C7MM97"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM97"
FT                   /protein_id="ACU94037.1"
FT                   /translation="MKSYMELVDSSASETEIRRHLVDGQRVSVALRIPDTLRDAAKEEA
FT                   ALRGMSFSAFVRTCMIEELAKKGA"
FT   gene            349012..349845
FT                   /locus_tag="Ccur_03110"
FT   CDS_pept        349012..349845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94038"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM98"
FT                   /protein_id="ACU94038.1"
FT                   /translation="MLNLLTMTVQLIDRESDGIRICRVEGESLVTVVVPRVKLSEAKHL
FT                   PDLPHRGIYYLLDEDHGVLNRVYTGQTTQGLLRLEAHKAKKEFWNKAVMFLDDDYNIDR
FT                   DVLDSLEAMAIEYVRNHGDYETDNTVTPTSRINPYKERRVQELHDSILFRMEALGYDLN
FT                   RTYSGPSVGSATFHTKKLGVKAIGRYDKETGKFIVFAGSQIALDKSIIKNRIAITVRAE
FT                   QFGETTERTTLINDVVFPSPSAAAVFVLGGSQNGWTEWVDDNGNTLSDIYRTEEN"
FT   gene            349849..352419
FT                   /locus_tag="Ccur_03120"
FT   CDS_pept        349849..352419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03120"
FT                   /product="type I restriction system adenine methylase HsdM"
FT                   /note="PFAM: N-6 DNA Methylase; TIGRFAM: type I restriction
FT                   system adenine methylase (hsdM)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94039"
FT                   /db_xref="GOA:C7MM99"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C7MM99"
FT                   /protein_id="ACU94039.1"
FT                   /translation="MNKQQLASKIWESANKMRSTIEASQYKDYILGFIFYKFLSETEVA
FT                   RLKAKDFAESDLPTLTEDDPETVAFVRGECGYFIAYDDLFQTWIAKGKDFEIADVRDAL
FT                   SAFDRNVSPAHKKVFEKIFETLQTGLSKLGTDARSQSKAARDLIQLIKDIPMDGRQDYD
FT                   VLGYIYEYLLEKFATNAGKKAGEFYTPHEVSQLISEIVAWHLQSRRQIEIYDPTSGSGS
FT                   LLINIGKAVARRNGNPDSIKYYAQELKENTYNLTRMNLVMRGILPDNIAVRNGDTLADD
FT                   WPWFDTVENKDETYKPLFVDAVVSNPPYSQDWDPVDKEIDPRFEYGVAPKSKADYAFLL
FT                   HDLYHLRNDGIMCIVLPHGVLFRGGEEGLIRRNLVEHRHIQAIIGLPANIFFGTGIPTI
FT                   IMVLRKQRAAGDDNVLVVDASKYFMKEGKNNKLRASDIKRIVDAVTTNTDVDSFSRSVT
FT                   IDEIRKNDYNLNIPRYVDSSEAPEGWDVFATMFGGVPVTEVDALDEYWTAWPSLKAQLF
FT                   TDNGSSCLTPTASNVAEVIAANTDVKSFITRFNQAIEGFPKAMENSLVVAPESVDTLAE
FT                   EDVLASQIGHMLAEVPLVDGYDAYQALDDAWRDISVDLEIIQSEGFNAVRKVDPNMVVK
FT                   KKRGEDIEVQDGWAGRILPFELVQRQFLADSLAEVSSAEARLSDIGQEISEIIENLDEE
FT                   DKNSTDAINEAGDAFVSADLKKAVKAIGKNPESDFEASLVCAQNLLEEEKILKKQVKAQ
FT                   RIDLHEATKKVLEGLDDSQCRELLKLKWIKPLFEKLSVLPGATVDDFVSKIQALYAKYE
FT                   TTYADVCSQIETAELELSSMLDDLTGNEFDMAGIAELKKLLSGE"
FT   gene            352409..353035
FT                   /locus_tag="Ccur_03130"
FT   CDS_pept        352409..353035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94040"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA0"
FT                   /protein_id="ACU94040.1"
FT                   /translation="MVNSMAAKSKTPEIRFKGFTDPWEQRKLGDVLTERNIQRAQSEDF
FT                   PLVSFTVENGVTPKTERYDREQLVRGDRAAKKYKETRLDDIVYNPANLKFGAIARNTLR
FT                   NAVFSPIYVTFNVDETAAPSFIEKVVTRSRFIQGALRYQQGTVYERMSVSPEELCDLNV
FT                   TLPYLDEQQYIGSYFTNLDHLITLHQRKCDKLKQLKQSLLEKMFV"
FT   gene            353045..354040
FT                   /locus_tag="Ccur_03140"
FT   CDS_pept        353045..354040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03140"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94041"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA1"
FT                   /protein_id="ACU94041.1"
FT                   /translation="MSYQPPFTLNSQILDLVADIAQKVGRVDAYGQINRSLQLRKENRI
FT                   RTIHSSLAIENNTLSLEQVTAVIEGKHVIAPPKDLLEVQNAIKVYENIDSFNPLSVDDL
FT                   LCAHKELMGGLVPEAGRLRSGNVGIFAGERLIHAGTPAKYVSNVLTDLFSWLAAGEFHP
FT                   LVTSCVFHYEFEFIHPFQDGNGRMGRLWQTIILSRWNDIFAWLPVETLVKERQKDYYDA
FT                   LSGSDEQGDSTRFIEFMLGMISQTLDDVLASGNDVGINDGINVGITNAAEAMREQLLLL
FT                   VSGNPSITVKQMAAELGISTRQTERIVSSLKQEGKLVRIGANRNGRWEVR"
FT   gene            354043..354591
FT                   /locus_tag="Ccur_03150"
FT   CDS_pept        354043..354591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94042"
FT                   /db_xref="GOA:C7MMA2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA2"
FT                   /protein_id="ACU94042.1"
FT                   /translation="MSSPWEQRKLGDFASKKTSKNNSLAFSETFTNSAERGVVSQLDYF
FT                   DHDVTNAESIGGYYVVEPDDFVYNPRISVTAPVGPINRNRLGRTGVMSPLYTVFETDES
FT                   VDKCYLEHFFRTRIWHKFMFLEGNSGARSDRFSIGDETFFEMPIACPLFEEQRAIASYL
FT                   ESIDSLITLHQRKLKLLKY"
FT   gene            354632..357865
FT                   /locus_tag="Ccur_03160"
FT   CDS_pept        354632..357865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03160"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="PFAM: Type III restriction enzyme, res subunit; Type
FT                   I restriction enzyme R protein N terminus (HSDR_N);
FT                   TIGRFAM: type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94043"
FT                   /db_xref="GOA:C7MMA3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA3"
FT                   /protein_id="ACU94043.1"
FT                   /translation="MIYENEADFEEAVINVLKQHGWDDADGVIKYPTEADLIRNWAEIL
FT                   YQNNSDRDRLNGFPLTDGEMAQVIEQVEALRSPLALNGFINGKTVAIKRDNPDDAAHYG
FT                   REVSLNIYDRREIAGGKSRYQIAQQPRYPAKNKLLNDRRGDLCLLINGMPLIHIELKRS
FT                   GVSISQACNQIEKYSHEGVFTGIFRLVQLFVAMNPDDAVYFANPGAGNFNSNFYFHWAD
FT                   FNNEPYCANQNPGADDWKRFTSSLLSIPMAHQMIGFYTVADSGDGCLKVLRSYQYYAAS
FT                   SISDHVRACDWGASTPAGTPGRPGGYIWHTTGSGKTMTSFKAAQLVADSRDADKVVFLM
FT                   DRIELGTQSLKEYRAFADDADDVQATENTDVLRHKLVESTDPKDTLIVTSIQKMSNVKV
FT                   GEGGITQAELDRMAKKRIVFILDECHRSTFGTMLQDIRTSFPNALFFGFTGTPIQEENK
FT                   KKGATTSMIFGNCLHRYSIADGIRDGNVLGFDPCMVTTYKDKDVRKAVALEQAKADSVE
FT                   AVMENPKKEEIFYYWMNEAPMGPRVSDAGEYIKGVEDFMKSVQYDEDTPHEYQVINDIV
FT                   EQFPILSHGNKFHAILATSSISEAISYYRRLKECAPQLKCTALFDPSIDNNDGATVKED
FT                   ALVEIIGDYNDTYGKEFAIPTWGSMKKDISSRLAHKEPYLNIDSNRDKRIDILIVVDQM
FT                   LTGFDSKWVNTLYLDKVIDYESIIQAFSRTNRLFGPEKPFGVIRYYRKPHTMSGYIKAA
FT                   VKLYSGDKPLDLFVQKLHQNIKMMDARLLEIKALFQANGVSDLSRLPDSREARAKFAKD
FT                   FVELSHFLESAQVQGFSWDKVEYEFEPGTLDESMRDELRMIDGGYESSGNYMIVKPNID
FT                   ERTYLILAQRYKELFKSKLGPTPDDVPYDIDGHLTEIDTGKIDTDYMNSNFVKWLKALN
FT                   SGDDNLEAASEELHRSFASLPQDEQRLAELFLHDVERGDVKLEDGKTLRDYITAYGRHE
FT                   KDSQFDKVVEALGVDRDLLVEMAGLDLTEENINEYGRFDRLKNSIDKTTAKTYFERVEG
FT                   VSIAPFKVHVKADELLKRFIIEGGFDLND"
FT   gene            357992..358915
FT                   /locus_tag="Ccur_03170"
FT   CDS_pept        357992..358915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03170"
FT                   /product="site-specific recombinase XerD"
FT                   /note="PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94044"
FT                   /db_xref="GOA:C7MMA4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA4"
FT                   /protein_id="ACU94044.1"
FT                   /translation="MEANQDQQLFCEYYTRWVKVYKEGAIRDVTMDKYRLTQSWLDKLV
FT                   PNLRLCDLTRISYQQLINDYAEHHERQTTMDFHHQLKGSILDAVDEGLIPRDPTRKVII
FT                   KGRQPKPKKIKYLNQFELHAMLADLDLGKEATLDWLILLIAKTGLRFSEALGLMPADFD
FT                   FTHQTVSVNKTWDYKRNGGFVPTKNVSSVRKVQLDWQLVMQLAGLLKELPAEKPIFVDG
FT                   KVYNSTANGVLARHCKRAGVPVITIHGLRHTHASLLLFAGVSIASVSRRLGHASMTTTQ
FT                   ETYLHIIRELENQDIDIVMRSLAALS"
FT   gene            complement(358927..359406)
FT                   /locus_tag="Ccur_03180"
FT   CDS_pept        complement(358927..359406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94045"
FT                   /db_xref="GOA:C7MMA5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA5"
FT                   /protein_id="ACU94045.1"
FT                   /translation="MGELFEESDLRSATEEILSVSVANGIYPASESDRDTNPGASINNY
FT                   KVVRIGDIVYNSMRMWQGAVGSSRYNGIVSPAYVVVRPRMKLDSTCFGYLLKRPGMLYK
FT                   YLCDSQGNSKDTQTLKYERFAEIDADIPSTIEEQRSISNYFMRLDDLITLHQRKR"
FT   gene            359855..367057
FT                   /locus_tag="Ccur_03190"
FT   CDS_pept        359855..367057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94046"
FT                   /db_xref="GOA:C7MMA6"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA6"
FT                   /protein_id="ACU94046.1"
FT                   /translation="MDILTKDGLLRRVLAAFFAAVLAVSMVPTPALAAGSADSANRTAE
FT                   AQQQLNSASSQEDSSDDASSSGSNDAEESDSAHSNATESSNADSQESTSDQQSSTKESA
FT                   STSNSGESDSTSSSDATVQNSAAESVTESSTEESSAEVLERSVAEGKELLSAAFSSAPY
FT                   DADNPYTKVEVGKYAPGTYTVTANLFIPASKNPFNKSIQAYMTNPENPLGIVEPDNGDP
FT                   SAVTGGVPIFHVNKNATLIVGEDDSLTLTIPIRNPVFTLQGIGSGQGVELLSAHTRAGQ
FT                   YGPRGASGEILSVGHTSRVDSVTFKLSNSGKTTDGSDGYTIQGCSEYPTILDQNWHVDL
FT                   DLTVDLSNVPASQKYVANPVVSQDLAYTGHEQQGVTFEIDKCEVTSGTAVATNAGDYSV
FT                   TLKPKAGFVWFDGTTDECTFDWTIAKAQVVKKYEVVVPCSEDVSETIAALPSADTVNAN
FT                   FTYEGLAEGDTPESLGISGQTFDSWWMGELEYAQTMPEMFHNLVPTALEGEFSGENVGT
FT                   DNYEVSTKAIAHITLAPGQMPIAHDVVYNGASQLGVEQADGTPFTNVGDGKTRWTPWND
FT                   FTQTWFLNLAARSFIDVGTYSVTLSPSENWAYADGYWSDGTHEPKTLSWEIKPATLTAK
FT                   ARDIYIHEGEVANLKVDVSGFVAQESAGTIAGYEAPVATVENGNTSTLSVGDYPITVSG
FT                   GNAKNYVFEYRSATLHVLPANTAAVPFVESNLTYIGKQQVGVSTGAGYTVEGGTATDAG
FT                   TYTATATLADGVSKWADGSTEKSRTFEWSIAKAELKATYINESVSRKDYESGKDAPAFR
FT                   IKVTGFVHGESPEEGTVANYVAPELYLYKGEVGAADLKASDWKADEDSADYAFIPAGGS
FT                   AKNYEFSSYKWGTLDLIHDAEDNYRAAFPYIETPLTYTGKQQTGVYSRVGSTVITGASG
FT                   VDVGTYKATVALDDERTGWWESNWYGENEKPTGETRIISAQWSIVKAPLAAKAQDVTIT
FT                   AGDAIPSFTAEVSGFKNGEASENAAGYKAPTVSLPAGVSANTLEAGKSYELSVSGGSAD
FT                   NYTFADYESGTLTVLPRGTVAEPTVAQGLTYTGSEQRAIQENEAWTLSGATATAAGDHE
FT                   TTVTLNAGYRWADGSTAPKTYHWSINKASLTATYAGEEITEGETPALKVDVTGFVGGET
FT                   ADTAAGYAAPIASLPEGVSADTLEAGKSYELSVSGGAADNYTFTYAAGTLTVKAADQPQ
FT                   PGKLAPGTYTVTANISMMTPLGFPGYTTNPFNPEGIGGKGGIPDAPVSNNATLIVGADG
FT                   TYTLSLNLVNPVFTVQNAESSDGVTVEAVDRVPIEQKDDDEEYNKSVAADGVTSRIAHM
FT                   TLKLNDVSGSYHFDNWKVYATTLNTFFPNSRYPQINSLDLSVDFDHAQKQVEGDYSKTF
FT                   TDHATGVSVTVSAEKGADTISQLEKASLQVEKVEAGSEHDGAVQALMQLYASTPSFSFY
FT                   KISLIADGEAVSFDDKTAAEVSIPTTQTSADVYSFKKASLSAISSQTSSGVTTCKSSQL
FT                   GSFVVVDSQGAAKFTWSHTVRNASTGASMTYSTDASVEDTLFESAYGPGHGLEALEWYG
FT                   SYMDESGVSSSQAPDSFSEKALAAAKESGSNSLTVAGTYAMGISYSMDGTGVPNNLFDS
FT                   LALGYTFTAGVNPLSAVVPVGNNDASVYAVYGTVGEGATGAKKLDAQIADGYAKVSLND
FT                   SDAQIPGLSSMLFHAAANVGDYTGAPQTAETQIAYLVAVEPSTHKIAKPTAAEGLIYNG
FT                   QEQTGVPEAEGYDVTTSQASNAGTYQSVVTLKDGYLWSDGTKDALTINWSIAKAELNAT
FT                   AADETITQGQTPAYQVNVTGFVNGETADTAAGYTAPVASLPEGVSADTLESGKSYELSV
FT                   SGGAADNYTFTYAAGTLTVKAADQPQPGKLAPGTYTVTANLAMPGQYNPVIKGLTVYAN
FT                   SPDNPFGPTIDENNPAEVHNTVPSNPQSANAKLVVGVDGTKTLILPVKNPIFTTQDLGV
FT                   CGDLSNVHTERITPTAGGGTYSGSYGNKTDRIHMMSAELPAEQSTGTATFNFSGSKLYA
FT                   VPLDLELAPSGSIALQLTVDYNSLSKDSDNTELPSFAKSDTPKPNPDPTPTPDPSPTPN
FT                   PGPTPGPTPNPGPTPVPDPQSDPGDLIETHNGHLAAGTYTVSANIWVNKATSGLPLQPH
FT                   FTSAAFPPMNPVSKNATLRVEEDGHTYVTVPIVIQSRVMQVLSLSGLNIVSQSYSGEGL
FT                   SSITVDLGILSGTDTITKNVTANIRLGTLAKTIIGGAENRTWACTFQVVFNGSPTSSGG
FT                   GTVPKAVQAILDAQGSDGRNANADEDAQNAADAALAALDAEEDLADESAITLAGSQSAK
FT                   GQGKNATEQALDDVNQAIRNNPELVISLVALIVVVIGVVSYTLYRRGKLGGVGK"
FT   gene            367173..367997
FT                   /locus_tag="Ccur_03200"
FT   CDS_pept        367173..367997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94047"
FT                   /db_xref="GOA:C7MMA7"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA7"
FT                   /protein_id="ACU94047.1"
FT                   /translation="MKQGLSIHSWCAAVVILICLGVFCLCPAGAYAAPLAAGTYTVSAN
FT                   IWVDRSDSGLPLNVHLTSNAFPPMDPSQSNAIAYVDEENHTWVRLPITIQPNIMTLRSV
FT                   EGLDLVGEEAAGTTGADDASGAADEDAADNGISSLTIDLGILTSDDAVMRSCTVQVTAG
FT                   SMALSLAGNALDNTPDHTWPATLEMDFTGTAASGGGEVPQVVKDMALGASPTSSSAAAL
FT                   AALDAAEDAGATSHAVSPSRMPIVIGIAGATLVALVAVIVLVVRVHRRSRAA"
FT   gene            368296..369402
FT                   /locus_tag="Ccur_03210"
FT   CDS_pept        368296..369402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94048"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA8"
FT                   /protein_id="ACU94048.1"
FT                   /translation="MQRVFSRRSFVMLSGVAAASAGLALAGCSSQSNQSTDTPSATDFS
FT                   TQSETREPMGSADPTTVRVGLIMGPPSMGLTQFLLAAQSGRTTNDFQFTFNGVDYISLS
FT                   AALNNGDYDIATLPSNIGPILYNNKDLRNQYEVISVNNLGVLYVMTTDESLKTLSDLAG
FT                   RHVYSYGEGGTPEYTIEALMKKTGMADSFQLEFKSSPFEVLNLMQNEKNCVAILPQPFV
FT                   SLSKLMVEPLYTPVDITKEWDKAFADTGSQAVTTTTIVNRAFLEDHEQAVIEYLKMAGK
FT                   SVEWSLSHMEEASALQEELGTFLNNSVALDAMPQISMVNLTGVEMRTALSGFIDELYTA
FT                   NPDSVGGAIPGEDFYYLPPAGTVTSQGA"
FT   gene            369408..370592
FT                   /locus_tag="Ccur_03220"
FT   CDS_pept        369408..370592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03220"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94049"
FT                   /db_xref="GOA:C7MMA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMA9"
FT                   /protein_id="ACU94049.1"
FT                   /translation="MAAAKQKGLFESLRNVVSRTNETTAPRQGASDAGTARMQIPQIAA
FT                   VLGLPEDRVAQMTALVRANGIDEVQMGSMMRMASAKGLSCDQIMAMLTSMGVERVRVVR
FT                   IMQSQGIMDDEEAQRILDEERAAARIHAADDARAARRSKLVKCAVIIFWLIVWQLVDTL
FT                   VDNRLILTGPIRTIQALGDQAVKPDFWIICGASFGRIALGFLLSFTVGILLALLSYRVK
FT                   LVRAFVEPIVSLLRTIPVVTFIIMLLIWVGNQALTIYLSFLIVLPLIYTNMLTGFESVD
FT                   AQMLEMARVYRLSRWRTFMYVYRPAFMPFLSSSCKISLGMSWKSGIMAEVLATPKPSIG
FT                   KEMSQARTYLDTPSLFAWTVVVMILSWLFEKVFMALLDRAARPMGHFLGKGDDR"
FT   gene            370589..371644
FT                   /locus_tag="Ccur_03230"
FT   CDS_pept        370589..371644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03230"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94050"
FT                   /db_xref="GOA:C7MMB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB0"
FT                   /protein_id="ACU94050.1"
FT                   /translation="MSASSDIRITGLNKSYGDLSVLRQVHVHLEQGGIYCLMGPSGTGK
FT                   TTLLRVLLGLERADAGSIEGLSPGEASVMFQEDRLCETLSPVDNVALVMPPRTSRRALR
FT                   EMLEEILPADCMNRPALQLSGGMRRRVSLARAVAYPSKLIVLDEPFTGLDVETKKTVVQ
FT                   FLLAHRANRTLLVSTHGEDDVRLLGGKKILLSAISASDRGDYTADEYHRDTYQQEPCDR
FT                   DTSKDERGTSTNDHDVSKDERDASKNGQGTSKDNQNTGTNDQDSRKDESGIRKNERKEQ
FT                   TMIDTTIPMRELVAAEPLFADFLVSKGFPFSVENPVTEFVTFDEVVQLRDLDKDAFLAE
FT                   YAQFKAERENA"
FT   gene            371692..376194
FT                   /locus_tag="Ccur_03240"
FT   CDS_pept        371692..376194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03240"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /note="PFAM: CoA enzyme activase uncharacterised domain
FT                   (DUF2229); BadF/BadG/BcrA/BcrD ATPase family; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94051"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB1"
FT                   /protein_id="ACU94051.1"
FT                   /translation="MFTVGIDIGASSVKVVALQVGGSSRLAAQQKTAEEATEGFGKTEE
FT                   DVASGFNKTAESVAGELGKTAEEVGGELSKNGESFPFPLLWAQRRVHKGSASACLLDLL
FT                   SAFADDLPIDECVGWVLTGSGADAFVGHGVAIPFLEEVPALTLGVRMLHPKAASVIAMG
FT                   GQRAAYVTDLIGDKPPRFGTNESCAAGTGSFFEDQMSRLNLSIEDYSSHAQRATSVPRL
FT                   SGRCAVFAKTDIIHRQQEGVAVDDILLGLCFAAVKSFKASIVRGMPVEKPVVLAGGVLL
FT                   NAGVVRAVREVFDLDARELLCGQENLYLQAVGAALHAARLVGFSVESNPLGASTDTNTS
FT                   SFQLGAATSSLPDIDVLFTLLSDCSAYDTLARRDPLPDTGFKPTAGYQLRSRPWPVDRD
FT                   GRTPCALGIDVGSTSTDLVLLDAEGGILDAQYLRTAGNPKQAVRDGLNSLASRLGNTVR
FT                   VDAVGVTGSGRTMIGEFVGADAVRDEITAQARAAVAADPSVDTVFEIGGQDSKLIVIDN
FT                   GQVVDFQMNKICAAGTGSFVEEQAARLDIPLAEYGDLALSSKSPVELGDRCTVFVETAI
FT                   ATALSQGAAKADIAAGLCQSIVSNYLNRVVSTKRVGKRIALAGGVAYNKGIVAAFKQRY
FT                   GENLFVTPWYAVSGAVGAALLAYEAQGQAVGHVMGQAVGQAQNQAQKVAKRPETNFRGF
FT                   DLTGTTKQSRHVDLAEVERNRAFFGKSQEFYLEGYNPTIDPNKKTVGVPRALLLYKFFP
FT                   LANAFFRTLGYNVILSDVSDEETVRLSQQTARGETCYPVKLIHGHMAQLADAGIDYLFM
FT                   PRVHTVKHGAVKVEHNYGCPYMQVAPLLVARDLGLEERGIQLIAPELDLDLGQQAMASA
FT                   MMGVGVQLGHDPHETAKALLAGGFAVNEFSRKVEELGSQLIDSLEPNERVLVIVTRNYG
FT                   IEDAVLNMGIPDLLLDRGQKVITVSHLEGGHDCDISRDYPCVCWPFGQHLLTAMKIIRR
FT                   DPRLFAVYLTNHGCGPDTMLTHLMAEEMKGKPYLQIEVDEHFSKVGVITRIEAFLNSLD
FT                   HYQAQEADRTLPFSPKQVTAQVEPLDPRKVIGLPSFGPAGPLLGRWFENQGYQVSLLEP
FT                   SPAAIARGRQEMTTKEYLSFTALVGVGLRAAEQYAAEQHADGVHSDGEQVLDKHSVKLQ
FT                   VDKQEAAGSNRAEQEVADKHAIKQAALPTSSTGFHLLIPSTEGAEADNLYERVLISKLA
FT                   AYGLADTEIISPKLEQLPARLGARLESFFAVLVANDVILATPPDKRADIQAALLEDCSF
FT                   EAVLSQAQRVSYARAGQADKPSVLVVGEWPCVLSDHLSGGMWRKLEGEGYTLRRMPIAE
FT                   FFWFMWRDVLEGVARDDARWAALDRLANLMRQISCALGSASPFCDDVESLCAEADKLMG
FT                   RFRGANGRYRAAKACMPPASVQGVLATSSLYENTDIILKLFSDSWELPVPILHVNFDAA
FT                   LDQGIEERIRSFLYYLQPTVPATSEQPANESLVSEVSCG"
FT   gene            376264..376965
FT                   /locus_tag="Ccur_03250"
FT   CDS_pept        376264..376965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03250"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94052"
FT                   /db_xref="GOA:C7MMB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB2"
FT                   /protein_id="ACU94052.1"
FT                   /translation="MIHIEVEDLHKSYGEGEARVEVLRGVNLQVERGSMNAILGPSGSG
FT                   KSTLLNAIGGLESVDKGSIRVEKHDITTLGPKELSAYRRATVGFVFQFYNLIPNLTISE
FT                   NIRVCQYLSSDPLDTAELLSTLGLADHANKFPSELSGGQQQRCALARALVKNPSVLLCD
FT                   EPTGALDTHTAREILMLLELVNKRFGTTMLIVTHSEGICAMVDQIVTIKDGLIERAEAN
FT                   AHKIPAGDIQL"
FT   gene            376975..379860
FT                   /locus_tag="Ccur_03260"
FT   CDS_pept        376975..379860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03260"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Predicted permease; TIGRFAM: X-X-X-Leu-X-X-Gly
FT                   heptad repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94053"
FT                   /db_xref="GOA:C7MMB3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB3"
FT                   /protein_id="ACU94053.1"
FT                   /translation="MQRLLFISSLRSVKSNALRYGALMLTVALSMLLVIGTLASALDVI
FT                   NSVESSNAAHHQEDGEFGTFVPLTDSEVAKLEDRGLTIEAQPYLDFSQEDGSTLRVMAN
FT                   REQINQVVVHEGALAASENEIAIETLYAKAKGLAVGDSVQVSGKTCTVSGIVSSPDYDF
FT                   CVPNLSSTVADAREFGTAFTTADTYNDLRADGQAIRSEAYRYAFLLPSDLTAADVKKQL
FT                   EEFDVDPAAVDDVYFHELVDRTLQDRTDIEQGIDELAQGSASLSAGTSSLREALDNFDE
FT                   ALSPLSSSSARLAQGLDQLSASSDSLEAGSAEVSRALQQLDAGATQLAQGASALSQMPG
FT                   LSSEAVASLEGAARLQSGIETLRQRYQEMDSGLAAYGSGVDAAATGSHQLAQGASQIQD
FT                   SASDLAHAAADLEEAAGDFDVGVQELKERVNTLLDKQFPLDIDNLTEFTSAADNSRIAA
FT                   SSDDLKININSGLFIGVVALLMIAYVISVFVLHTVDRDSAIIGSLYALGVRRGSLALCY
FT                   TAPAVLSCFVGGILGTIGGLSAPWMDMMLSDTLAYYSPPPIVYTVDAWVIAYGVVMPTV
FT                   LAFIVNMIVISRALNRPALSLLRHETHTGRAARITLKDRNFMRTFCVRQLLREWRSASA
FT                   VIIGLFVCLAILCMGVTCYVLCTSLQTNIAADTKYEYLYEYKYPTEEVPAGGVEAYGES
FT                   LNRSILGYDLRIEVYGLTDNNPFFPSIKARGQSEVSISSALASKAGLHEGDEVILYDRI
FT                   GGKAYGFTIAEVVPYSPSLACFMPIDDMRKLFNQEDDYYNIVFADHALDIDAGRLYETV
FT                   TRADVVERSSIFVDLMGSLIVSLAGSALLILIVVMYQMMAVMIDRSAQSISLMKVFGYR
FT                   NREIRKLFLDANFIVVAVGTAFVLPLAKWVIDLMYPYFVSNVSCQIDLVWSWQMYVAVY
FT                   AIVIGCYFVTRILLMSKVSKTSLHEVLQRRE"
FT   gene            complement(379969..380886)
FT                   /locus_tag="Ccur_03270"
FT   CDS_pept        complement(379969..380886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03270"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix protein,
FT                   lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94054"
FT                   /db_xref="GOA:C7MMB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB4"
FT                   /protein_id="ACU94054.1"
FT                   /translation="MNPKYEAFVKAVETGSFKQSAADLGYTQAGISYLINALEKDMGTA
FT                   LLIRSHAGVRPTPDGEALLPWIQEVCNSERALQTRLDEVRHIEGGTIRIASFTSVAVHW
FT                   LPGIISRFLDDHPQVEFESVCYEEQEAQELACWRGDFDCAFVVTPTKLDFHTISLAQDP
FT                   LAIVVATDHPLAQGGVFPAWALGSEPYIKVRNDTHTEMDTLFENHGVEPNVRFEVDNDY
FT                   AVMGMVAQGLGFGVFSQLILRDTPFDLVALKPEIPLERQLGIAVRSLDKASIATKAFIE
FT                   CTRSWVAENEKNSDGTVPSGSDIL"
FT   gene            381162..382091
FT                   /locus_tag="Ccur_03280"
FT   CDS_pept        381162..382091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03280"
FT                   /product="predicted permease, DMT superfamily"
FT                   /note="PFAM: Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94055"
FT                   /db_xref="GOA:C7MMB5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB5"
FT                   /protein_id="ACU94055.1"
FT                   /translation="MQSKQGIVIMLVLIQAAIYGLGNVLMKIAYLGISPMWCAVLRFGL
FT                   AFVLFMLFFGRRVISTFKGKRLRTWLPSCLLMAASFLLCGLAVNLTSATNAGFFMALPM
FT                   LFTPVLSLVVLRRAYTLQTVLLQGVVIAGLYLLCCNGGALSFGPGEFCGLASSACFAAS
FT                   IVMAEHGLGEVDAIAMSVAQIGVTFVTATGAAIVFEVPPVLDAVPLESWVAIAFLAVIG
FT                   TCVAFFLQNFALSRIPSATVSVLLCAEPVFTAAISAVALGEVLTSVGIVGAALIVACTM
FT                   AASLEDTQITLPHRIVHEHVQRLSSVRR"
FT   gene            complement(382238..382453)
FT                   /locus_tag="Ccur_03290"
FT   CDS_pept        complement(382238..382453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94056"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB6"
FT                   /protein_id="ACU94056.1"
FT                   /translation="MTAEELERNFFLVEDATGSCTARFASDLPDSLADATEMPAAVVAC
FT                   DLAMSVDVRERRSGLDYLEGLLDEMR"
FT   gene            complement(382697..384652)
FT                   /locus_tag="Ccur_03300"
FT   CDS_pept        complement(382697..384652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03300"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94057"
FT                   /db_xref="GOA:C7MMB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB7"
FT                   /protein_id="ACU94057.1"
FT                   /translation="MIGRVFNNRYQLTERIGIGGMAEVYRAQDRVLGRLVAVKVMLPQY
FT                   ASDPEFTQRFRQEAAAAANLQSPYIVNVYDWGQDEGIHYMVMEYVRGSDLKTAITQRGA
FT                   INQRKVAEIGAQVCKALSVAHNQDIIHRDIKPQNIMVQPDGNVKVMDFGIARAKNSMKQ
FT                   QTSAVLGTAHYISPEQAQGKELTPASDIYSLGVVLYEAATGKLPFDGPDSVSVAMKQVS
FT                   DAPVPPREVNPDLDPNLEAIILRALEKDPAARFATVNDMKHALNDYLAGRPVSLDDDAT
FT                   HVMSNGTFVPPISNAAGATSVMQPLASEGSPVSGAPSVMRAVDEEEQAKHKKRRNAVIV
FT                   AIIAAVALLVAAIAFALSGMNGSSMVPDVTGQTAQQAEATLKSAGYTIGTTTEVYDDST
FT                   DEGRVVSTDPPAGTTVEKGSAINLNISKGKGQVEVPDLNGMNADQAKQALTKAGLTASQ
FT                   GTAVASDEVAKDKVATQDPAAGTKVEKGSTVTFSLSSGPESVSVPDITGMSEKEAQAAL
FT                   SNVGLTGSLSDRKASDKVAEGDIISQSPSAGKKVSKGSKVSYVISTGPSVVTVAVPNLT
FT                   GMTKDGAKSALTEKGLVLGDVTEKSSDKPKGTVIEQSTDSGTKVEKGSKVNIVISSGQG
FT                   VLNSLVNPSSSTTTTS"
FT   gene            complement(384729..387494)
FT                   /locus_tag="Ccur_03310"
FT   CDS_pept        complement(384729..387494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03310"
FT                   /product="bacterial cell division membrane protein"
FT                   /note="PFAM: Cell cycle protein; Penicillin binding protein
FT                   transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94058"
FT                   /db_xref="GOA:C7MMB8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB8"
FT                   /protein_id="ACU94058.1"
FT                   /translation="MTRRNTELLLLLVAAPLVILLYAMIVMHNGGQVGVDTLGVPLAIF
FT                   ATFALAHFAVRIWAPGADPALLPLSFALSGIGIAFITRLAPEMAVRQVIWLIGSIVCMI
FT                   LVVALVKRIDRAAEYKYTLMVFGIILLLSPLLPGIGKEISGSRIWLGLGPFSFQPGEIA
FT                   KLMIVLFLAGYLAANREMLSVFTWRVGPLHIPDLRTLLPMLLMWGLSLLVVVFEKDLGS
FT                   ALVVFFVFLAMLYVATGKKSYVVGGILLAFVGALAAWKLFTHVQIRVETWLDPFADAGG
FT                   KGYQLTQAIYSMADGGIFGVGIGNGLCDKIPVVESDYIFAAIAEESGLLGAAGLLLLYV
FT                   CFAIRGMVTAARAKSDVSSFLATGLTCAIVLQAFIIVGGVTRLIPLTGLTLPFVSQGGS
FT                   SLLASFIAVGMLLKCGDEGTGIEAEMRGATTQIHANSVLGRVALGKRLTHLALFIAVLF
FT                   AVLVANLTLLMVVNASYYQNLPGNNHTIQKQATRERGTISTSDGTVLAQSVPNGDGTYT
FT                   RTYPAGTLAAQVVGYSSTQYGTSGIEATANDQLTGESSFATWTDVINAYAGISRSGNDV
FT                   KLTINSKIQKAAQDALEGYSGACVVMDPETGKVLAMASSPTYDAANFESLLAGSTGPGS
FT                   SSDALYNRATQALYAPGSTFKMVTLATALQNNIATEKTSYKSPGTMDIGNAPITNFDGY
FT                   SYGTISLARATELSSNTVFGQLGVQIGPDLLVKSSEAYGFNQNVPFDLPLTQSLMPNPS
FT                   EMTTWETAWAACGQPVGEHKSPAGPQANVLQMALVGCGIANDGSIMKPYLIDSVYNADG
FT                   EKASSTTPSVFANVMSAQTAQRERAVLKGVVDEGTGTAAGINGVSIAGKTGTAQTGKAH
FT                   DDSWFVGMGPTDDSKVVVAIVLEQASDSSTNAAARAKNVLRTALQEQGAL"
FT   gene            complement(387491..388849)
FT                   /locus_tag="Ccur_03320"
FT   CDS_pept        complement(387491..388849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03320"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94059"
FT                   /db_xref="GOA:C7MMB9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMB9"
FT                   /protein_id="ACU94059.1"
FT                   /translation="MSGRPSARSRRAFTALFGSRTDIGCVREHNEDSLVVAPPLFAVAD
FT                   GMGGHAAGEVASEIAVRSLAHDAPHEADTEALGTAVVTANHAVIEAARQKGRSGMGTTL
FT                   TAAVLDGERLALAQVGDSRAYLLHNGRLQQLTRDHSLMADMIEAGELTAEEARVHPQRS
FT                   VITRALGSDPGMQPDLYEINVAAHDRLLLCSDGLTTMLEDKQIERILNRTHDPQRCASI
FT                   LVNEAIGAGGYDNVTVVVVDIEGNASARVRKARQRGRLWGVFIVAALIATILGVCFGVY
FT                   SYAQGTAYLTAQDGKVAVYAGAPGTVLGHELSHLDHVTDISVDDLQPGVAARLKDGVIR
FT                   TDSLDAANKLVDEYQSDIASSSKFSTSSSNTQSETEAEKEALSEREVLSSAAQNATNGS
FT                   TAADSDASPSSAEASTEVSTSASATSVSFTGSSPNNSQASHAHSTQQQGGAAL"
FT   gene            complement(388849..389265)
FT                   /locus_tag="Ccur_03330"
FT   CDS_pept        complement(388849..389265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03330"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94060"
FT                   /db_xref="GOA:C7MMC0"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC0"
FT                   /protein_id="ACU94060.1"
FT                   /translation="MAIDVTLLIARLLFVALLYLFLFAIMKTGIGLVRGQRRREKSWTI
FT                   AVEKGPKELRGVQIAVHGPVIVGRNPGADIVIGASYVSGRHARFTLMGQNLFIEDLGST
FT                   NGTYVNGQRIREAIALRNKDVVTIGDVAIRVRFV"
FT   gene            complement(389308..390534)
FT                   /locus_tag="Ccur_03340"
FT   CDS_pept        complement(389308..390534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03340"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94061"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC1"
FT                   /protein_id="ACU94061.1"
FT                   /translation="MGIFSRLERGMENGLEGAADRMFDAPISPVQISKKAERAMKREKM
FT                   VGAGRQYAPTLYTILVNPDDDQRLFGYYPTLAGETETYLAAKAAESGLSMDGTPLVRFI
FT                   VDEELKHGKFDVIAEMVSAPIVAQLRQEEMARYGLAPQPVPQQRAQNNRGSVASAYAPA
FT                   AAYPSTAGAVRPQSYPQTYPQTHAQNAHAMASNSTAAPATPAASATPVTIPNAAGMASA
FT                   GMAEQNATPEATPVSTQASQAPQAKPPLPYVPEEEIDRSIDYGEYTFNSQDFESYEQSA
FT                   QAIPPVEQPTAQPSTPPAGGSFAAGVSAPAAAITVARLIDNATLRAWTLHSSRMIVGRS
FT                   SASDIVIDDINASRSHAELRCDTQGQWLITDLGSTNGTFVNGQRITTRPLMEGDRIAIG
FT                   TTDLMFSLH"
FT   gene            complement(390868..392976)
FT                   /locus_tag="Ccur_03350"
FT   CDS_pept        complement(390868..392976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03350"
FT                   /product="predicted ABC-type transport system involved in
FT                   lysophospholipase L1 biosynthesis, permease component"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94062"
FT                   /db_xref="GOA:C7MMC2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC2"
FT                   /protein_id="ACU94062.1"
FT                   /translation="MYAKLAFGNVRKSLRDFGIYFITLVFGVCIFYAFNSLEGQSGLLE
FT                   ITESQEEIMKLLGIVITGVSVFIAVVLGFLMVYANQFLIRRRKREFGIYQVLGMDRSKV
FT                   TRIIVFETFIVGLAALVVGLAVGVLLSQVLLYVTASLFSAPVKGFQLSFSGAACLLTII
FT                   CFGIIFLITLIFNIVSVSRYKLITLLNANRTNQAVKVRSLPLCVVLFIVALTLIGAAYW
FT                   ILVRSGFSQITMPEFAASTALVIVGTFLFFFSLSGFLLQAVKRNQRIYFSGLNMFTLRQ
FT                   LNSKVNSAFFSISIVCLTLFLAITSTCTGFAMTSAINGNLAKANPYDASLSTFFSSFLG
FT                   RDGTDPQPDYYAAEADDVNMETALKSRIPNWDNLVADSAQLNQYRTEVTLGTLAQNAGV
FT                   TLPDYLSNLSDYPLPVIGQSQFNQTMALQGHEGVDLQGSEYLLWSNVEKMQSFFTPVID
FT                   AAPSIEVNGTNLSLTTQQDSLCTAAETNSPLPSLYAALVVPDDVLPGQESLYLITLNVR
FT                   YTAQTDQVEADFKAAIQQAHSAVAAEEGLEDSQVYWPFLILITAQDNADQILGLNAVIS
FT                   YLAIYIGFVLLIACAAILALQQLSEAADNQERYAVLQRLGCEKTMAQRALLAQMGVYFL
FT                   FPLVLGICHSVVAVSALVDVIGTLGHLDIIKPLIGTATFALVIYGGYFLVTYLMARNIV
FT                   LSRKANRS"
FT   gene            complement(392966..393733)
FT                   /locus_tag="Ccur_03360"
FT   CDS_pept        complement(392966..393733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03360"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94063"
FT                   /db_xref="GOA:C7MMC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC3"
FT                   /protein_id="ACU94063.1"
FT                   /translation="MNHVLECRGIEKYYGNREAVTRALDGISFTVEAGEFIGIMGPSGS
FT                   GKTTLLNCIATIDRVTAGNILVNGQDSTVLNARQVARFRREKLGFIFQDASLLDTLTAR
FT                   ENIALALTIARVPAAQIGPRVEAVAMRLSIADILDKFPYQISGGQKQRVAAARAIVSNP
FT                   ALVLADEPTGALDSKNARMMLESLEMLNTDLSTTILMVTHDSLAASYTHRVLFIKDGKL
FT                   FNQIVRGNDTRKQFFDKIMDVVTFLGGDGADVR"
FT   gene            complement(393954..394997)
FT                   /locus_tag="Ccur_03370"
FT   CDS_pept        complement(393954..394997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03370"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94064"
FT                   /db_xref="GOA:C7MMC4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC4"
FT                   /protein_id="ACU94064.1"
FT                   /translation="MTFFAYLRDHFACIVILGVALVFDALMLSALGIASTVIIVSVVVV
FT                   LFALFIALGINWIRKRTFYRDLTAVVNNFDKSYLIAEVVEEPTFAEGRIMHEALRVAGK
FT                   AMNDRIASYRQQSEDYRDFIELWIHEVKTPLSAAHVIAANTPSESTEAMDAEINRIENY
FT                   VEQALFYARSTALEQDYVIRPLCLNDVVHQAVKRNSRALIAAGIALQLEGLDTTVYSDT
FT                   KWLVFIIGQILANCAKYAKPSGGIVRISAGRDSERLDAFYTVLSIQDTGIGIPAADVPR
FT                   VFDKGFTGANGRHHAKSTGIGLYLCRELCQQMGLALSLTSKEGQGTCINISFPEETMHF
FT                   RSKSEHD"
FT   gene            complement(395015..395830)
FT                   /locus_tag="Ccur_03380"
FT   CDS_pept        complement(395015..395830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03380"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94065"
FT                   /db_xref="GOA:C7MMC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC5"
FT                   /protein_id="ACU94065.1"
FT                   /translation="MEQKENNIYIVEDDRTMRENLRTLLEHNGYIVQVLEDFSAPVESI
FT                   LAASANLILLDLNLPHADGRFICREIRRESNIPIIVVTGDDSDLDELICLNFGADDFIA
FT                   KPYNPQVLLAHVASVLKRTASSVATPAHHTVGGVSLDAECCRVSFAGKQADLTKNELRI
FT                   LSLLMRNAGKIVPRERIQEELWNSDEFIDDNTLTVNVSHLRHTLSTIGADDFIRTKRGI
FT                   GYSFEVAPSESSKSSYSTELSQLSHADETGCQAMDYKSPQSGCSHLDAS"
FT   gene            complement(395940..397103)
FT                   /locus_tag="Ccur_03390"
FT   CDS_pept        complement(395940..397103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03390"
FT                   /product="phosphoglycerate dehydrogenase-like
FT                   oxidoreductase"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94066"
FT                   /db_xref="GOA:C7MMC6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC6"
FT                   /protein_id="ACU94066.1"
FT                   /translation="MHRMYCLNTIAEKGFSLLPDTYELVQSINDAEALLIQDALLDTTP
FT                   LPNGLLAIGCAGAKIAPALLDECTKRGIAVFDTPRANANAVKELALCAMLLSSRNILEG
FT                   AAWCREHAQSPTLTQDANAVKDCFMGHEIAGRNVGVIGLGAVGGQLVRSAVALGMNVYG
FT                   YDPYVARTSADAQAGIHRVTDLEELCAVCDYLVVRVPASTATQSLIGEAEIAAMKPGAT
FT                   LINLSACEVIDTAALADALEAQHIKCYFTDFPTQEALALPHTIVLPHLGDSTVEAQESC
FT                   ACAAVREVVSYIDEGSIENSLNFPAVQAPVLPEGAGRIALLHTNRPNMVGQITAALAEA
FT                   GANISHLMNASRNEAAYTLIDTDESVGKVPLDQLRAIEGVWRLRTIR"
FT   gene            397523..398398
FT                   /locus_tag="Ccur_03400"
FT   CDS_pept        397523..398398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94067"
FT                   /db_xref="GOA:C7MMC7"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC7"
FT                   /protein_id="ACU94067.1"
FT                   /translation="MFTFLPAFIPTIVQIFPFVLAFALLAAKSLHKHPVAFYIPIAIVV
FT                   LIVSIPAFISGMMGDACPEVITQLARTLHHLDRSFPVLYPFVQLLTSIDTGISMYLIVM
FT                   FIGALRKTASVRRLYSVRSELSILAGIIAAGHVLRVIDHAFFLFNPEWAERMQGPALIV
FT                   MGGTLTFVGLALLVFFLIPWITSFPALRKRMSAAMWKKTQLLAYPFMFFMVLMGMGLNA
FT                   GYALRSYPYTSEKFTQTMASDPISFLSSFAGDVASATVFFVVGVLYLGLRLNKHREDKE
FT                   ARLKAAKTAK"
FT   gene            complement(398508..398594)
FT                   /locus_tag="Ccur_03410"
FT   tRNA            complement(398508..398594)
FT                   /locus_tag="Ccur_03410"
FT                   /product="tRNA-Leu"
FT   gene            398836..400599
FT                   /locus_tag="Ccur_03420"
FT   CDS_pept        398836..400599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03420"
FT                   /product="protein kinase family protein"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94068"
FT                   /db_xref="GOA:C7MMC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC8"
FT                   /protein_id="ACU94068.1"
FT                   /translation="MADELILGRYRPIGEAGRGGFGTVVVAWDTRIKRRVAVKTMPVDT
FT                   SSGEMAEIPGLEEARTAAMLSDACIVGVLDFEVQDDTAYLIMEYVEGITLARLLSECDN
FT                   LVTADMVATVLADVSHALEVAHDNAVLHLDVKPDNILIDHRGRIKVTDFGLAELSSAVG
FT                   FSDASGGTIGYMPLEQMARESLDERCDEWALASVIYEMIAGENPFLAHDLAGARKAIDK
FT                   AEMVLPSLCLEGVGEEADNALFQALDPDKDERFEDVRVFAENLQHGLGDVRVGREELAA
FT                   AVLQVMDDTGEASVVSQKLVQRARSIDLEMDQFLLRIIGAVSCGIMVWIAVPQIAWIPA
FT                   GSTPWEALAAFAVGILAALLPPAGMPVVLALLATAFASQGVYVATVALVGLGGFWFWRV
FT                   GRFGLTEAAAIPCSVLAALAGIPAAVPIISGYLLNVRDAVLSTICAWLVLFLLGSYSFP
FT                   SAVYWVLRPVFAVASDPIAVLVMGLARPTTWIVLVAWVAASALIAVLCRRRKRVRAVLG
FT                   MAASALVLCAACAISVALEQAGAVWTPDAIEIARIVIPIAGGMALAAWKVPPRAEYVDP
FT                   DEVWDPEVEEA"
FT   gene            complement(400734..401597)
FT                   /locus_tag="Ccur_03430"
FT   CDS_pept        complement(400734..401597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03430"
FT                   /product="pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94069"
FT                   /db_xref="GOA:C7MMC9"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMC9"
FT                   /protein_id="ACU94069.1"
FT                   /translation="MTTALYHREGAYIPRIAAIHDLCGYGKCSLGVAIPVLSAAGCDVC
FT                   PVPTGLFSSHTAFPGWYMHDTTAILADYLDAWKGIGVDIDAVYSGFLGAPEQVDIIRSV
FT                   YETYPNALRVVDPVMADHGKVYPTYTPELCEAMAGLAADADILTPNLTEASIILGIEWP
FT                   GADVDEATARRMIDGLREKGARNVVLKGIDRNDGIIRNYVEGDSVEFFVTENELLPYML
FT                   HGTGDLFASSLLAAVMTGRDLSHATRFASDFVVSAMKITAHQPDFQNRGVSFEPLLGDI
FT                   ASLLKK"
FT   gene            complement(401786..402007)
FT                   /locus_tag="Ccur_03440"
FT   CDS_pept        complement(401786..402007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94070"
FT                   /db_xref="GOA:C7MMD0"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD0"
FT                   /protein_id="ACU94070.1"
FT                   /translation="MDFGELYHFLFETYAGIGVLFATVIVICLIACVIMERRTRRVYQN
FT                   HEKSEDDWSFFDDDDEEDTEENARTNKK"
FT   gene            402128..403411
FT                   /locus_tag="Ccur_03450"
FT   CDS_pept        402128..403411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03450"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: Seryl-tRNA synthetase N-terminal domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94071"
FT                   /db_xref="GOA:C7MMD1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD1"
FT                   /protein_id="ACU94071.1"
FT                   /translation="MLDARFVRENQEAVAEAMANRNFPWDPARFSELDEARRAAIVEEE
FT                   ALQAERNRASKEIGSLMAAGDKEHAEEAKAAVRAVNEKLETATVQREKIDEALHTLLMG
FT                   VPNIPHETTPVGKDETENPEVRRWGVPRQFNFDFKPHWDLGSELDIIDPDRAVKLSGSR
FT                   FMLLGGLGARLERALINFMADTHTSRGFKEWWCPALVNRETMTGTGQLPKFEEDLFKTK
FT                   DESLYLIPTAEVTLTNIHAGEVLDAAELPLRYTAFTPCFREEAGSAGRDTRGLIRLHQF
FT                   DKVEMVKFAKPEEAYDELESMTAEAEYILQKLELPYRVISLCTGDLGFSAAKTYDLEVW
FT                   LPSYDAYKEISSCSCCGDFQARRADIKYRDAESFKGTRYVYTLNGSGLAVGRTMAAILE
FT                   NYQNEDGSVTVPDALVPYMGGVKVIDHA"
FT   gene            403404..404234
FT                   /locus_tag="Ccur_03460"
FT   CDS_pept        403404..404234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94072"
FT                   /db_xref="GOA:C7MMD2"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD2"
FT                   /protein_id="ACU94072.1"
FT                   /translation="MPDAHSARTSSHTSGMRTSASASRKTKAKITASAKTKANARATSK
FT                   IGAKTGAGVASKSSTRANAGTKTVRQSSPVQSTRNRRSGLSVIKRIILVVVAVVFVLVC
FT                   AVVWNLWFRFDDAADIQGSWTSSDGASVSIDGHDLHLSDDVAYAYSLNTTAKTIDYTFA
FT                   SASGHASYRFSADRATLVLDERGGTDWLVLLGLKVDPALSGGSTSGVTVLMRQTTPSIT
FT                   EATENLASVDTTESTEAAAATESTGTPDSSTGTSIHGTSIDYSGKAGSSTAKNR"
FT   gene            404248..404652
FT                   /locus_tag="Ccur_03470"
FT   CDS_pept        404248..404652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94073"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD3"
FT                   /protein_id="ACU94073.1"
FT                   /translation="MSAGLAIDCITVKRDRIVCGVRCLDMQRCYTNPAMAARALAARPH
FT                   LAEHACVNEQGETFGAVIARTPLPHLLEHVAIDILTEIDPRDYQIYTGVTEWIAGQAGR
FT                   ARVQLVLTDDLIVLSAVREALRFINEEVVR"
FT   gene            404655..405905
FT                   /locus_tag="Ccur_03480"
FT   CDS_pept        404655..405905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03480"
FT                   /product="transcriptional regulator with HTH domain protein
FT                   and aminotransferase domain protein"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94074"
FT                   /db_xref="GOA:C7MMD4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD4"
FT                   /protein_id="ACU94074.1"
FT                   /translation="MSSAHLTFDSTSDKIATRVRKMRSSAVRDLFAAATRDDIISLAGG
FT                   MPDVRLLPEEAVCKAAEAACGAARSEALQYGGTNGREATRRVFCGLMRDIGVRCRPDEV
FT                   LITTGAQEALDLIAKTFIDPGDIIITEGPTYLGALQAFSAYEPDIHCIPFDEEGMRMDL
FT                   LEEELERLGVGAVKFLYTIPNFQNPGGVTMSSARRTRLIELADRYDVMVVEDDPYGRLR
FT                   YNGGHMIPLKVLSSDVIYLGTISKVFAPGLRTGWIAAPKDVLARINLVKQGTDLCGSSF
FT                   DQVVVEHYFTDTPWERTLQTFVRTYAERRDAMLAALDEFFPPEASWTHPDGGFFVWVTL
FT                   PEYVDVTSMLATALEAGVIYTPGNGFFPDGVRGRNSMRIAFCYENPEAIREAIRRLAVV
FT                   IEERLQLYRAFLEAGAL"
FT   gene            406092..407075
FT                   /locus_tag="Ccur_03490"
FT   CDS_pept        406092..407075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03490"
FT                   /product="ATP-grasp enzyme, D-alanine-D-alanine ligase"
FT                   /note="PFAM: D-ala D-ala ligase N-terminus; D-ala D-ala
FT                   ligase C-terminus; TIGRFAM: D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94075"
FT                   /db_xref="GOA:C7MMD5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD5"
FT                   /protein_id="ACU94075.1"
FT                   /translation="MKVAVLMGGASFERAISLDSGKRVCEALEEAGHKVVPLDTTKDLV
FT                   PTLRSERPDVAYSALHGKHGEDGTIQSLLEFLEIPFVGSPAAVCHDTWNKATIPLALRS
FT                   WAAGQGGMSSASYPQGVCLARDAMKDMGAATAIDLFEQRIPGGYPLCVKPACGGSALGV
FT                   HRVECVEDMGAALLDALTYDDEVLVQEWIDGVEVAVSILGNGWDAHALPPVEIIVRDGL
FT                   YDTDARLSDEAVDYYTPVRPSSLSNNEADAQAIRAEIERASLEVYRAYGVCDMGRVDLI
FT                   WDGAQARVLEVNVSPGMTERSLFPVACDAAGLSMTAVLDRLVCEHA"
FT   gene            407290..407880
FT                   /locus_tag="Ccur_03500"
FT   CDS_pept        407290..407880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94076"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD6"
FT                   /protein_id="ACU94076.1"
FT                   /translation="MSSKLGMFLLGGAIGAAAALLYAPRSGAETRALAADKANEAWGHA
FT                   QHYGTEAQARGQQIYDNVAARGQEVYRTATTQARGVYDRTATAAQGAFTAAQSRVQTAR
FT                   DNMRPVIVEKNDELREKIESARQRIASQVARNAAESQSAIDDAIDIADAPETVDTAAAT
FT                   SEPVDAAEATDTVSQSAVETSEAETGKKKSSKK"
FT   gene            407966..408808
FT                   /locus_tag="Ccur_03510"
FT   CDS_pept        407966..408808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94077"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD7"
FT                   /protein_id="ACU94077.1"
FT                   /translation="MDTKTQSTKQLSGTRVVGGKRGTSRIGKVGSFVFHPTEKRVVGFL
FT                   VKRPDLLWMFHRKDLFVSLDSFDFEDGRIRLPYKESKAATGLAACKRLGLTWDECTLWE
FT                   GMPLMTASGETFGAVDDVAFLRVSGKIVSVGARKGSLDTALLGHLEIPASLIRGFKVGA
FT                   GVPLAGGALDNQQEVSDEQDDARAFGAILVDDAVVDLAVEGGLAEKAGKGAAVAQDRIQ
FT                   KATKAAKPHVEKAARATEDAAVKGAYATGRQISRAKGMFGAFKDEYRKARFDESNSKE"
FT   gene            408814..409632
FT                   /locus_tag="Ccur_03520"
FT   CDS_pept        408814..409632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03520"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94078"
FT                   /db_xref="GOA:C7MMD8"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD8"
FT                   /protein_id="ACU94078.1"
FT                   /translation="MQSPESKNSEKTPAASASSASARTITHNDAKSSPILHIFGRSVSK
FT                   TDLFKLLGLLAFIVITVGVVWALWPLLSELFQEGGTEKMIDKVRSAGPWGVLILLAFQL
FT                   LQIIVAFIPGEVVQVSAGILYGPWGGSAIILLGCLISSWIIYQIVHRLGQPFVEDMVPT
FT                   KYLEKFQAFEESGRLDVMVFILFLIPAMPKDTFTYLVPLTKMPLKRYLVITTVARTPGV
FT                   VVSTLAASGLAEGNIAASVAIFAVVAVLAVLAIVFREKLMGLGDRFGKKD"
FT   gene            409636..410115
FT                   /locus_tag="Ccur_03530"
FT   CDS_pept        409636..410115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03530"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: TM2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94079"
FT                   /db_xref="GOA:C7MMD9"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMD9"
FT                   /protein_id="ACU94079.1"
FT                   /translation="MDDSAERKNAQHTGTGTEQQGTTNTGHRGAEGNASTEHKDTEHLN
FT                   AEPSDPGSNNAQHKAPGSPVPPDCHQGSYVPSKDYVAAGLLAIFLGSLGIHKFYLGYNS
FT                   TGFIMLAVTVVGSAFTLGVAGGVMGVIGIIEGIMYLTQGQQRFDRTYVQNRCEWF"
FT   gene            410215..411156
FT                   /locus_tag="Ccur_03540"
FT   CDS_pept        410215..411156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03540"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="PFAM: DeoC/LacD family aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94080"
FT                   /db_xref="GOA:C7MME0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME0"
FT                   /protein_id="ACU94080.1"
FT                   /translation="MPRITRDQVKVPVDVMPEFREAYIENYLKATRETGRLMLFACDQK
FT                   IEHLNADFYGEGIDESDADPEHLFQIASQGTIGVMAGQRGLIAHYAMDYPEVNYLVKVN
FT                   SKTNLVKVSQDDPYSPQLHELEAVLAMRDAGVNIVGLGYTIYLGSEYESTMLAEAGELI
FT                   AEAHANGLIVVLWIYPRGKAVGDREKAPETIAGAAGVAVCLGADFVKVNPPVATEGASS
FT                   AENLHIASVAAGRCGLVCAGGSKADPREFLSSLYDQIHVGGACGNATGRNIHMRSLDEA
FT                   VRLTQAISAITLDDASVEDAEAIFNGDARFTL"
FT   gene            411193..412506
FT                   /locus_tag="Ccur_03550"
FT   CDS_pept        411193..412506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03550"
FT                   /product="permease"
FT                   /note="PFAM: Permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94081"
FT                   /db_xref="GOA:C7MME1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME1"
FT                   /protein_id="ACU94081.1"
FT                   /translation="MDEFFKISARGSSVRTEVMAGLTTFLTMAYVVAVNPAMLGKAGVP
FT                   FTAALTATCFGAALMTAVMGLVTNRPVALASGMGLNAVVVFSICLGQGVDWRVAMACVL
FT                   LEGLAIMILVLCGLREAIMRAIPASLQRAIGIGIGLFIAFIGLKGGMLIVGNESSLITM
FT                   GAITQPEAIIAILSIVLAVGFTVVKIKGGLLWSILIATLVGIPFGVTPLPSAWNFGLDF
FT                   SAFAAPLQTTPDGMVALVQVIVQPALLLFVFSMLMSDFFDTMGTVFAVGQKAGFSKENG
FT                   DVEDMRQILIVDSAAAMAGGFIGASSITCYAESVSGATAGARTGFSNLVIAGAFVLCAF
FT                   LSPIIGMISSSATCGALVVVGYLMMTEIGEIDWHDPALAIPSFLVIVGIPMTYSITDGI
FT                   GFGFIFYCFVMLVTGRGRDVKPLMWIASAAFLAAFILV"
FT   gene            complement(412593..414623)
FT                   /locus_tag="Ccur_03560"
FT   CDS_pept        complement(412593..414623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94082"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME2"
FT                   /protein_id="ACU94082.1"
FT                   /translation="MKTNRRKEKSCAVALSALLVATVICSGCSLATNGPSSSASSAGGI
FT                   AASATTTTAAYSDSLSAISNIAANTASMDFSYTNRDTDASWDASTASTISFSSGTADVS
FT                   GSGVEVQGSRVTITAVGTYVVSGTSDAASIVVAAGENDKVQIVLDGVQLTGSDGPCITV
FT                   SSADKVFLTLADGTDNVLSDASTWTLSGEDGEANATVYSASDLTINGSGSLTVNATTHN
FT                   GITSKDDLKITGGTITVDAANTGLRGKDSVRIAGGIVTVTAQNDGIKSDNDEDADKGFI
FT                   SIDDGTVTVVSQDKALNASQLVRVAGGTVTLDAADDAIHSDKDALIAGGTTTISAGDDG
FT                   IHAEYNTGVSDGAVTITRSEEGLEAQCVEIAGGGVSIASDDDGINASVAEDTSTTTTTT
FT                   AEDTASISAAQTSTAALQDGLNTTATSTANTASSSMSTVSGPPSSGNTPNDSGASGAPG
FT                   GQAGPFGGGAQSQPESSEACAVVISGGTTVIENTLDGDGIDSNGSIWQTGGTVYISGST
FT                   QGNNSAIDSELGAQITGGSIVAVCATGMQESFNSSSTQASITATYTGQAGSRIDIQDAQ
FT                   GTTILSYTARNAFGWILASSPAIQDGAEYSILVDGVTVASVNASTQQAANGQPGMAGSG
FT                   GGPGGGPDGDSAGPNRAGEPPDANNAAGNQERPGGSAAPVG"
FT   gene            complement(414623..415318)
FT                   /locus_tag="Ccur_03570"
FT   CDS_pept        complement(414623..415318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94083"
FT                   /db_xref="GOA:C7MME3"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME3"
FT                   /protein_id="ACU94083.1"
FT                   /translation="MFDSLIQSVFPQSESTASILTGSAFLACALAALVLGVAIAGIYMF
FT                   RHRYTKNFVVTLALLPLIVQMVILLVNGNIGAGIAVMGVFNLVRFRSIPGSAKDIGAVF
FT                   LAMAVGLACGMGYLALAAAFTVIVGIANIIFVLSPLGSGHEGEKSLRISIPEDLDYTSA
FT                   FDTILGTYTTHWELVNAKTTNMGSLYQLDYHVVLKDPLKEKELLDTLRTENGNLSVQFG
FT                   RITTEKETL"
FT   gene            complement(415338..416294)
FT                   /locus_tag="Ccur_03580"
FT   CDS_pept        complement(415338..416294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03580"
FT                   /product="VTC domain-containing protein"
FT                   /note="PFAM: VTC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94084"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME4"
FT                   /protein_id="ACU94084.1"
FT                   /translation="MNTQKTGEATSATRAAESFARIEKKYLVKRAIWPALSQALHEHLQ
FT                   EGPFGRGSVSSLYYDTPRNDMITASMGKPFYKEKLRIRAYGEPAADEAVFVELKTKVKG
FT                   SSYKRRVATSCGAAQAWLAGMPYAEACARFPLRSTIHRTASSSSMPSHHPSESVSLQIV
FT                   REIDAARKRHAPLSPLIMTIVERVALTSASRSDVRVTFDFDARWRMKDLSFDTGLSGTP
FT                   LFADGCIIMEVKCQGAYPLWLAQLLSRSCLRPQPCSKVCRALEAARQIHPIGTLSPDSQ
FT                   QQSLQESTTQWLASNNQFARYTNYLSNDRLSVSEQSA"
FT   gene            416652..417332
FT                   /locus_tag="Ccur_03590"
FT   CDS_pept        416652..417332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03590"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94085"
FT                   /db_xref="GOA:C7MME5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME5"
FT                   /protein_id="ACU94085.1"
FT                   /translation="MQILVVEDDPRLAEALAAILKANDYQVDVVGDGDAGLAYAQSGLY
FT                   DCAVLDVMLPRRDGFSVAAQLRREGNALPILMLTARGEIRDKVEGLDAGADDYMTKPFA
FT                   PVELLARIRSLTRRTGSVEFETLSFNDITLDLDACELECKGKRIRLSQKEFDIMHVLMA
FT                   QPSRVASKDSLISKVWGYDSTAADNNVEAYVSFLRKKLAFIGATTCIVTLRGQGYRLGT
FT                   QADG"
FT   gene            417325..418623
FT                   /locus_tag="Ccur_03600"
FT   CDS_pept        417325..418623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03600"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94086"
FT                   /db_xref="GOA:C7MME6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME6"
FT                   /protein_id="ACU94086.1"
FT                   /translation="MGKRIRAAAHSFIASFRHRFVATSMVLAALVLVVVVVVVGMDSYH
FT                   RDMTSITKALDHRVHDPLENPEGKKGPDWKGEGAPRDASSDQFVATSVFEVDTNGEQTA
FT                   ADDVLGLSSDVVDSALSRVNESLNSSDGSTSGFLGDLNLYYSAIHLDSGGMRVAFASGN
FT                   FVMQNTMSLLATLGAVSAGALLAFFGISVLLARRATVPIERAWMRQQQFIADASHELKT
FT                   PLTVIMANNSLIEGNPHDTVASQRKWLHSTDEEAARMQVLINDMLYLAKMEDDEQAPIK
FT                   ERVDFSETVQSTVLQFESVAFEAKTELFSEIDPDIFAEGDRARLQRLVAILLDNACKYA
FT                   GPAGRVQVSLHRQARGCSLVVTNTGRPIDAADLPHLFDRFYRSDKARTGGAGGFGLGLA
FT                   IAQRTVTGHGGRIAAESSAEAGTVFTVVLPCTR"
FT   gene            418908..420320
FT                   /locus_tag="Ccur_03610"
FT   CDS_pept        418908..420320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03610"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94087"
FT                   /db_xref="GOA:C7MME7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME7"
FT                   /protein_id="ACU94087.1"
FT                   /translation="MSTDGNVQAGASRLPYELTHFNPAYFGFALLPSWVFGFIHRESVA
FT                   GDGTYLTAIFFLSLAAGMLAFAGLRFALNVSAVEKLLSWSSAVLCVLAAAVVAAPVAFP
FT                   PGLIIVACVGGGLGIAGLYLSWSPFYSSLDIRDAVACAFGSMVVAAVFKLIVSFSPAPV
FT                   ALTLLVLAAALSPMTLAAAERNAPPQGARPQLYFSSARSSFPYVILLGVAMCAFIIGVV
FT                   PGVSLSPRYDLEPVLVVVQCAIEAISALAVLWWVFLFNGKLHFTNMWRVIVIIVATALL
FT                   FLPHIGGPLTSWALMLVAVAQAMLVTVVWTMLADAAHHSSASPYLVFSFAWVSYALPLA
FT                   AGLYVGNILAAQTNSPFLVAVLSYALTVTAILTLNDRNFIEHRVFRDLDLAIPNEEALE
FT                   GIDAKCERIGRERGLTEREVEVLELLCRGRSKNYIADTLFISENTVRSHARHIYRKLDV
FT                   HSRQEAMDLLLD"
FT   gene            complement(420427..420510)
FT                   /locus_tag="Ccur_03620"
FT   tRNA            complement(420427..420510)
FT                   /locus_tag="Ccur_03620"
FT                   /product="tRNA-Leu"
FT   gene            420689..422134
FT                   /locus_tag="Ccur_03630"
FT   CDS_pept        420689..422134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03630"
FT                   /product="dipeptidase, putative"
FT                   /note="PFAM: Peptidase family M20/M25/M40; TIGRFAM:
FT                   dipeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94088"
FT                   /db_xref="GOA:C7MME8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME8"
FT                   /protein_id="ACU94088.1"
FT                   /translation="MCVALDRVASNPNALPNLLDQLDRFWETHWDEMLADLDRLVAIES
FT                   VEDLAHAAPGAPFGPGPAQALETFLTIADRMGFTTKNVDGYAGIADMVGDSPVQVGIIG
FT                   HVDVVPIGEGWTVDPLRVTVRDSFLLGRGTSDDKGPLLMSLYAAKFWMDKGRALPYTLR
FT                   YIVGANEETGMRDVEQYRKIHGDPAVVFTPDDEFPACYGEKGQIQGAITSPQLAGVIQD
FT                   IQGGIAPNAVPGSASALVAVPAVRLKPADGIEIETRDGGTFVTARGVQAHAAMPESGTS
FT                   AILHLVAYLAASGICSPAEQQWLSCLETWLGDFSGMGLGIASCDEAFGPLTAVGGMISM
FT                   QNGRIRQTIDIRFTTASDPDVLEKTLVSLTQSAGGVWETTRLAPVFLMNPESPFMQALI
FT                   SSYRAVTGDNQPAFTIGGGTYARHFPCAAGFGASVCGKAYPSWVGGMHAADEGVAIADL
FT                   KNAFKVYAVAIDRLMALDLCGEL"
FT   gene            422233..423798
FT                   /locus_tag="Ccur_03640"
FT   CDS_pept        422233..423798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03640"
FT                   /product="Ykud domain-containing protein"
FT                   /note="PFAM: Ykud domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94089"
FT                   /db_xref="GOA:C7MME9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MME9"
FT                   /protein_id="ACU94089.1"
FT                   /translation="MSGYTSEPIGKHCAPAHASTATSQATAAMSPVRISGVVSGAAEAT
FT                   KAKKNKINTRTVVKVLLIVLGVLAAVYVAGIIVFSNLFLPRTAFAGNNISFKSAADVSS
FT                   IATQIGTDYKVRVSGHGLDFTVTSADAGVTVDGSTVANKALSSQRAWAWPYEVFKTHDM
FT                   SSFLFSEYNESGLADVVGQKVDTFNETAEPPVNASVAFSSAKDAFEVKSEQTGTQVDTQ
FT                   AVLSEIDKAILNMDSAVTLDDTVLVQPTVLSNDPSLIAAADEANGYLKARIELVLGSTA
FT                   IHAADVGPAEISQWVTVDDEGNVSFDQDAMNSWTRDLASSINTVGSERSYKTANGDTIT
FT                   VSGGTYGWKVDADKLVSTVQEAVQEGENGQVTVPTKSEGYTWAGQGKADWGAHAEVSIS
FT                   QQHAWFFDESGNMVWESDVVTGKPGHDTSPGVWKIFKQQSPGTLTGSILPSTGKPEYVT
FT                   KVSYWMQFTYDGQGFHDATWQSSFGGSRYTSGYGSHGCVNLPLDKAKELYSHIAIGNAV
FT                   IVYN"
FT   gene            423929..425719
FT                   /locus_tag="Ccur_03650"
FT   CDS_pept        423929..425719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03650"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94090"
FT                   /db_xref="GOA:C7MMF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF0"
FT                   /protein_id="ACU94090.1"
FT                   /translation="MSETHKKPAPASTSTSTSTSATQSMPVVRLLQWSQRKGLYFLSAV
FT                   LAIIGVAGTIVPYFAAANMIVGILSGVRDWGFFVGWGLFAAGGYVLYLVCHYTSTAVSH
FT                   VATFATISRIRLLLAHKLTRVPMGYVLDTPSGTLKSLIVEKVDSIETTLAHAVPELTSN
FT                   VLVPIVVVVYLFMLDWRLALSALVPIAVGMLCTMGMAKDYAQWYGRTVEASKVMNNTSV
FT                   EYVAGIEVIKAFGQSASSYEKFSQAVRISAHSFIDWMAHCQIWSDGALSIAPATLVTVL
FT                   PLGCLFVVQGTLDPAVFAMCAVLSVGIFPPLYAALGFTDTLAQVGTTVEEIAAVLDLPE
FT                   QNRSATKASPDGHDITLSDVHFSYDADEVIHGVDLHIASGHITALVGPSGSGKSTLARL
FT                   IAGFWDPNTGTVSIGGCTLEEFTADQLAAQIVYVDQDSYLFDDTIMNSIRMGSPDASDE
FT                   DVIACAQASGCHEFISALPQGYQTVVGGSGGHLSGGERQRVAIARAMLKDAPIILLDEA
FT                   TAYADPESEAEVESAVARLVRGKTLVVIAHRLSTVRDADQIVVMNKGCIEAQGTHSELM
FT                   QQCPLYASMYNAHIGARDVA"
FT   gene            425731..427464
FT                   /locus_tag="Ccur_03660"
FT   CDS_pept        425731..427464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03660"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="PFAM: ABC transporter; ABC transporter transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94091"
FT                   /db_xref="GOA:C7MMF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF1"
FT                   /protein_id="ACU94091.1"
FT                   /translation="MISVLKKYFAFGSIYQKNLTRGLLLTFIHAFFEALQITALWIVFT
FT                   DLVHGTISNTTLLMSLGTMLVCIVGSFVTAHFTSVNFCQANFGMAGAKRAEVGDRMRHL
FT                   PMGYFNEKSLGDITGIMTNTLDAMQTMGGMVYQAVLGGLAFSVMICVMMFVLDWRLGLL
FT                   TLITIALFCATMELLQRFVRTASDRRTAAQDSIISAALEYVRGIGVIRAFSLLDSANSR
FT                   FAEAVGRCEHENVAFEFACLRFAVAQSVVAKAASVTMCLLSCWLWLAGIMDAGICLTMI
FT                   VASFMVFSRLEMSGAFSSILRHIEVAMEKVNALLATNTMDEGAGLTTASGYDIDIKNVS
FT                   FGYGTARILEDVSLSIPAGTSCAIVGPSGSGKTTLVRLIERFWDVDTGVVQLGGRDVRD
FT                   YQVDSLMENFSTVFQGVFLFDDTVENNIKFGNPGATHEQVVRAAQRARCEEFIAALPNG
FT                   YNTRLGENGSMLSGGERQRLSIARAILKDAPIVILDEATANVDPENELELQHAIAELTK
FT                   SKTVIMIAHRLKTVRDADQIIVLDKGRIVQQGTHDSLMEQGGLYATFVNMRERAVGWKI
FT                   A"
FT   gene            427567..428259
FT                   /locus_tag="Ccur_03670"
FT   CDS_pept        427567..428259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03670"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94092"
FT                   /db_xref="GOA:C7MMF2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF2"
FT                   /protein_id="ACU94092.1"
FT                   /translation="MEKARETTARRRILASALHEFRAHGFEAASLRTIADRAGVTTGAI
FT                   YGYFPSKLDLFDAVVKPAGDTLAFLFEHAQEEFCALSAEEQDFPHMLTFAHDVLERLVA
FT                   ILYDNRQVFLVIFKNAAGTPWNNYAQRFVEVEIKGTVQYMESQALQSDASFNKVSEPLM
FT                   RVLAESYFRDLFTLFCLDSCRESALENMRQLINFYHRGYEALLLGKYDKAVSGTSIQSN
FT                   QLEVSGNY"
FT   gene            428578..430659
FT                   /locus_tag="Ccur_03680"
FT   CDS_pept        428578..430659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03680"
FT                   /product="conserved repeat protein"
FT                   /note="TIGRFAM: conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94093"
FT                   /db_xref="GOA:C7MMF3"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR041030"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF3"
FT                   /protein_id="ACU94093.1"
FT                   /translation="MIKSTTARMSLLLAALAVLVAVFALPMQKAFAVTVIKDNTDLAHV
FT                   QAYQFTMTQANMSVISQSGDVDMDVVPPETGREQSTVFALKVDKTKRADQSFSQPLKLK
FT                   FSNAGTVNGKVVDVYVTVNSVDLEFLQEGTGDFENPSKTVVPFMMVDENWGHKSFTIQN
FT                   YIEGTHPTYTKDMFHTFGVHANVTVELKNQDGTPCDLRAVMFPSDIDVMSTHNRKETFS
FT                   LFNKDTAFDKIVMNNRNSLNESTSGNKTSWTPTIPAGTSGDDAEHNVSGLAIRSVDNKI
FT                   NFEYGTTMSCGGLFGLYTEVIAPPPTKEVDKEAVQAEAGQELTYTTKYRMPKPGVDTIG
FT                   PITSMTMIDTFDDRLDFKSLVVTQDGTTLTEGDDYTVTVEGQKVTVDIAKKHLTEGNGG
FT                   KYYTIVYKTVTNEKAAQEGTANIDNIVTQNVDNIKADSNKVTTRLLYAKDHKFISGVPG
FT                   KDLPQEVIDLTPGKVKGYENGTTVTPDQPTQTQVKVPEGTWVFVGYDKDSETINGADAH
FT                   FIGKWVLVSKPVKDVLDENGTSIDGQSVTAGQILTYTVSYPNTTGASRTVTITDPIPAH
FT                   TTYVEGSADNDGTYDSATGKITWVKEVADGDTLKVTFKVKVDEDVDSDEIANTAHVNDG
FT                   LIDQDTNTTKNVAKKPPVPSVLPVTNDTFDGGIVAGILASVSGLVSVVLYRRNRQLGC"
FT   gene            complement(430925..431875)
FT                   /locus_tag="Ccur_03690"
FT   CDS_pept        complement(430925..431875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03690"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase, C-terminal
FT                   domain; 3-hydroxyacyl-CoA dehydrogenase, NAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94094"
FT                   /db_xref="GOA:C7MMF4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF4"
FT                   /protein_id="ACU94094.1"
FT                   /translation="MGIEDIKRVTVAGGGVLGSQIAFQAAYRGYDTTIWLRSEASIERC
FT                   QTKIDRLTTIYLDTLEALKSDPSAWAYGLIAREDVSPEACEALKDKVKAAHTNLKLTAD
FT                   WDEAFNNTDLVIEAIAEDPQQKTAFYQELAHHLPEKAIIATNSSTLLPSMFAEATGRPQ
FT                   KYLALHFANEIWKNPIGEVMGHAQTAQENFDTVVAFAEAIRMVPVKVLKEQPGYLLNSM
FT                   LVPFLSAAQGLWAAGIGSPEDIDRAWTLGTGAPAGPFRILDIVGLTTAYNVSIMNPAAK
FT                   EEGTIQNRVATLLKEKIDKGETGVAAGKGFYEYRK"
FT   gene            complement(432147..432704)
FT                   /locus_tag="Ccur_03700"
FT   CDS_pept        complement(432147..432704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03700"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Domain of unknown function DUF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94095"
FT                   /db_xref="GOA:C7MMF5"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF5"
FT                   /protein_id="ACU94095.1"
FT                   /translation="MNLFEIVVLGIALSADAMSVTLCNIIANPRISRRRAALIPLTFGA
FT                   LQGIMPLIGYLAGFLAVEAISAYAGIITFGILGIIGAKMAWDGIHEDSSEDEEAVRGKL
FT                   SVPVILVQAIATSIDALAVGISLAAGQTNIVSAAGIIALSTFLLCGAMIIIGRCLGASF
FT                   GRRAQIVGGIVLILLGAKAFFF"
FT   gene            432898..434268
FT                   /locus_tag="Ccur_03710"
FT   CDS_pept        432898..434268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03710"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="PFAM: MatE; TIGRFAM: putative efflux protein, MATE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94096"
FT                   /db_xref="GOA:C7MMF6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF6"
FT                   /protein_id="ACU94096.1"
FT                   /translation="MLDRADFKVYIHYIIPSIASFLLTGIYSIVDGLFVGHAVGDAGLA
FT                   GINVAWPLVAFMMAIGTGVGMGGAVISSIYAGIGDLRSSNRAIAHTLSMLALATPLVMV
FT                   VLFCFGQQLIYLFGGRDEILSQSQSYLSVMTWGSLFQIMASGCIPLMRNKGRVVAAMVI
FT                   LVISGLLNVALDFALVMLAGWGVAGAGLATVIAQAFVFICGLAFFLKRENRPRSRDFAL
FT                   DGEFLSRTLKGGFAPFALTLLPEVTTIVMNMATEAHGGATAQSAFAVISYVAVAIQWII
FT                   QGVNDGSQPLVSLRFGEGKLSTMRALRHTNYVFAVGIGLAGMVALYVLRVPLAVVFGIS
FT                   PQTSEVFYHGVALFSLALGFYGITHATTSFFYAVESSRNATIVILGEVVFVVFFAAVLP
FT                   LFLGLDGVWLAVVATQACLAVLAVALLRHSRGNIAQAAARHVEKHAELAGQAAESNA"
FT   gene            434465..435187
FT                   /locus_tag="Ccur_03720"
FT   CDS_pept        434465..435187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03720"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="PFAM: Cytochrome C biogenesis protein transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94097"
FT                   /db_xref="GOA:C7MMF7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF7"
FT                   /protein_id="ACU94097.1"
FT                   /translation="MFVNYLLTFLEGIVTFVSPCLLPLLPVYVAYFAGGLPEASGNAAA
FT                   SQSASTSASRIAGSKFKGALGFVAGFTVLFCALGAMAASLGGFFMQNRRALEVVCGLVI
FT                   ILFGFTYWGVIKTSIFTGRGARPKTLSQGFGPSFLFGMAFAVSWTPCVGAFLGSALSLA
FT                   VTTGDMLTGASLLACYSLGLGVPFILSALLIDRLEGAFTWVKAHYGIINKVCGALLVLV
FT                   GALLVSGLFSSWMGMFAA"
FT   gene            435243..435881
FT                   /locus_tag="Ccur_03730"
FT   CDS_pept        435243..435881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03730"
FT                   /product="thiol-disulfide isomerase-like thioredoxin"
FT                   /note="PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94098"
FT                   /db_xref="GOA:C7MMF8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF8"
FT                   /protein_id="ACU94098.1"
FT                   /translation="MISVVVLVAVVAVAVVAYRALSAGQMSSSTSAGSASTSSSSIDQS
FT                   QALSQSPGNSSSANGSGSAMSGGSSGNSQALPSFSVLDSSGAKVSSDSVIGKPTFIGFW
FT                   ATWCPNCVSEAPDIQKLYDTYGDRVNFMMIDCVDGQRETVDIAKQWIESKGYTYPVYFD
FT                   TTNQASLALRVQYLPTIYLVDAQGNVTSMKIGSTSFDAMATALDGLLAS"
FT   gene            complement(435895..436158)
FT                   /locus_tag="Ccur_03740"
FT   CDS_pept        complement(435895..436158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03740"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94099"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMF9"
FT                   /protein_id="ACU94099.1"
FT                   /translation="MPTIMPVSSLRSYTEVLDGVAPGAPVFLTKNGQGKYAILDMDDYN
FT                   KLAAENRLFSELEAGRTSGDKDGWITSENVRKRFAERAQHVQ"
FT   gene            436272..436346
FT                   /locus_tag="Ccur_03750"
FT   tRNA            436272..436346
FT                   /locus_tag="Ccur_03750"
FT                   /product="tRNA-Val"
FT   gene            436623..437087
FT                   /locus_tag="Ccur_03760"
FT   CDS_pept        436623..437087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03760"
FT                   /product="universal stress protein UspA-like protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94100"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG0"
FT                   /protein_id="ACU94100.1"
FT                   /translation="MYQSILVPYDRSEHAKHALSAALELASTSFEGKVTLLYVAELPDF
FT                   DDPTFEAAAQMAGVARVSQEDSLAAQREFYERKKKDLIADAKSIVGDFTQVVYRVTSGK
FT                   PHDAIVEFAETGQFDLVVMGNRGLGALRGALGSVSYAVLRSVDIPVLIVK"
FT   gene            437156..437350
FT                   /locus_tag="Ccur_03770"
FT   CDS_pept        437156..437350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94101"
FT                   /db_xref="GOA:C7MMG1"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG1"
FT                   /protein_id="ACU94101.1"
FT                   /translation="MEHVRYLKAASAICGALVLFAIGIMLTGYQAWDAKHIGTTVVVAI
FT                   ASVVCGYFAYKKTRASRTK"
FT   gene            complement(437504..437977)
FT                   /locus_tag="Ccur_03780"
FT   CDS_pept        complement(437504..437977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03780"
FT                   /product="phosphoesterase, MJ0936 family"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94102"
FT                   /db_xref="GOA:C7MMG2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG2"
FT                   /protein_id="ACU94102.1"
FT                   /translation="MKVGLVSDLHRQLPTAVMEALQGVDRILCAGDIEVEPILWELQTI
FT                   APVTAVKGNNDYGIDLPLSTTFILEGVRFFMVHRPQDIGTPADDVAVVVHGHTHIPRNE
FT                   VIGGVHYINPGSPSYPRGGSDPSVAILILRDSAVERVEFISVGEYEKMPPRQG"
FT   gene            438053..438955
FT                   /locus_tag="Ccur_03790"
FT   CDS_pept        438053..438955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03790"
FT                   /product="rRNA methylase, putative, group 3"
FT                   /note="PFAM: RNA 2'-O ribose methyltransferase substrate
FT                   binding; SpoU rRNA Methylase family; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94103"
FT                   /db_xref="GOA:C7MMG3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG3"
FT                   /protein_id="ACU94103.1"
FT                   /translation="MAEFIEGKHPVWEALSTHVPITRIFLADGNKHDRLLQDILHMAAR
FT                   QHIVMETVPRAQLDKRSKRGSHQGIMAQAQPFAYASLDDIIARGNDQAVSLAVSHSSSA
FT                   APCALIIVLDHITDAGNLGAIARSAESVGAAGIIIPNKRSAYVTASTYKSSAGAISHIP
FT                   VAQVANLQQALARLKNEGYWVAGASEKAEGGIWDANLTGNVCLVMGNENTGLARLTQEA
FT                   CDFFVSLPQRGVVSSLNVAQSATVCMYEWLRQNRLSLQECASGTSNTSHTLANANANAS
FT                   NRSSAPSCCSRASSQAKAQ"
FT   gene            438977..439516
FT                   /locus_tag="Ccur_03800"
FT   CDS_pept        438977..439516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03800"
FT                   /product="predicted RNA-binding protein containing a PIN
FT                   domain protein"
FT                   /note="PFAM: Protein of unknown function (DUF901)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94104"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG4"
FT                   /protein_id="ACU94104.1"
FT                   /translation="MKSRNKLLIVDGYNVLRSGSRYRHMRAMADYTDEVYNKCREALIN
FT                   DVIAHMGRDYCEAYLVFDGRDNEFSTGVPERIGGVQVVFSPAGLSADTVIEKLAFDARS
FT                   RGVEVMVVTSDATIQDTVFGLGVDRMSADGFSREAELLDQEARLDENPKATVKNTVGER
FT                   IDASTLAQLEALRDGK"
FT   gene            439845..443381
FT                   /locus_tag="Ccur_03810"
FT   CDS_pept        439845..443381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03810"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="PFAM: RNA polymerase beta subunit external 1 domain;
FT                   RNA polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain
FT                   6; RNA polymerase Rpb2, domain 3; RNA polymerase Rpb2,
FT                   domain 2; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94105"
FT                   /db_xref="GOA:C7MMG5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG5"
FT                   /protein_id="ACU94105.1"
FT                   /translation="MAQAQNNAPNSLYRSRRSFAKIPPVIDIPNLIAIQTESFDWFKGE
FT                   GLDQAFQDICPIESNTKNMRVEIGKHEFGDPKYPVDECKVKDLTYQAPLFAEVRFTNLE
FT                   TGEIKEQDVFMGDFPLMTPRGTFIVNGTERVVVSQLVRSPGVYFGAERDKTSNKTIYNA
FT                   KVIPSRGAWLEFETDKRDILSVRIDRKRKQPATLLLRALGLAETREEIIEALGDSEMVL
FT                   RTIDRDPATTRDESLIELYKRFRPGEPPTIDSARTLLDGLFFNPQRYNLAKVGRYKINK
FT                   KLGFDAEGDSSTLTNDDIIATMRYIVALHNGEEGYVTDDIDHFGNRRIRTVGELIQNQF
FT                   RIGLSRMERVVRERMSMQEPDEITPQSLINIRPIVASIKEFFGSSQLSQFMDQANPVAG
FT                   VTHKRRLSALGPGGLSRERAGFEVRDVHNSHYSRMCPIETPEGPNIGLIGSLATYARVN
FT                   NYGFIEAPYRRVVEGKVTNDVDYLTADEEEHHTIAQANEPYDTKTGILGTTDESGTFHP
FT                   TERLLARTRNSHGEFGDPAEVSVSQVDYMDISPRQMVSVATSLIPFLEHDDAHRALMGS
FT                   NMQRQAVPLLRPHAPFVGTGIEHRIAVDSGEILIAQNSGLVDYVDGEVINILTDDGEYD
FT                   EYLIPKFQRSNQGYCVNHKPLVRKGDRVEVGDVLADGQSCDHAELSLGQNLLVAYMPWE
FT                   GYNYEDAIVISERVVAEDLLTSIHISEYEADARDTKLGPEEITREIPNISEDMIADLDG
FT                   DGIIRIGAEVNPGDVLVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAGG
FT                   RVIGIHRFSRASGDELAPGVNEQVRVYVAQKRKIQQGDKMSGRHGNKGVVSRVLPVEDM
FT                   PYLADGTPVDIMLNPLGVPSRMNVGQLLECHLGWAAKWGWSDDENSDEAVEGPIYVSTP
FT                   VFDSATEEEIRDVIEKSNRNLVNLNREKYGDAMREEFVPQLNEFGKTTLYDGRTGEPFR
FT                   EPITVGYPYMLKLGHMVDDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALYAY
FT                   GASNVLQEILTVKSDDTVGRVKTYEAIVKGENMPDAEVPESFKVLIKEMRSLCLNVELE
FT                   GHNREVLDVIESHPERTNDDNVLAGLVEDAQKTEREDDDMIGDIAAELSNLISDDLKDG
FT                   NDGNDLIGGEER"
FT   gene            443382..447773
FT                   /locus_tag="Ccur_03820"
FT   CDS_pept        443382..447773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03820"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="PFAM: RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 3; RNA polymerase Rpb1, domain 4; RNA
FT                   polymerase Rpb1, domain 5; Bacterial RNA polymerase, alpha
FT                   chain C terminal domain; RNA polymerase Rpb1, domain 2;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit,
FT                   predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94106"
FT                   /db_xref="GOA:C7MMG6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG6"
FT                   /protein_id="ACU94106.1"
FT                   /translation="MTEYDVNNFDALRISLASAEDIRSWSHGEVKKPETINYRTLKPEK
FT                   DGLFCERIFGPTKDWECACGKYKRIRFKGIVCERCGVEVTRAKVRRERMGHIELAAPVS
FT                   HIWYFKGSPSRLGYLLDIAPKDLEKVLYFASAIVTSVDKEAREEDEADLRDELAADLDE
FT                   LDAERDRLIASTRRLSTDYTPEDDEFVDDIEDEERLTPEEVEDELADIYEEFNERKALR
FT                   SEAFEAFMKIEPKQLVADETLYREMRLNYSEYFKGGMGAEAVRDLLDDIDLDEVAEELS
FT                   EIIATGKGQKRAKAVKRLKVVDAFLKSENKPHDMILDVIPVIPPDLRPMVQLDGGRFAT
FT                   SDLNDLYRRVINRNNRLQRLLDLGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPVTGPGN
FT                   RALKSLADMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPSAMALELFKPF
FT                   VMKRLVELEYAANIKAAKRAVDRGASYVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEP
FT                   VLTNGKAIKLHPLVCTAFNADFDGDQMAVHVPLSSAAQAEARVLMLSSNNIKSPAHGRP
FT                   LTIPTQDMIIGLYYLTTIRDGFAGEGRVFASFDDVQHAYDAHADLDLQARISVRLPRDM
FT                   TVVSSYGQAKECKAGERIETSAGRVIINDVLPDDYPFLNYELDKTEVGRLISDCSNRYS
FT                   TAAMEPILDGLKSNGFHYATKAGLTVSIYDATIPDDKDEILAAADEKVAAIDGDYEMGL
FT                   MSDEERHKQVVDIWTDATEEVGEAMASHFSGQNPIYMMATSGARGNIKQIRQLAGMRGL
FT                   MADTKGEIIDTPIKANFREGMSVLEYFLSSHGARKGLADTALRTADSGYLTRRLVDVSQ
FT                   DVIVRELDCGTTEGVTYALVDSKGELDENLVGRCLSEDVSDASGTRLASAGDYINSMDE
FT                   LTAWQQAGVEEVTIRTIMTCHAEHGVCQKCYGWDLATARPVNIGTAVGIIAAQSIGEPG
FT                   TQLTMRTFHSGGVAGDDITQGLPRVVELFEARKPKGQAVLAEIAGTLQISGDKQTKTIT
FT                   IHDQEGNYREYVTSARVQMMPGVVDGSEVTVGQQITRGSVNPHDLLRLTDPNTTLRYIV
FT                   GQVQDVYVSQGVDINDKHIEVIARQMLRKVAVLDSGDSDYLPGRQVNRYEFEDVANQLV
FT                   LEGKQPPVGQPLLLGITKASLATDSWMSAASFQETTKVLTDAAIESKTDQLVGLKENVI
FT                   IGKPIPAGTGLKRYRNVGLTYKGHAVHEITSDTLPDYAPEALRKVEELLPQPQDWSLDG
FT                   DSYLNMGGSYSSYFNSLSAGRNSQLSDEDARLYIYDDLGVSQRWANKFSEAGIETVGDL
FT                   IGYSEEDLLRIEGIGAKAIEELKEGLEKHDLLHIIEDDLNATGDDMSQLLDMVFSPDDT
FT                   ILIGGDVPATFNTEGEDMLGEALPPRSYQRNLEELDAILGNVGDLNLHIDESSTDDSEN
FT                   EE"
FT   gene            447855..449198
FT                   /locus_tag="Ccur_03830"
FT   CDS_pept        447855..449198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03830"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94107"
FT                   /db_xref="GOA:C7MMG7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG7"
FT                   /protein_id="ACU94107.1"
FT                   /translation="MGKLFGTDGARGVANSELTCEAAFRLGQAAVHFLGSVITVGKDTR
FT                   RSGDMLESSLAAGIMSAGGTVQALGVIPTPAVALLARTMQADGGIVISASHNPPEYNGI
FT                   KFFDGNGYKLPVTTEEAIEEYVFAGGLSVSERPTGAAVGNIVLVNNAREVYINHAIEAV
FT                   RSQGIDLSHWKIALDCAHGASSVTSPEALRRLGAEVVVINDNYNGYDINVDCGSTHLEP
FT                   LKELVAATGADIGIAHDGDADRVLFVDAAGNEIDGDMVEAACALDMKEQGRLAGNTVVS
FT                   TVMCNLGFVRAMEAHGIAVKQTAVGDRHVLECMRDADYRIGGEQSGHTIFLEYNSTGDG
FT                   LMTACQFLVCCERAGKTPAQAAAVMTRYPQELINVRVSNKDAISSNEAIRAAITSAEQE
FT                   MGDAGRVLVRASGTEPLIRVMVEAADEAQARLHCEAIATVVQSEIGCE"
FT   gene            449453..451276
FT                   /locus_tag="Ccur_03840"
FT   CDS_pept        449453..451276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03840"
FT                   /product="putative collagen-binding protein"
FT                   /note="PFAM: Collagen binding domain; Cna protein B-type
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94108"
FT                   /db_xref="GOA:C7MMG8"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG8"
FT                   /protein_id="ACU94108.1"
FT                   /translation="MKRKLSYLMSVLLVAGLMIPAGSLQAFADDTTTESSTPAVSVDAV
FT                   APTSTGVVDTTAAPAAADSTEATDATATINSTDSVTEETPTADTSSASSATADMQATVS
FT                   EDATTNSLDVATPLAVSSLATDVSDALLTAGLTRAGPLQRPGAGQEVSVNLTGFKFKNM
FT                   DHNDTTEIRANYNFFLSMDWDASGKSIHEGDYFDIKLPDQMKFPEGNSNFDITDSDGNV
FT                   IAHGEIQPGPDNNGGKVHVTFTNYVNNRYDIKGNIQVKTRFNTSRITPNENNNFTIETG
FT                   GKTKTSTVKVIDPWKLVDETVGKWGEQDGSDPNTTVWYVRINHMKDNLTNVVISDHLTS
FT                   DQGLDGIHYIAGSFELQHVTMDEFGHTTSVISRNDINSSVQISADGTSFTYPMGNINGD
FT                   QYVLRYKTTYKPGMKLLNHIKLVSTEKTKEASSSYHYTGSNGNGEGSLFSKIKIIKVSA
FT                   SDETVKLAGAVFTITSVSDPTRTYSLTTDENGEAITDRLVAGQYTIKEVTAPEGYLVND
FT                   ETYTVTVTSNAATIQTVKDEQKPEVPDNPNPGPNPEPSPNPEPSPSPEPPTPESSVLPL
FT                   TADGFMPLAGMLGFAALAGAGLAVRAWRCSR"
FT   gene            451477..452376
FT                   /locus_tag="Ccur_03850"
FT   CDS_pept        451477..452376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03850"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94109"
FT                   /db_xref="GOA:C7MMG9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMG9"
FT                   /protein_id="ACU94109.1"
FT                   /translation="MKNKGKWLISVASCLAFVCALALAGCSSGTTASTDNASNVDSSAK
FT                   ETTQLQIFAANSLSKAMDEVQQLYTRDHSGITFADTQYKSSGELNELLAGGASADVLIS
FT                   ASKAKMDDAESAGYVDAPTRFNMFKNDLVMVTSEKNDAITEVSLDDIAAGKYKVAVGDE
FT                   SVPAGNYACQSLSTVGCYTEPDGTTGKDATGKGGQFSGALAADGMVSLQTSVGNVCKQA
FT                   QSGDVDIAFVYTSDVYRFGGVKVVGTVPANTHKNIIYPAAITAQTDHAAEAQAFLDWCT
FT                   TDPEALAVWQKWGFEMAA"
FT   gene            452466..454058
FT                   /locus_tag="Ccur_03860"
FT   CDS_pept        452466..454058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03860"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component; TIGRFAM: molybdate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94110"
FT                   /db_xref="GOA:C7MMH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH0"
FT                   /protein_id="ACU94110.1"
FT                   /translation="MGNNLDSAICIAWRHLRTCFVACLVALMLAFLVFPSIAWADDDAT
FT                   GDVDDPTTRSSAAASISQQATASESASSSEAAHGTGAGGASSSAAASTGTTAENAAGSA
FT                   GDSAGSLEVSSDNTAARSTAVSFALSEFSRAQVGSNRAIADAYRGYAYYAGSHAPSMVL
FT                   IATPDYAVVYVSPEAAAREGLTLSAEADRAALRSMVGALDAANANGGAVLGSSARWYFT
FT                   SDETFEVDGAVFHFNQDFGDGCIYECITDTAGGDITDSERDLPDGAVPIKLTHACFAEL
FT                   VAFDDAAIAPAPTWIESLGGFLSSIDYSPLWVTLKTTGCAIVFIFVLGLAAAYFCLGLS
FT                   ARWRDVFDAIFTIPMVLPPTVCGFILLLALGNNTGVGRWFISVGFPLIFSWPATVIAAV
FT                   VVAFPLMYRSARGAFESLDPVMLDAARTLGWSNARIFFKLMLPLSWSSIAAGTVLAFAR
FT                   ALGEFGATLFLAGNYLGVTRTIPIAIYFEWMNGNTDTAIFWTVVIMAFSFLVIMFINLW
FT                   GRRTVRYRKGATR"
FT   gene            454055..455167
FT                   /locus_tag="Ccur_03870"
FT   CDS_pept        454055..455167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03870"
FT                   /product="ABC-type sulfate/molybdate transport systems,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94111"
FT                   /db_xref="GOA:C7MMH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH1"
FT                   /protein_id="ACU94111.1"
FT                   /translation="MSLEITIKKHLPSFDLDVSFTASRGVFGLLGASGCGKTMTMRCIA
FT                   GIESPDEGRIVVNDEVFFDSEAGINLSAQQRKTALLFQNYMLFPNLTVADNVAAGIPRR
FT                   LPAEERRRLVERELARFDVSHFSRRYPAQLSGGQQQRVALARMLAARPGILMLDEPFSA
FT                   LDAHLKDLLEQNLSSLFEAFEGTILYVSHDIDEAVRFCDTIAVMEDGRVREIDAARSLV
FT                   DHPQSIAALKLSGVKNVARVQWRDAHTVYCPQWGIELTCPNTVSEDVQAVGVRAFHIER
FT                   AAAPGENVFRMRVDRAIDSRFDRLSLLRFLDRDEDAARMVEAEEEEMRYLHQRLSWRVS
FT                   LLDTDEALCPHVGDELLVRIPPERLHVVYQ"
FT   gene            455343..456356
FT                   /locus_tag="Ccur_03880"
FT   CDS_pept        455343..456356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03880"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="PFAM: Molybdenum Cofactor Synthesis C; Radical SAM
FT                   superfamily; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94112"
FT                   /db_xref="GOA:C7MMH2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH2"
FT                   /protein_id="ACU94112.1"
FT                   /translation="MKDSHGRTIDYLRISLTDRCNLRCVYCMPADGILQVPHDTILRYD
FT                   EIVRFVQVAAQRGVQRVRLTGGEPLVRKGVAGLIERLSAIEGIDDISLTTNGVLLKKMA
FT                   PELHRAGLRRVNISLDTLDPAQFTQITRLGHIESVLEGIDAALEVGFDPVKINAVAVRS
FT                   LHQDYLAFAKLSLDRPLHIRFIEYMPVGNSSGTCGAGWGPEDVVSCDDIRRQIDEGAQA
FT                   AGIGTLVAAEGNNRPVGGGPARYYHFPQALGTVGFISPLSRHFCGDCNRLRLTSTGGLR
FT                   PCLFSDKEYDVRTPLRAGNDAALNAVIDAACGMKPSEHHEGDHARATQTNMNAIGG"
FT   gene            456445..456945
FT                   /locus_tag="Ccur_03890"
FT   CDS_pept        456445..456945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03890"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="PFAM: MoaC family; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94113"
FT                   /db_xref="GOA:C7MMH3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH3"
FT                   /protein_id="ACU94113.1"
FT                   /translation="MSGLTHIDEHGAARMVDVGEKASTQRIAIAEGFISMNPATLSMIV
FT                   DGTAPKGDVFACARIAGIMASKQTSSLIPLCHPLAITKSEIECKPVYAGERTDGLVGVH
FT                   VQSTCKVTGQTGIEMEALTAASVACLTIYDMCKAVDRGMEIQEVRLLVKDGGKTGLWQR
FT                   ESA"
FT   gene            457136..457933
FT                   /locus_tag="Ccur_03900"
FT   CDS_pept        457136..457933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03900"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="PFAM: Domain of unknown function DUF28; TIGRFAM:
FT                   conserved hypothetical protein TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94114"
FT                   /db_xref="GOA:C7MMH4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH4"
FT                   /protein_id="ACU94114.1"
FT                   /translation="MSGHSKWATTKHRKAAQDAKRSALFGKLSRNITVAAKEGGDPNPD
FT                   NNASLAAAIEKAKGYSLPKDKIKTAIDKAFGSGKDAASYETVVYEGYGPAGVAIYCEAL
FT                   TDNRNRTAADVRSAFTHAGGSLGTSGSVAFQFERKGQIRVDKVIKSDEKKVPDKENAAD
FT                   EDEFMLAVAEAGGNDYDDAEDQWIVYTAPGDLMAVKKGLEEQGIETSGAEFVMEPTTPT
FT                   TVSVSDAKKVMRLVDRLEELEDLQSVFHTMDITDEIAEALDEE"
FT   gene            457967..458920
FT                   /locus_tag="Ccur_03910"
FT   CDS_pept        457967..458920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03910"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; TIGRFAM: cell
FT                   division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94115"
FT                   /db_xref="GOA:C7MMH5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH5"
FT                   /protein_id="ACU94115.1"
FT                   /translation="MARRTSEHEARILDFEEARRPAREQSTRAARPSTRRATRTASSRS
FT                   SARGESSSQPARRSTGAASSSQAGSVRRSGRRIQSSAREESFCRSASTASSRHSTRPHV
FT                   SARQQQSGRITSFFKGLQKKRLDKRFDRSVRTGDDTTHESSNSARPKAALYSTHMGRVH
FT                   RKSSRMQNTAARTTSRAGSASIATSSRQRWVVPVCVVAFLVLCGAFLYAPAKDYYIASR
FT                   DAAKTQAEYNRVSQENSQLQSDVESLSTDEGIEDRAREDYGWVKEGENSVSVSGLSSDR
FT                   DQSTNASSKADAASEVKAPTTWYSGILDAFFGYKDS"
FT   gene            458921..460000
FT                   /locus_tag="Ccur_03920"
FT   CDS_pept        458921..460000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03920"
FT                   /product="exopolyphosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94116"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH6"
FT                   /protein_id="ACU94116.1"
FT                   /translation="MEQRIAAIDIGTVTCRLLIADVADARINEVARECTIVNLGEGVDA
FT                   TGVLSPAAIDRTVDCLASFMHTIDAYRQDAPITVRCMATSASRDARNASELTARLAQLG
FT                   LTLTVISGEKEAELSFQGASAAFPGEEVAVVDVGGGSTEIIVGQGGAAPRRSHSFNIGA
FT                   RRATERFIQTDPPSADDMKAIHDWCRPVFESFFAASGASGTCHSTGNASCSSSDGTGMS
FT                   NKAGTSDGVSAPSNASMSNSVGAPDNVIVPPQRLIAVAGTATTAVSVADAMEAYDSSRV
FT                   HGREMKAAELDNLIDRLAALNLAEREEVVGLQPQRAPIIVAGLLILSDAVHAAGTGSFI
FT                   ASESDILAGIIMDTACRSS"
FT   gene            460095..460179
FT                   /locus_tag="Ccur_03930"
FT   tRNA            460095..460179
FT                   /locus_tag="Ccur_03930"
FT                   /product="tRNA-Leu"
FT   gene            460269..461333
FT                   /locus_tag="Ccur_03940"
FT   CDS_pept        460269..461333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03940"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94117"
FT                   /db_xref="GOA:C7MMH7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH7"
FT                   /protein_id="ACU94117.1"
FT                   /translation="MSDQTTRSIREIMDSVEETPETFEDYLASYADQVGDLVNRFIPRG
FT                   SHPDMNKYLYDPLLRYSRNGGKRHRPLICFAACRAVGGDLDRALSAAAAIEHFHTAALI
FT                   HDDIADEAELRRGEPCLHLTEGLGLAINAGDLGLSLVNGTVMEDDALDDATKVRVVSEL
FT                   ITMTRRTIEGQALDIGWARDGRYDITPEDYLVMATHKTAHYSGAVPLAIGAIVGGGTEG
FT                   EIEGLRNYGLDTGLAFQIQDDLLNLIGAEEATKKDFRNDITEGKRTLVVVHALQASTQR
FT                   DRLVEILSSREKDPRVLAEAVSLMEEAGSIEYARNYAENLTSIAKNRLVEMINPTPARD
FT                   LLVSMADWFVNRLR"
FT   gene            461553..462464
FT                   /locus_tag="Ccur_03950"
FT   CDS_pept        461553..462464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03950"
FT                   /product="putative peptidoglycan-binding domain-containing
FT                   protein"
FT                   /note="PFAM: Putative peptidoglycan binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94118"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH8"
FT                   /protein_id="ACU94118.1"
FT                   /translation="MAAMETIRKHDASAAVQDVQEKLASLGYLGTKQVTGTFDDATIAA
FT                   LKAFCKDSGFPPRDEVDDKVWALLLDATFRLGDRTLYLRMPYFHGNDVAELQQALDALG
FT                   FATSTDGMFGAHTELALRLFQMNMGLPSDGIAGSFTFRAIANLHHSWEGKPGPQAAKHV
FT                   GFARAASVLEHNALCLFGTDEFTRSVAARMSNLALATNPASKIVSAENLLVAPDNEMFL
FT                   VHIVADEAQKSDKAPFVLYESEETLPLRLAAAFAAASQVPPRLAICLPGTQWADAGVGR
FT                   SAQHYAITLLDAICSALASDAQ"
FT   gene            462502..463860
FT                   /locus_tag="Ccur_03960"
FT   CDS_pept        462502..463860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03960"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase
FT                   /glucosamine-1-phosphate N-acetyltransferase"
FT                   /note="PFAM: Bacterial transferase hexapeptide (three
FT                   repeats); Nucleotidyl transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94119"
FT                   /db_xref="GOA:C7MMH9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMH9"
FT                   /protein_id="ACU94119.1"
FT                   /translation="MDASAIILAAGAGTRMKSQRPKVLHEVLGKPLVRWVVDAAHEAGI
FT                   EDVVCVLGHGRDQVEPYVAGDTQVAVQEQRLGTADAVAAASDVLTNHQQSVLVLSGDCP
FT                   LITAETIKELARKRAEADAGVVVLTMQAPDPTGYGRIVRDAQGQIERIVEQKDCTDAEA
FT                   CITECNAGFYCFDGALLFDALGKVDSNNAQGEFYLPDVIAIARDAGRPVIGLCAADASE
FT                   CLGVNTRVQLAQASAIMRDRINERHMRAGVTMLDPSSVWIGPEVQIDTDVEILPNVMLM
FT                   GSTSVGTGTLVGPQTRLIDTQVGRNCTIDETIAYETCIDDGCVCGPRAYLRPGTHLCEG
FT                   AKVGTHVEIKKSTIGAHSKVPHLSYMGDTTMGKGVNIGAGSITCNYDGEKKWPTEIGDG
FT                   AFIGSDTMMVAPVKIGAHSLVGAGSVITEDVPEDALALARARQVVKPHWKASH"
FT   gene            463969..464934
FT                   /locus_tag="Ccur_03970"
FT   CDS_pept        463969..464934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03970"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94120"
FT                   /db_xref="GOA:C7MMI0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI0"
FT                   /protein_id="ACU94120.1"
FT                   /translation="MALNTEMKKRMAIFSGTVNPDLASEIAGELGTTLGNVRIEKFANG
FT                   EIYARYQESVRGADVFIIQSIAGEHINDALMELLIMIDAAKRASARSISAVVTHYGYAR
FT                   QERKAASREPITAKLVADLISVAGATNMIALDLHQDAIQGFFNIPVNHMTAMSIFADYF
FT                   KHKGFNPDELCVVSPDVGRAKAAKKFQTMIDSDIAIMHKDRPRHNQSEITALIGDVEDK
FT                   ICIINDDMIDTGGSLVAAAETLKAKGAREVYACATHGLFSGPAYDRIENSSIEEVVVTN
FT                   AVPVPLDRQTGKIRVVSVAPLFAKTIKNVYECGSVSALFE"
FT   gene            464941..465498
FT                   /locus_tag="Ccur_03980"
FT   CDS_pept        464941..465498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03980"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="PFAM: Peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94121"
FT                   /db_xref="GOA:C7MMI1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI1"
FT                   /protein_id="ACU94121.1"
FT                   /translation="MYLIVGLGNPGEEYEHTRHNAGFDTIDILADEAGARYWKNECGAL
FT                   SARGVLANEEVVLAKPQSYMNTSGGPVKQLCNTYGIAPDNLIVIHDDLDIAPGRIRVKF
FT                   GGGHAGHNGLRSICDKLGTRDWFRVRCGIGRPPGRMSVSDYVLSRPRHEAQDDFQVGCA
FT                   TAAEAVSFLIRNGLEKTQQEFN"
FT   gene            465769..467604
FT                   /locus_tag="Ccur_03990"
FT   CDS_pept        465769..467604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94122"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI2"
FT                   /protein_id="ACU94122.1"
FT                   /translation="MKDFTINSCARANAQAQNALSIERARKRTTLPAKVVAVALTATLA
FT                   LGSTPALVYAATTQADATTTASSTSTTSSAPGTGDVAPSMPSDGAQGAGAPPSGGGPGG
FT                   GADTMSFDYTGSYTGTLTADGTAVTSSGESIAATDADVNAVLAENGGTLTLEGSTLSKS
FT                   GDDTNGDNCNFYGLNSVLLSVGEDSTAYASNANLSATSEGSNGIFATDSGTVYASGGSI
FT                   STTAGNSRGLDATYDGTIVADGIYITTQGDHSAGIATDRGGGNISANDMTISTAGSGSP
FT                   VLYSTGDIEVDNVKGSASGSQIAGMEGLNSIMISNSTLSSTITKATASDPVADGVIIYQ
FT                   STSGDAESTTGERALFQATDSTLSSAIESGAMFYVTNTSADVVLSNTTLDFDSSAANLL
FT                   LAAGNDSNNWGSAGSNGATLSFTGIGETMSGAIQADTISQANVYLLDSTNWTGAASIVD
FT                   NANATSTKDDNLTINVDATSTWTVTADSTVSNLNVVSGGKVVDTAGKTVSIVDASGTTL
FT                   VSGDSDITVVVTGSYGTTVETSDASSVRSANIDRGAFDAYFKTGFSQTTGTNTGVPTTT
FT                   VSADTNAASAQSAFTSDDAGNNPLIVFWNWLASVF"
FT   gene            467884..471288
FT                   /locus_tag="Ccur_04000"
FT   CDS_pept        467884..471288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04000"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="PFAM: DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; DHHA1 domain; DHH family; TIGRFAM:
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94123"
FT                   /db_xref="GOA:C7MMI3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI3"
FT                   /protein_id="ACU94123.1"
FT                   /translation="MCDNRAEKQETNRKGCTVPAQFYIHEADPAATEVLCKTLGLPRFI
FT                   AATLVARGISSPQEAGEFLRPSLARDWGNPYCIPGMDEVVGGLEAAVRSGKRIMVFGDF
FT                   DLDGISSTAVLTRGLRELGGEVVPFIPRRQDEGYGITEAAIERLMKDEPDLLVTVDCGI
FT                   ACRNEVRLLKNRGVDVFITDHHEPADLVPEEVPVCDPKIDPDCSESILAGVGVALKLIQ
FT                   ALGARFGQPHLWREYTDLATLGTIADLMPMQQDNRALVADGVAHMNESPRPCIAALLHS
FT                   AGVADKPVSSTSLSFSVIPRLNAAGRMGDAMLALNLLLEDDAHRAQDIAADLEAVNSQR
FT                   RAIEAELAEIATLQAQEIYQGQRALIVAGEGWHEGVKGIVASRLARSYGVPTILFAIDE
FT                   EGIARGSGRSVGSVNLFKAVESCSDMLIRFGGHEAAVGVTLSAADLPAFTKRLCAFMDG
FT                   LDKNCFHPRIDIDACVNLDELTVENVEALEQLAPFGQGNRQPTYLAQNVMLTRSRAVGA
FT                   DKNHFSTVLTDGAHTVSGIMFHCAYIDRLMHCDSVVNAGFEVQVDEWRGRRSVKAMLSS
FT                   IYPAQPCVALESMLDPEQKSFVSELYAASDAELVADCEDAPEEVTRLDAEREQNRQHWE
FT                   QVAAQDPQSLREAVVQALIGDGALFNSQKQILSALDNNIDTLAVMATGRGKSLTFQVHA
FT                   ATRALASGQASLFVYPLRALIADQAYHLNHALLPFGLNAEVLTGESAPEERQRIFEGLV
FT                   QGTVDIVLTTPEFLTIHANRLAQSGRIGFLVVDEAHHIGQARAGNRMAYAYIDRAIARL
FT                   GNPCVLALTATADAQCAQAIEETLGCHHRVLDRTERKNLVLDDQRNLKQSDPYLANLVS
FT                   QGAKMVIYVNSRRHSVALARSLRKRVPQMAPFIGFYNAGLARPDRCRVEELFRTGQLTV
FT                   LVSTSAFGEGVNIPDIRHVVLYHMPFNEIEFNQMSGRAGRDGKEAVVHLLFSVTDARIN
FT                   EGILADATPNHDTLAQVYRELKRLSAEADGSPLRVSDADLAQICSDRQPALRMSQDSVA
FT                   CAIAVFRELGLVETEVSATQGEHRLIRLIEAHGNKAELTDSVRYREGLDEIEIFRTFCH
FT                   WVGSATAPVLQSRIIRPILPDESQEEV"
FT   gene            471291..473861
FT                   /locus_tag="Ccur_04010"
FT   CDS_pept        471291..473861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04010"
FT                   /product="(p)ppGpp synthetase, RelA/SpoT family"
FT                   /EC_number="2.7.6.5"
FT                   /note="PFAM: Region found in RelA / SpoT proteins; HD
FT                   domain; ACT domain; TGS domain; TIGRFAM: (p)ppGpp
FT                   synthetase, RelA/SpoT family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94124"
FT                   /db_xref="GOA:C7MMI4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI4"
FT                   /protein_id="ACU94124.1"
FT                   /translation="MPQKSRSQKNVSQKDTSQKSMPQKSQENAPRNDASQKNVSQESMS
FT                   QKSSKSASHNDTKQVDFLGSSRDVVGGGARFSDGSDALIGRAGSAALTFKGDAAAADPA
FT                   PMPHHKTPEERFADLDEACAVYLNEDERDLLRRAFEFARSAHKGQCRKSGEPFVSHPVE
FT                   VALILSDLRMDAETLAAALLHDVVEDTDTTKEELAHEFGEAVADLVDGVTKITRIEVEN
FT                   LSDEQAATIRKMFVAMNKDIRVIVIKLADRLHNMRTLSALREDRRIFKSHETLEIYAPI
FT                   AHRLGIGQIKWELEDLAFFYLEPGKFKQISRMVAESRMEREEYLGNVIDILHGEMEKAD
FT                   IGCQIMGRPKHLYSIYRKMTTHGKGFSEIYDLIAVRIIVDTVAQCYSALGAVHSLWHPM
FT                   PGRFKDYIAMPKYNMYQSLHTTVIGPAGRPLEVQIRTEEMHRMSEYGVAAHWRYKEGAK
FT                   GESGFDRQLAWLRQMMDWQDETQDSREFLKSLKVDLAPSEVFVFTPQGDAMSLRAGATP
FT                   VDFAYAIHTEVGNHCVGAKVNGSIVPLSYELQMGDRVEILTQKSAAPSQGWLSLVKTPR
FT                   ARSKIRAYFSRASHSDDVREGHERLTREMRKHGSGISSAAGQRALKTVSERMGFKDPDE
FT                   MLASVGTGKESVQAITNRLLKALGEKDAAPTPSADLVPGDSSTGKLPPMLTSVRHPKTA
FT                   KQHPVSKGVRVKGDPGMLVRLSRCCNPVPGDDIVGFVTRGRGVSVHRRNCPNAASLMDH
FT                   PERIIDVTWDSEPSADTSYKVEIYLEAIDRMNLLRDVVDSLSECGANVLSSSTTSHRDG
FT                   MGEMRFLFQVSSVSSIDHIVQKLSGIEGVFDVHRMMPGDEKKKK"
FT   gene            473871..474539
FT                   /locus_tag="Ccur_04020"
FT   CDS_pept        473871..474539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04020"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94125"
FT                   /db_xref="GOA:C7MMI5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI5"
FT                   /protein_id="ACU94125.1"
FT                   /translation="MARFDDLHEVKGGCVPISFLVLGPIENNVYLIDDGAGGVIVVDPS
FT                   CEPDLIMDALAGRPISALFVTHQHWDHVGALRALVDRTGAAVYASRIDAPTIESGQADR
FT                   HSPERIPPCRVDHKLSDGESVTVGMLTWRCILTPGHTKGSMCLLAETGTRPGSPVLISG
FT                   DTLFQASIGRVDFEGGSMTDMRASLRKLSKLPDDTIVLPGHMGTTTIGAERHRVIEALM
FT                   "
FT   gene            474706..475758
FT                   /locus_tag="Ccur_04030"
FT   CDS_pept        474706..475758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04030"
FT                   /product="phosphate/sulfate permease"
FT                   /note="PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94126"
FT                   /db_xref="GOA:C7MMI6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI6"
FT                   /protein_id="ACU94126.1"
FT                   /translation="MSIELGVFLSTLVSNPAMLVVAVLNIGVLIVNGATDAPNAIATVV
FT                   STRCLKPTPAIVMAACCNFLGLLIVTLLSSAVAETIFHMVDFSGDSHQALVALMAAMVA
FT                   IIVWGVSAWYFGLPTSQSHSLIAGLTGAAIALQGGFDGVNWDEWMKVIYGIVLSTFLGF
FT                   GLGWLNAKAIRRFCSGFDRQRADAFFRWAQVIAGAAGAFMHGAQDGQKFMSIFMLASLL
FT                   AAGADLPSTITIPIWLMVVCALSLGTGTGLGGKKIIKNVGMDMVKLERYQGFCVSLAST
FT                   FCLIISTFGGLPVSSTHTNTTAIMGVGRAKCKSAVHWGVAVDMVKTWILTFPGCGILGY
FT                   VTALLFLAIF"
FT   gene            475775..476404
FT                   /locus_tag="Ccur_04040"
FT   CDS_pept        475775..476404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04040"
FT                   /product="phosphate transport regulator related to PhoU"
FT                   /note="PFAM: Protein of unknown function DUF47; TIGRFAM:
FT                   conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94127"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI7"
FT                   /protein_id="ACU94127.1"
FT                   /translation="MPRKMKYDYFKAFESQVDIALAEADLLITVIRDFTTAEAVKDILP
FT                   EAHDLEHRGDTINHNIYTALATDFITPIDRDDILQIAQALDNVIDYIEDVIRMFYVMDV
FT                   HFMHRDLEQVGILIKKSCEALKVGMREFTNFKKSATFKRVLVEVNDYEEEADRLYDEMT
FT                   HNLYTKDADNPLRVIVWSRIFAKIEKCSDACEHVADIMGTVLLKNS"
FT   gene            complement(476489..477277)
FT                   /locus_tag="Ccur_04050"
FT   CDS_pept        complement(476489..477277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04050"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94128"
FT                   /db_xref="GOA:C7MMI8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI8"
FT                   /protein_id="ACU94128.1"
FT                   /translation="MLESVLVVPFWFEMIATITGAISGSMSAQRAQFDLFGTVVIAIIM
FT                   GLLGGIMRDILLQNYGIYAFQKPELIVACVLTGCVVFYFGRITTYLNPVIDIIDGLSVG
FT                   MWAVLSAGKALAAGLSIVPAVILGTVVSIGGGVMRDIIMNRPVTAFQPGSLYGTAAVLG
FT                   TIVYTLMRTYHIFDGASAIICLVIIMCIRFGSMAFGWHTRPARDLSEPVADVMARPVRA
FT                   IRYLNRTPENIADEKARRHHAKKIDQQSTWSKIWNRLRRH"
FT   gene            477474..478757
FT                   /locus_tag="Ccur_04060"
FT   CDS_pept        477474..478757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04060"
FT                   /product="aspartate kinase"
FT                   /note="PFAM: ACT domain; Amino acid kinase family; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94129"
FT                   /db_xref="GOA:C7MMI9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMI9"
FT                   /protein_id="ACU94129.1"
FT                   /translation="MSLIVAKFGGTSVASPERIKMVAKRLIAMKQAGNDVVAVVSAMGK
FT                   TTDELVGLAAALSSNPPAREMDRLLSTGEQVSMTLLSMAIDASGYRAMSFSGSQAGIET
FT                   DNEHAKAKITLIHADRIKSAIAQGIIPVVAGFQGIDKRGDVTTLGRGGSDTTAVAVAYG
FT                   IGADVCEIYSDVDGIYTADPRVAPRARKLDAISYEDMLELSSSGAGVLQSRAVEFARRY
FT                   GVVIHSRSAFSDAQGTLIKEADSTMEQAVVSGIAHDTSEVKVTIRDVQDHSGVAAQVFQ
FT                   ALASNSVNVDMIIQNISEEGVTDITFTCPGADLPRARTVMESLLAPLGAREYAVDESIA
FT                   KVSIVGTGMKSSPGVAARAFQALGDSNVNILLISTSPIRLSVVIDALQVEQAVRCLHAA
FT                   FGLDSDTVFEEKMLSAEELAAKKNKGRS"
FT   gene            478866..480521
FT                   /locus_tag="Ccur_04070"
FT   CDS_pept        478866..480521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04070"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94130"
FT                   /db_xref="GOA:C7MMJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ0"
FT                   /protein_id="ACU94130.1"
FT                   /translation="MMRLRISQTVGILLVVCAALCVLVFSVYPLAALFSRSLAGDFVTR
FT                   FTQTLGDSGPLVIQSAQVGIAVAVASTVLALIVAICASFSSRGMRRAVLGAALASIVSP
FT                   PFLASLAYIELFGRRGLITHGLLGLSISPYGFIGVVIMQSVFFSAINVMLLLSALKGID
FT                   PAVINASRDAGASPLRTLVCIVIPLIKHSIAACLLLTFIRSLADYGTPIVIGGGLETIA
FT                   TAIYEQVVGYSDLESAAVLGVLLCLISMVVYAIYGRLIVRSRGASGLSGAAVDLLGDTT
FT                   FSSLRLRGVLGISVRVVGILFVLFMIVQYGTIAHAALTRGVGWNAPFTLANIQHLISFD
FT                   AGSLILSIEYALAAAVLSIILGALIAYMRTLFAHPASPVGRLTSVLEFAATMPYMLPGT
FT                   CLGLGLILAFNATPLKLTGTGAIIVFALAIKQLAVSIQSFSGAFSQFDANLERAARDLG
FT                   ASRLEAIRDTVLPVSRRAFMVAFANAFSTAMVSYSVVLFLVVPGNKTAIFELFDALSSG
FT                   KYGQAAAISLAITLVVLVVNAVVFLLFGRKKERS"
FT   gene            480521..481471
FT                   /locus_tag="Ccur_04080"
FT   CDS_pept        480521..481471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04080"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.30"
FT                   /note="PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94131"
FT                   /db_xref="GOA:C7MMJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ1"
FT                   /protein_id="ACU94131.1"
FT                   /translation="MSVMEFKNITAGYGGHTVLDNFSLAIDKGELICLIGPSGCGKTTA
FT                   LRLAGGYLQPKQGQVFIDGVDVTSRPPERRPVSTVFQSYALFPHMTVARNVEYGLRFQG
FT                   FAAHERHDRALEMLQAMHMDDRADAYPAELSGGQQQRVALARSLVLKPQVLLLDEPLSN
FT                   LDEGLRFEMREEIKAVQREFGVAMLLVTHDREEAMALGDRIALVHDGHIAQEGNPAHVY
FT                   DHPSNEYCARFLGWVNVLNSCDSPRYFRVEAVRLGAEGAYTGSVERAIFLGSSWEYFID
FT                   VDGQKVRARGDRSMLLNEGDAVSFNITSLLNWKEE"
FT   gene            481475..482578
FT                   /locus_tag="Ccur_04090"
FT   CDS_pept        481475..482578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04090"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94132"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ2"
FT                   /protein_id="ACU94132.1"
FT                   /translation="MQDAKTLTRRGFVTLSAAAVSAAFLGGCSSGSGNGSSSESSQEGA
FT                   TKLTSSSGKTMKVICTSESYKKLFDKFTSEVGAPVEFVSMSSGEALSKLKAEGGTPAAD
FT                   LWFGGGVDSFMSAKDSGLLEQVNFAATSRFSADFKDPDNYWFSKGATVVGFIVNNDILG
FT                   EIGAQAPASWADLTNAAYRNEILMSTPAVSGTNYAAVDALLQNLGDDAGWEYFSQLNEN
FT                   IPFYTKRGSDPSTRVGAGEAAIGITYIDGTLDELISGGNLELVYPSEGLPYMPDGVAAF
FT                   KNADDVEDAKLFIEWLFSNDENMRFLAEIDKKSTILLCIPDVDGIEATFDASQLMKEDV
FT                   SLFGPQREDVLAKWKDMTSSKDVVSSS"
FT   gene            482846..483886
FT                   /locus_tag="Ccur_04100"
FT   CDS_pept        482846..483886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04100"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="PFAM: Semialdehyde dehydrogenase, dimerisation
FT                   domain; Semialdehyde dehydrogenase, NAD binding domain;
FT                   TIGRFAM: aspartate-semialdehyde dehydrogenase
FT                   (peptidoglycan organisms)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94133"
FT                   /db_xref="GOA:C7MMJ3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ3"
FT                   /protein_id="ACU94133.1"
FT                   /translation="MAWTKQMPARPVVAVCGATGAVGQEFLTVLHDLDFPAAQVKALAS
FT                   ARSAGKKIAFGGCGNQPAGDLTVEEMTPESFTGVDIALFSAGSNVSKQLRDAVTAAGAV
FT                   MIDNSSAFRMDAGVPLVIPEVNPQDAYQHEGVIANPNCSTIEMAVALAPLSRVVSIKRV
FT                   VVSTYQAASGAGLPAMHELREQTRQMLAGEEPQAQEFAHPLAFNCIPRIDVMREDGYSK
FT                   EEWKMIAETRKIMHAPEIGITATCVRVPVMRCHGESLNVEFAAPISLDEAYAAWEAAPG
FT                   IEVLDQPDEDIYPMPGVLAGTDPVYVGRVRRDATVENGLAFWLVMDQIRKGAALNAVQI
FT                   AQLLLP"
FT   gene            complement(483868..485418)
FT                   /locus_tag="Ccur_04110"
FT   CDS_pept        complement(483868..485418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04110"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: HAMP domain; His Kinase A (phosphoacceptor)
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94134"
FT                   /db_xref="GOA:C7MMJ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ4"
FT                   /protein_id="ACU94134.1"
FT                   /translation="MARLESQQPPHPEQADQPHHLRIPLALVIGRYFFYLLVGSLIVIG
FT                   APLAALTGQMRSGSIVPANYGEVHLDDVAKTLSTQPTFNADAIPSAYRYALFTSTDSIA
FT                   LSDMNASQIEFARTVTASPNEKDAQVVVEQQRFFYTAINLPDGRRCVLCYNLTPQWADK
FT                   NLRDTLPNPQDMMFWSFGALAVLIVLIAMRASNVIKRKMNPLVEAAQAVGRQDLNTATG
FT                   RSNVAQIDDVLRAMDEMRISLKQSLEAQWESEQRTREQVAALAHDLKTPLTVVRGNADM
FT                   LIEDATAGALDIDQAQSAQAIQTAALSMDSFVSQIVEASHSGAGTLQFKPTNPSKLADQ
FT                   LEQEAKALVEARGFTLDTARSSSFTDACCQTATSTDTRAQWDARALERAVLNLVDNACA
FT                   YASHSVVRLVFSFDATVHTFFITVENDGSGFSPEALVHGTERFYRDDASRTGSHTTGNV
FT                   ESTHFGLGLAIASDIAHAHGGTLNLSNQLAGNGTIQGARATIVLPEIIKRDEHYGKSN"
FT   gene            complement(485406..486068)
FT                   /locus_tag="Ccur_04120"
FT   CDS_pept        complement(485406..486068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04120"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94135"
FT                   /db_xref="GOA:C7MMJ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ5"
FT                   /protein_id="ACU94135.1"
FT                   /translation="MARLLVVDDESAITDLLQRILVRDGYSVDAFNDPTAVLSCDLSRY
FT                   DLIICDVMMPEIDGFELVERIRDHVDAPILFLTAKVGESDAVQGLAIGADDYIRKPFGT
FT                   AELRAKVAAHLRRENRVYTHAFTLGAVRFDMGARELFVNDALVALTPTEYAICEYLAQH
FT                   PGQVFSRQQIRKQVLGWASDAGDDAISMHVSNARTKLKRAGATSIETVWGTGYKWHA"
FT   gene            complement(486130..486936)
FT                   /locus_tag="Ccur_04130"
FT   CDS_pept        complement(486130..486936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94136"
FT                   /db_xref="GOA:C7MMJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ6"
FT                   /protein_id="ACU94136.1"
FT                   /translation="MTFVRALKAQMLCLRHSALVPLHLVCALVAGLACGLYFAVSPWNI
FT                   TLGFDAFVQLLGALMPLMAGIVCGLDVNAEEEATKLSGLLSAVSRQQALFARIALLWLM
FT                   GVGTLAVTIVIFALVLLVAARDVPEVSVWLAGIGGLALGSIPLYLMLYTTALQWGRNAA
FT                   ISIGALGLILAFFSVGGLAYGLMTGELTATALNMFAYLPTSWAIILGSAPIEWAVAAGA
FT                   ASFTDTLDAVISTVQLMMGLCMIGSALFAGSMAIWISRFEPTQRGE"
FT   gene            complement(487026..487847)
FT                   /locus_tag="Ccur_04140"
FT   CDS_pept        complement(487026..487847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04140"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94137"
FT                   /db_xref="GOA:C7MMJ7"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ7"
FT                   /protein_id="ACU94137.1"
FT                   /translation="MKWQHKTNQNNQVNQATYRRGSFLVALRAEMMKSRHGTPVKLACA
FT                   LTLPFLLMATLMTVRAPELGLQYSPWNYWYALLMPVSITLVATTIAKADARLGNRAILS
FT                   SGMPLERIWVAKCTWCLILSLVSNLIVFVIYTVLSLVLPQGAASLPSMFATALALTLVS
FT                   SWIIPATLFLTMRVGTLSGIFIPLAAQLLLSFSWSLVPLWPVCPPTATIVLPTAFLPVL
FT                   PTGEPASDGLALVESIAQTGNVVLALIVAGVVTALIAVAGAAWLARSEELR"
FT   gene            complement(487844..488566)
FT                   /locus_tag="Ccur_04150"
FT   CDS_pept        complement(487844..488566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04150"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94138"
FT                   /db_xref="GOA:C7MMJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ8"
FT                   /protein_id="ACU94138.1"
FT                   /translation="MAKYILETQKLVKRFGCGKRAQQAVDELSLHVEEGKVYGLLGPNG
FT                   AGKSTTLKMITGMLHPTEGRILFEGHPWQRDDLYRIGSLVESAPLYPNLTAKENLRVRT
FT                   TLLGLPHSRIDEVLATVDLTDTGSKRAGRFSMGMKQRLGIALALLAHPRLLILDEPTNG
FT                   LDPIGIEDLRNLIRRFPEQGITVLLSSHILTEVQHTADTVGIIVNGRLAYEDDLHKDED
FT                   LEALFMNVYKKGTRGDVQ"
FT   gene            complement(488703..489722)
FT                   /locus_tag="Ccur_04160"
FT   CDS_pept        complement(488703..489722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04160"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94139"
FT                   /db_xref="GOA:C7MMJ9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMJ9"
FT                   /protein_id="ACU94139.1"
FT                   /translation="MHPIGEAAIVITVTALLALGLYYSITRRGHLREDAQTARTRLAKL
FT                   RRPKALATKQPVGEEDALFIRFNTQFGLMLVYTIEYRPGDFARVMDVQGAFQSATYLED
FT                   GRIYELVFDYLKLYNHLFEAPFPIKSLLTIGGGGYAWPKYVIAHHPETSVDVIEADEAV
FT                   TRIAERYFFLDRLIEEFDVIDTGRMGIITEDGRTYLDEYADAVIHKRPSQYAAIGDYAP
FT                   ACTYDAVVNDTFAGRDAVMNLASVEAAQHIKQLLTPGGMYLSNVISSLEGEQSTLLRQM
FT                   VATLQQVFAFVYVIPCGKYAAQDRDNNLLIASDRAYHFEHAYDLQADPATPILHDANL"
FT   gene            complement(489913..492768)
FT                   /locus_tag="Ccur_04170"
FT   CDS_pept        complement(489913..492768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04170"
FT                   /product="polyphosphate kinase"
FT                   /note="PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94140"
FT                   /db_xref="GOA:C7MMK0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK0"
FT                   /protein_id="ACU94140.1"
FT                   /translation="MNRKAATNQTDEMVSSPKESASLQQNATSEKTPHGHKSNGKGRHE
FT                   RMPFMQNRELSWLTFDERVLEQGSDDTVPLLERLQFISIFSSNLQEFFMVRVGSLTDLS
FT                   LLKTQVIDTKSNMTPDEQLDAIYARCHELYPVQERIYSEVKHQLADEGIRRLTFDELNE
FT                   EQREFALDYLRSNVLPFLMPQIINARHPFPHLGNGELYIIVRLSEETPKKADLTSEERK
FT                   RVKELRRQVKSLGAEGVTLGVVGLPRNAERIIKLPGEGFNFILLEDLLEANVASIYSMY
FT                   TVKHANIICVTRNADLDAADTADEGEEDYREHMKKILKKRARLAPVRLESKRKLSATVG
FT                   SFLLSRLHLAPHQVFTTEVPLNLGYAFALPSMVDPVVRARLTSEPFSPAWPACLSHSER
FT                   IIDQIQQRSVILSYPYESMDPFVQLLREAAEDPDVVSIKITLYRLASRSHLAEALITAA
FT                   EAGKEVTALFELRARFDESNNIQWSQRFEEAGARVLYGFHDYKVHSKICCITRQTPQGL
FT                   QHITQLGTGNYNEKTARLYTDFSYITVDDAIGRDAIEFFRNMGLESASRAYHTIWVAPL
FT                   QIKQNILKGIDGQIAHARQGEPCGLLFKTNSITDREVLEKISEASQAGVPITLIVRGIS
FT                   CLLPGIPNATENVRVVSIVGRLLEHSRIYAFGPLDEATIYLSSADLMTRNMDNRIEIAW
FT                   PIRDKHIHDAVVDYVHVCLRDTAKLRELRADGTYTPLRALVQAGTEPFNSHEYLIEKAR
FT                   IASDAAREAELAAKPDHERIAMHAHYSRQSAARERRAMRDLEEIYREALQHEIGGTEGE
FT                   ALTSFMRAAAKVFAEIEAESAERTEILEEQAENGNDSAAFVSDSDPATKSEPVTEAEST
FT                   DTSKSAESGTTAGRAQDASTLDATLAALSSAPRSANAQDQAVTDAQTTSRTATDTAATA
FT                   TFAAQTRQHGFFWRLFHRKKR"
FT   gene            493179..495008
FT                   /locus_tag="Ccur_04180"
FT   CDS_pept        493179..495008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04180"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Polyphosphate kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94141"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK1"
FT                   /protein_id="ACU94141.1"
FT                   /translation="MLERIDFDCIPIDRDEYKPARDELVKRLVLLQQEAHIRGIGLVVL
FT                   FEGWDGAGKGGRISDLMYNLDARSTTVHVDDSQHEKDARKLHARGLSTDGYFPMMQPYW
FT                   NSLGPRGNMTLYDRGWYNAAAAHLAEEITPSSKRKRIPGALTGPSPMERSLASIESFER
FT                   QLVNDGYLVVKFFLHIRKKTQRKRLEGLAADPATAWRVDKQALAAIGDYDRYCKLYDKL
FT                   LSRTNYDFAPWVVLNGEDKRRANLGVVRTLVDALDQAIAAADAPVGSFSVSDVSAGSTV
FT                   STGMPVDTSDPAGASENGSVSAGAPVGSTTSSNSADVLEDAHALVDSTETEEELAWDTQ
FT                   DVDVRQEAEAQAAKQASFAPSTSRFPISNSHPTLKGVDYHLRFDPARYKTELKAEQKRL
FT                   YRLELEMYKQRVPLILMYEGQDAAGKGGNIKRIAQALDARSYTIFPSPAPTKPELAHPF
FT                   LWRYWTRLPKAGHVGIYDRSWYGRVLVERVEGFARPDEWARAYDEINEFERDLVDWGAI
FT                   LLKFWVEIDRDEQLRRFESRAEDPARQWKITDEDWRNRAKYPQYREAVEDMFRLTSTDF
FT                   APWIILESNDKRYARIKALRIINNALEERLQRR"
FT   gene            495010..495858
FT                   /locus_tag="Ccur_04190"
FT   CDS_pept        495010..495858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04190"
FT                   /product="sortase, SrtB family"
FT                   /note="PFAM: Sortase family; TIGRFAM: sortase, SrtB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94142"
FT                   /db_xref="GOA:C7MMK2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK2"
FT                   /protein_id="ACU94142.1"
FT                   /translation="MKHAAHAAIAPAAPKAKKPRRRLLWRIIFWLALIVFIGSAGVLGF
FT                   YLYSYWSADRGYQDIAAQALTSVSAQDMPADADATELADMTVDWDYLRSLNPDIVAWVV
FT                   IPDTRVNYPVVQGHDNEEYLHKDFSQKEDFGARGGAIFLEASNSPDFSDENNVLYGHHM
FT                   RDGSMFACLSKDFVNGDFFDAHRTFYVLTPEKNYKLQAFSLVLTNGWDEIVQTRFGTDD
FT                   QRSAYIKDKEQRSVVAPAGGMPDPASITQLFTLSTCDYQETNGRAVLFSSVVDTVTPSN
FT                   A"
FT   gene            495920..497410
FT                   /locus_tag="Ccur_04200"
FT   CDS_pept        495920..497410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04200"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="PFAM: Glutamine amidotransferases class-II;
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94143"
FT                   /db_xref="GOA:C7MMK3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK3"
FT                   /protein_id="ACU94143.1"
FT                   /translation="MGDSVMPSERPDRLEEACAVFGVYAPGEDVARLTCFGLQALQHRG
FT                   QESAGIAVGGNGTVVAYKDLGLVTQVFNESTLSALQGDVAVGHCRYSTAGGGGWESAQP
FT                   HLSAIDDVLIALAHNGTLVNTTRIRAQLVGQGVQLYSNTDSEVAAKVIGAETSRTHHLR
FT                   EGIRAMMCLLEGAYAMVLASPDALYAFRDPNGIRPLCIGRLDNGGWVVSSESCGLDIVG
FT                   ATYLRDVEPGEIVRFSAEGMASEQGVPAGPRASCIFEYVYFARPDSVLDGQNVYTARRE
FT                   MGRILAAEAPIDADLVLGVPDSGLPPALGFAEASGIPYADGIVKNRYVGRSFIQPTQAM
FT                   RQNAIRIKLNPLPQVIAGKRLVVIDDSIVRGNTSRKLVEMLKAAGAVEVHLRIVSPEVE
FT                   WPCFFGIDTDTQDQLIAANMNNQQMCESIGCDSLAFISLEGLHRAVTADHPGFCDACFS
FT                   GNYVIDIPDSLQETGFFERNRVTSYAGGAPRSNTTTEG"
FT   gene            497486..498721
FT                   /locus_tag="Ccur_04210"
FT   CDS_pept        497486..498721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04210"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="PFAM: AIR synthase related protein, C-terminal
FT                   domain; AIR synthase related protein, N-terminal domain;
FT                   TIGRFAM: phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94144"
FT                   /db_xref="GOA:C7MMK4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK4"
FT                   /protein_id="ACU94144.1"
FT                   /translation="MTDRITVSAASADDAPAMPSWVGQDSVTYAQAGVDTAEGARAVDA
FT                   IKQSVQSTRRPEVIGDIGGFGGLFSIAAAKDMDDPILVSGTDGVGTKLQVAKMAGKHDT
FT                   VGIDLVAMCVNDILATGAEPLFFLDYIAVGKLKSEAVAEIVGGIAEGCRQAGCALIGGE
FT                   MAEHPGVMDPEEYDLSGFSVGVVDRARMLDPENVTEGDVLLGLASSGLHSNGYSLARKV
FT                   CLEGRTHYEVRLPQSLLGGESVQDALLEPTRIYVKSVHTALTNHPHAVHALAHITGGGI
FT                   TENLNRALPSHLDAQVDIGSWTMKPIIPFVCRAAKLSESEALKTFNMGLGLVLIVDAAA
FT                   VDSVEHTLQEAGEEVFRVGHVVAGSGAVRYTNEGALLHDVLVEEEEENQPVTPIEQRTQ
FT                   ERDVFYEEEESD"
FT   gene            498725..499363
FT                   /locus_tag="Ccur_04220"
FT   CDS_pept        498725..499363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04220"
FT                   /product="phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /note="PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94145"
FT                   /db_xref="GOA:C7MMK5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK5"
FT                   /protein_id="ACU94145.1"
FT                   /translation="MNRSPASSAPLKIGVLISGSGTNLQAIIDAIEQENLAAEVVMVLS
FT                   SRPDAYGLKRAADAGIPTVSLNRDVYADRAVADAAIVTTFKQAGAEYLIMAGYMRIIGP
FT                   IVLNEYPNRVLNVHPALLPAFPGAHAIDDAWQAGVKVTGVTVHFANALYDQGPIIAQRA
FT                   VPIHEDDTREALEARIHEVEHELYPWVIARLAAGDISIDPEGKVHIAHA"
FT   gene            499356..500342
FT                   /locus_tag="Ccur_04230"
FT   CDS_pept        499356..500342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94146"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK6"
FT                   /protein_id="ACU94146.1"
FT                   /translation="MHKETVRRIISDLNAGRPPQFPLDDFPCFSAEATEGNPHITPASA
FT                   SVIAQSLTVADIPVFERALLAIDAAEQAWIGFKIVFDATEATRNKDNAVTREYGAQGSA
FT                   DGQSGVFFCNEAREIVFSRTPSPRDVFQMKDVTRGPSMHTEQFPGLTWCSVALFAPVQV
FT                   WLIGASDVAAEVATLAGHVGFSVTVIDDDATYLNADRFPQARRLLLENFDDLANLSAAP
FT                   KDYVCVLTRGHMHDPEGCLWAQRANVHYTGMMGCAGKNSRVADLCRQAGMTEAQWERIK
FT                   RPIGLKFGAKTPAELAIAIVAELVDVRYRERYSEQEIRQHESDLGRN"
FT   gene            500345..502045
FT                   /locus_tag="Ccur_04240"
FT   CDS_pept        500345..502045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04240"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="PFAM: MGS-like domain; AICARFT/IMPCHase bienzyme;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94147"
FT                   /db_xref="GOA:C7MMK7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK7"
FT                   /protein_id="ACU94147.1"
FT                   /translation="MESPQIRRVLISVTDKTGVIDFARALSGEFGAQIISTGGTARTLS
FT                   EAGVPVTSIEDVTGFPEMMDGRVKTLHPSVHGGLLARRDNPQHLNDAAHQGIEMIDMVV
FT                   VNLYAFEKTVTQGADFAECIEHIDIGGPSMLRSAAKNFESVTVVTNPFSYKHILAEMRE
FT                   TGGTTTRATRFVLAREAFRLTGAYDTAITDWLTNQMPENVDSSKFLSAAWVETEGIEAS
FT                   QTGNEVTAGEMSAREVATGGDVVYEEEWPQQLNLSYSRVQILRYGENPHQAAAFYRLPD
FT                   APSHSLAHAEQLGGKPLSYNNLLDADACWTIVCGLNETAVVILKHQNPCGSACADTVGE
FT                   AFERAFACDEKSAYGGIIAANRMVTADMVARINAHKLFMEVLIAPDYEPAALELLQQKK
FT                   NLRILRTGGTDVFDATRQELRSIDGGLLVQTIDTVSEDPATFTIPTKRKPTAAELDDLL
FT                   FAWKVCKGVKSNAILVAKNKAGIGMGPGQPNRVDSARIACQRAGVACKGAVAASDAFFP
FT                   FRDGVDTLAEQGITAIIQPGGSIHDDEAIQAADEAGITMVFTGHRHFRH"
FT   gene            complement(502207..503055)
FT                   /locus_tag="Ccur_04250"
FT   CDS_pept        complement(502207..503055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04250"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain protein"
FT                   /note="PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94148"
FT                   /db_xref="GOA:C7MMK8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK8"
FT                   /protein_id="ACU94148.1"
FT                   /translation="MHAMKKSEALNILGLADGASEDDIKAAHRRKIRENHPDRFSDPTE
FT                   KQAAEERTKLINEARDVLNSGKWDPEYGPRATTYSSPYAHPSSGVPHNGDPFEGFPFTV
FT                   DYVWTSWDDIGSGQRGAANADNRQRARRGGVWGQGYANPFEGDPFFTEFTRAPRKTPQE
FT                   EEREAKADLRQTLLGCAVKLAVLALCSSLGAVAIGMFAYVVATLLLAVAREVKGCTSFL
FT                   VLPFIIFFGPLIAWFMPRLGAGIGAGLFVFFGIAVLVDISTIRRSVSTLRTAREKVKVS
FT                   S"
FT   gene            503288..504730
FT                   /locus_tag="Ccur_04260"
FT   CDS_pept        503288..504730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04260"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94149"
FT                   /db_xref="GOA:C7MMK9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMK9"
FT                   /protein_id="ACU94149.1"
FT                   /translation="MKKAIFLVLAVVAGCFLISNAETIASIYDAAQSGATIPLILACII
FT                   MVARHVTQAVSYKAAFEAVGFSGRGLWEYIVLIFSLVFINTFCLFSGATGVAFIVDDAH
FT                   RKGANLGKATSGAILSQIGYFSALLVISIIGFITMIVSDSINTVFVIGALLLAATLLVL
FT                   SSLYIIGFFQPQWLYGFFRRLAVPVGAIARKVRRPLRAQWAGDTADSFITSAQIMASNP
FT                   LGTFTSVAWASLSAVLNMLSLVAIGFAFGFENVAALIAAFALAAISVILSPTPQGIGVV
FT                   EAAIAAVLTAYGCSLPTATAIALLYRGIMFWVPFCIGAVLLSQSGFFKTKKNPTQKQRD
FT                   KDVAWISGTAVGIVGAVSIASYFVPALLAPYNALVEWIDFSNVFAGPAIVFFGVLLIVL
FT                   AAGLVRRYRTCMALTVTVLLLLASIQFLFFETITVAVVCVGLAVWIFIKRASFDKPMPP
FT                   LEDLQTLGREKIQAWSSRKNSK"
FT   gene            504744..505910
FT                   /locus_tag="Ccur_04270"
FT   CDS_pept        504744..505910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94150"
FT                   /db_xref="GOA:C7MML0"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML0"
FT                   /protein_id="ACU94150.1"
FT                   /translation="MIIVDDGHVSDRMSTYLAQSKQPVLATDASRAIASAHPGVVLVEE
FT                   DAAAKRIEEGERLYTMSEGRLSWVLEHVKNPDLHKAIEVFKNKEHMRNVLAPLYPDYFY
FT                   RACSIEELATMPFPAQAIPLVIKPSVGFLSVGVYTVRDRADWQAALDTIEQQRSQWVSW
FT                   YDEAVIGSGRFIVESLIEGAEYALDAYFDHQGTPHILNVLRHDFADAADTSDRLYVTGP
FT                   SIIRETHDEMTEFLTRVNSLTYVHDFPVHVEVRVTDAGQIIPIEFNALRFAGLGGTEIS
FT                   SFAYGFYTFDHYLNDTYPVWDDVLEQLNTDDLFCMSVLNPPVGTSSQAHMDYDALQKRF
FT                   NHVFALDRFDYAKAGIFGFLFWKTSASDDRERTFLVQSDLAEFITEDE"
FT   gene            505914..506552
FT                   /locus_tag="Ccur_04280"
FT   CDS_pept        505914..506552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94151"
FT                   /db_xref="GOA:C7MML1"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML1"
FT                   /protein_id="ACU94151.1"
FT                   /translation="MADSQQSQQSQEPQSPASQSQLTNDSSSDASLDTSSGDRVSAAVT
FT                   PDSSVSDSASSEIDTAYSVSNEVSHNASSHQPRALKDEYASDQLDKEAPQGPKPPAGWE
FT                   SKPPAPDDPAFVPFDDFSQRTADQTGRTVMALSFACGLLFGIFGLLFILFFTIGRNQGA
FT                   RPAMLRFCAIGVIVGALIDMLVLQLMGGSIGQLSNFTLPSISTQTPSAF"
FT   gene            complement(506603..507412)
FT                   /locus_tag="Ccur_04290"
FT   CDS_pept        complement(506603..507412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04290"
FT                   /product="ABC-type Mn2+/Zn2+ transport system, permease
FT                   component"
FT                   /note="PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94152"
FT                   /db_xref="GOA:C7MML2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML2"
FT                   /protein_id="ACU94152.1"
FT                   /translation="MLEYAFMQKSLIVGLLLGIVVPLVGVNVVLRRLSMVGDALSHTSL
FT                   AGVAGGLIAGINPVLGASIACIAGAFCIEGVRMRFKDQSELAVAIVLAAGIGLAGVLSG
FT                   FVPNAASFNSFLFGSILTVTDEELIFVCIISALGIAFCTFFQRALLLSAYDETQARVTG
FT                   VNLTVLNSAFVALVALVVAIAARTVGSLMVSSMMVVPVACALQLTGGWKRVCVASSLIG
FT                   VISSLVGLTLSFYLGLKPGGTIVLVSIAFLLIVLVAKAVRNLAKRHS"
FT   gene            complement(507416..508120)
FT                   /locus_tag="Ccur_04300"
FT   CDS_pept        complement(507416..508120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04300"
FT                   /product="ATPase component of Mn/Zn ABC-type transporter"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94153"
FT                   /db_xref="GOA:C7MML3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML3"
FT                   /protein_id="ACU94153.1"
FT                   /translation="MSDSRDEKTPIRLHAVSYALGGQVIIDRVNFSLGQGNIIALTGEN
FT                   GSGKSTLCRIVMGSLVPDAGEAFLFGTNARHFKDWKRIGYVQQLPPAAVLRHPATALEI
FT                   VQASCPRTTSLPSHTTAKEHALYWLAEVGMQAQAHQVIGSLSGGQLQRVRLAAALTCDP
FT                   DLLVLDEPTTGLDAQSTEAFCTLIQTLRASRQLSILLVTHDRTTAQALDAQIVRLENGC
FT                   LHAEADAEDKKG"
FT   gene            complement(508120..509169)
FT                   /locus_tag="Ccur_04310"
FT   CDS_pept        complement(508120..509169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04310"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface adhesin"
FT                   /note="PFAM: Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94154"
FT                   /db_xref="GOA:C7MML4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML4"
FT                   /protein_id="ACU94154.1"
FT                   /translation="MNNLFSLSPIEGAHTSLVRRFTIAGLCALAAALTCFALSGCSGSS
FT                   ADSANTTDSKDTKKVQVSASFYPMYDFAQKIGGDRVEVSCLVPAGTEPHDWEPSTTDIA
FT                   KLSNADVLVYNGAGMEHWIDDTLASLSSSHLVAVEASKGVTLRELSEEADEHEHAHEEH
FT                   AEGNHDDHDHDHSGTDPHVWLNPQNAKIEMGNIRDALIQADPDGADVYRANYDKWAAEC
FT                   DTLDNEFKTGLANVAQRSIVVSHEAFGYLCDAYNLTQMPIEGIEADSEPDAKEMAEIAE
FT                   FVKEHNVKTIFSEELVSPKVAQAIAQETGAQTAELNPVEGLTDEQLAAGEDYFSTMRDN
FT                   LTALKEALS"
FT   gene            complement(509240..509533)
FT                   /locus_tag="Ccur_04320"
FT   CDS_pept        complement(509240..509533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94155"
FT                   /db_xref="GOA:C7MML5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML5"
FT                   /protein_id="ACU94155.1"
FT                   /translation="MAHRLLKLIAATLLAANVLMAALSLEATSHHECPGDNCPVCALIA
FT                   TIAHAAATQVADIPPLPPGMASMWPTIMGALLLCSVMTLAITPVSLKVRLDL"
FT   gene            complement(509533..509949)
FT                   /locus_tag="Ccur_04330"
FT   CDS_pept        complement(509533..509949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04330"
FT                   /product="Fe2+/Zn2+ uptake regulation protein"
FT                   /note="PFAM: Ferric uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94156"
FT                   /db_xref="GOA:C7MML6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML6"
FT                   /protein_id="ACU94156.1"
FT                   /translation="MSERGSYNTRQKALVIDCLTGNQDRYLGVDDVLVMLHEAGKEIGR
FT                   TTIYRNLEALVTSGQVLKATSLKGEARYRLAPGKRSGQLVCLSCGCTLPLDCTMLSDFA
FT                   VHVQTHHGFEIDSSRTVLYGLCASCAQKDRKRER"
FT   gene            510117..510854
FT                   /locus_tag="Ccur_04340"
FT   CDS_pept        510117..510854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04340"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: TipAS antibiotic-recognition domain; MerR, DNA
FT                   binding; MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94157"
FT                   /db_xref="GOA:C7MML7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML7"
FT                   /protein_id="ACU94157.1"
FT                   /translation="MGYSIKEVADIAKVSVRTLHHYDHIGLLSPRKLANGYRSYDDTDL
FT                   KILQSILFYKYLGFSLKEIARLIQDDRGRVAALERQLHLLEQEQQRMEELVQTLKRSIE
FT                   EEKGELIMTAKEKFKGLTWSDSKEYENEARELYGNNIIDAAIARQKGNEDVMTEAFNEV
FT                   FFAFAHNCEEGIAPDAAENIAIAQRLLDALRTYSFDCTLEVFGHIGKGYVADPRFKANI
FT                   DKFGEGTAQYASDAIAAYVKVSA"
FT   gene            complement(510867..511682)
FT                   /locus_tag="Ccur_04350"
FT   CDS_pept        complement(510867..511682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04350"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94158"
FT                   /db_xref="GOA:C7MML8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML8"
FT                   /protein_id="ACU94158.1"
FT                   /translation="MTECQFATEGGVIHYWVSASPSPKQGWMVFLPGLSADHTLFNLQF
FT                   GHFAQKWNLIVWDAPAHGLSRPWNHPLSIDSMAEALGAILEKNRAANPIIAGQSLGGYV
FT                   AQAFIDLYPGCTRAFIAIDTSPMQLRYYKKWQLGILRHMEGLCRLWGTDHFLRNQMAHV
FT                   CSTTPYGRRNMLQQLERYSKHELCALLGDGYRALADAVAQDRAYTIACPLMIICGTQDK
FT                   AGFVTAYDKAWSINTGVPIIWVEGAGHNSNVDDATFVNAAIDQFIDSSI"
FT   gene            complement(511790..512374)
FT                   /locus_tag="Ccur_04360"
FT   CDS_pept        complement(511790..512374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04360"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94159"
FT                   /db_xref="GOA:C7MML9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MML9"
FT                   /protein_id="ACU94159.1"
FT                   /translation="MNERFFALPSTRRNAIINAGFETFSSYPYSKAPMSEVASAGGVSK
FT                   PLLFHYFKNKLGLYLFLWEIALDALKCSIKDADVFASDNLFEILRRATSAKCTVMRSHP
FT                   RLFAFATRAYYEEEPSVKAAIEKQVDEALSIAANSLSHLKDTGLREGLCAMDIYNDFLL
FT                   LSEGYVMQRYRTDNIDVDAIERDFNAIINRW"
FT   gene            512612..513883
FT                   /locus_tag="Ccur_04370"
FT   CDS_pept        512612..513883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04370"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="PFAM: Aconitase family (aconitate hydratase);
FT                   TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase, large subunit;
FT                   3-isopropylmalate dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94160"
FT                   /db_xref="GOA:C7MMM0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM0"
FT                   /protein_id="ACU94160.1"
FT                   /translation="MTAQPMTMAEKLLSAHAGVDSVQPGQLIDCAVDLVLANDITAPLA
FT                   IRAFHELGVKNVFDPQKIALVPDHSTPNKDIASAKLTKMMRDFAYEQEITHYYEVGCMG
FT                   IEHALLPEQGVVGAGDLVIGADSHTCTYGALGAFSTGMGSTDVGVAFATGRAWFKVPQT
FT                   IRINLEGSLASTVTAKDAILHIIGRIGVDGALYQAMEFHGGAIEGLSIEGRMTMANMAI
FT                   EAGGKAGLFPVDTTTRAYLDARTERPYTVYNPDEGAVYARTITIDAADIVPTVAFPHLP
FT                   SNTRPVAEARDVAIDQAVIGSCTNGRIEDMRAAAHVLNGRTVHPRVRCIVIPATQAVFK
FT                   QCIDEGLTDIFVNAHCVVSTPTCGPCLGGHMGVLAPGERAIATTNRNFIGRMGDTTSEV
FT                   YLASPAVAAASAVAGHIALPDDLD"
FT   gene            513954..514490
FT                   /locus_tag="Ccur_04380"
FT   CDS_pept        513954..514490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04380"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="PFAM: Aconitase C-terminal domain; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94161"
FT                   /db_xref="GOA:C7MMM1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM1"
FT                   /protein_id="ACU94161.1"
FT                   /translation="MRFKGTAHTFGRDIDTDVIIPARYLNNPNPQELAKHAMEDADPTF
FT                   VDTVQSGDILVAQENFGCGSSREHAPVALKAAGIDCVVAKSFARIFYRNSINTGLAIME
FT                   CPEAAEVIKEGDVVSIDADTGLIVDETTKKHFMAQPFPTFIRDIIEDGGLVEHTKRELT
FT                   HTNNVAGGQRNCGGE"
FT   gene            514511..515638
FT                   /locus_tag="Ccur_04390"
FT   CDS_pept        514511..515638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04390"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: Isocitrate/isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94162"
FT                   /db_xref="GOA:C7MMM2"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM2"
FT                   /protein_id="ACU94162.1"
FT                   /translation="MARTSYTICLLPGDGIGVEIMDAAAGVLDAISKASGIRFVFDRQL
FT                   LGGCAIDEVGDPYPPATHRAAHEADAVLLGAVGGPKWDSTDPCAPRPEAGLLAIRKDLG
FT                   LFANMRPVRVQPDLVGSSPLRPEVIQGVDLIIVRELTGGLYFGARERTYDEDGAGANGE
FT                   PGQHAIDTLDYREYEIERIVRRAFEVALRRHRRLVSVDKANVLETSRLWREVVHRIARE
FT                   YPQVECSDMLVDNAAMQLIRDPRQFDVIVTENTFGDILSDEASMLSGSLGLLASASLGE
FT                   RAALFEPSHGSAPDIAGQDIANPIAQVLSVEMMLRYAFGLQREAAAVASAVDSVLAAGW
FT                   RTRDLAEADTPDDRIVGCAQMGSLIAHVTHQALVE"
FT   gene            complement(515761..516678)
FT                   /locus_tag="Ccur_04400"
FT   CDS_pept        complement(515761..516678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04400"
FT                   /product="sugar kinase, ribokinase"
FT                   /note="PFAM: pfkB family carbohydrate kinase; TIGRFAM:
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94163"
FT                   /db_xref="GOA:C7MMM3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM3"
FT                   /protein_id="ACU94163.1"
FT                   /translation="MRKVIVFGSLNMDLSIESDRLPLEGETMFGRNFIVNAGGKGANQA
FT                   VAAAKMGAEVHMVGAVGGDLFGDHLIASLAETGVGCEYVTRCENVATGVAVIIRCKGDN
FT                   RIILGAGANLCPTAHDAACAIEELAQPEDIFLTQLECDFDETLGALRYAHEKDLYTVIN
FT                   PAPACELPAEIYHSIDMLVVNETECELLTGIYPADENACRRALQLFCDRGVETAIITLG
FT                   ERGSILQSSGQTLVSIPPTVNAVDTTCAGDTYIGAMVAAHTRACSLDEAMELATNASAL
FT                   TTTTVGAQQSIPYLEDVPRPQCFV"
FT   gene            complement(516722..518140)
FT                   /locus_tag="Ccur_04410"
FT   CDS_pept        complement(516722..518140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04410"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94164"
FT                   /db_xref="GOA:C7MMM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM4"
FT                   /protein_id="ACU94164.1"
FT                   /translation="MSQVNTPIQSGNAPRIVVLMTSLLVAIFAFQLNASMLSPALVTMQ
FT                   NELATTEAAIGLTQTVFFTAAALFSLFLPRLADLIGRRKVLGSMLALTGVGCLISAIAP
FT                   DVNILMIGRVLQGVSGPVVPMCLIMLHEEVTDTARYTRLMAILTSVNGGIAGVDAILGG
FT                   WLAGNFGFRSVFLAMALVAIVAVVLVLAFTRESTADDTPKMDWAGVFSLGIAFLATYLA
FT                   INEIQKLAAMSVPLVVGFIVVAVIAFIAFWNLEKRNPAPMVSTIYMKQRRTWGLLLTTL
FT                   LTMTGVFAVMNGVVPAIAQDTTLWSGMGADVVSFATLTPYALLGLVFGPITGMLASKFG
FT                   YHAVLRCGLVVSIAGILFGVFIAQSPSIPLLVAISVVLGISYAGTANIMLNGLGIMLSP
FT                   KDNPGYLPGMNAGAFNLGAGLSFVVLYAVMGAVNIGGDVAAGYASSLITGAVILVFALL
FT                   ASFLIPRPEDADRS"
FT   gene            complement(518146..519087)
FT                   /locus_tag="Ccur_04420"
FT   CDS_pept        complement(518146..519087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04420"
FT                   /product="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /note="PFAM: Inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94165"
FT                   /db_xref="GOA:C7MMM5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM5"
FT                   /protein_id="ACU94165.1"
FT                   /translation="MARKIILDCDPGHDDAVAILLAVGNPAIDLLGVTTVGGNQSLDKV
FT                   TYNARAVLEKAHALNVPVYAGCARPLIRPQEVAASIHGETGLDGVELPSPSRPLEQKHA
FT                   VNYLIETIMAHEPGTITLVPTGPLTNIALAARLEPRIVERVKEVVLMGGGYHVGNWSAV
FT                   AEFNIKVDPEAAHIVFNEPWKVTMVGLDLTHQALCTPAVQKRIEATGTDLAQFVSGLMD
FT                   FFRLTYQNNQDFVDPPVHDPCTIAYLIDPQVITCRRCPLDVEIHSTLTLGMTVADLRGP
FT                   EPAADVCHTQVAVNLDFDRFWDLIVDAIERIG"
FT   gene            519686..521008
FT                   /locus_tag="Ccur_04430"
FT   CDS_pept        519686..521008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04430"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94166"
FT                   /db_xref="GOA:C7MMM6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM6"
FT                   /protein_id="ACU94166.1"
FT                   /translation="MAIQRPKGTEDLLAGKAIFYRHFVDTAFEVFGRYGYVPIEVPTFE
FT                   QTDLFVRGLGTATDVVSKEMFTAISGENLKSLLAGETVKPESRFSLRPEGTAGVVRAVA
FT                   QNNLVAQGSAPVKLMYAGPMFRAERPQKGRLREFHQVGIECLGASAPSVDAEGIIMLMR
FT                   FYERIGIPRENMRLLLNSMGDHTCRPAYREAVRTYIMDHASEMCDECVRRADINPLRSF
FT                   DCKNPDCQRVMANAPIISDWLCDDCKSHYNQVKAYLDAAGIEYVEDPSLVRGLDYYTRT
FT                   VFEIQVVDGMGSQSAIGGGGRYDGLMEEIGGKSCPGFGFALGFERCVLALTAAGVSVAN
FT                   NPTCTLFIACVDDAARSQGFILAQTCRDAGVAVEIDHQSRSLKSQFKLADKLGAVYVAV
FT                   LGPDEVAAGVAKVRDMASHEEQPVSFAEVAHFVSHGGVETK"
FT   gene            521207..522985
FT                   /locus_tag="Ccur_04440"
FT   CDS_pept        521207..522985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04440"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="PFAM: OB-fold nucleic acid binding domain; tRNA
FT                   synthetases class II (D, K and N); TIGRFAM: aspartyl-tRNA
FT                   synthetase, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94167"
FT                   /db_xref="GOA:C7MMM7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM7"
FT                   /protein_id="ACU94167.1"
FT                   /translation="MTDYLNEHCMHTRTCGELRLADEGTEVTLTGWVWHNRDHGGLIFV
FT                   DLRDRTGYTQCVFDPDCVTEEEFHAAEHLGREYVIEVTGTVRARGEGSVNPQMATGEIE
FT                   VLARSLQVLNTSVTPPFAIEDGIETDETTRMKWRYMDLRRPEMFNALKLRHTVAQAMRA
FT                   ALNKRGFIEVETPILANSTPEGARDYLVPSRPNPGRFYALPQSPQQFKQMLMVGGIERY
FT                   YQIARCFRDEDLRADRQPEFTQVDIEMSFVSESDVMDLMEGVFQEVLEAAGVEHSFPLE
FT                   RMPWKEAMDRFGCDRPDVRFGMELVDLTDIVANCGFKVFAGAAASGNIVKAINAKGAGD
FT                   WSRGDIEKLAEVAAANGAQGMAWIAYTSDGKEKSPIIKFLGEEVHNQIKTAMNVEPGDL
FT                   VLFAADTFAVANAVLAALRLHMADLLHIERPGHRLLWIVDFPMFKYDDEAKKYAAEHHP
FT                   FTMIPQSDWVKIETDPLACGSYSYDIVMDGFEMGGGSIRIHDAELQKRVLRRCGVADED
FT                   MEVKFGHLIHALELGAPPHGGIALGLDRLVMLLTDKSSIRDVIAFPKTSSAADPMTGAP
FT                   GQVTARQLKEAGLRIL"
FT   gene            523175..524935
FT                   /locus_tag="Ccur_04450"
FT   CDS_pept        523175..524935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04450"
FT                   /product="threonyl-tRNA synthetase /Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /note="PFAM: tRNA synthetase class II core domain (G, H, P,
FT                   S and T); Anticodon binding domain; Threonyl and Alanyl
FT                   tRNA synthetase second additional domain; TIGRFAM:
FT                   threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94168"
FT                   /db_xref="GOA:C7MMM8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM8"
FT                   /protein_id="ACU94168.1"
FT                   /translation="MKVLYNDGHIDECPEDEELHVLRHSAAHILAQAVKRLYPEARFGY
FT                   GPANDNGFYYDIDLGDAKISEDDLPTIEAEIKKIVKENLKFTVFELPREEAVKFMTERG
FT                   ESYKAEHIGDLPEDTRLTFYQQGEYVDMCVGPHITYTKALKAFKLTNVSGAYWKGDAAN
FT                   KMLTRIGGVAFRTKEELVHHEELLAEAEKRDHRKIGREMELFMMADEGPGFPFWLPNGM
FT                   RLKNALTQYWMEMQEAYGYEQVDTPIILSRKLWETSGHWDHYKENMYTTVIDDEDYAVK
FT                   PMNCPGACLIYKSKPRSYRDLPLKLAEAGKDHRHELKGALHGLFRVRAFTQDDAHLFIR
FT                   PDQITEQVTDTAHLITAYYEQFGFPYRVELSTRPDDSMGSDEDWALAEEGLRQALEAMG
FT                   VDYTLNEGDGAFYGPKIDFHLQDCLGRTWQCGTIQLDFQLPQNFELEYTDSDGSKKRPI
FT                   LIHRAGFGSFERFIGMLTEQYAGKFPTWLSPLQVKVLPVSEKHREYSRQIADKLRQAGV
FT                   RVKVDERDEKIGYKIREARSVDRVPYMLILGEVEEEAGNISVRDRSNETVQRSLDDFIT
FT                   DIQAEISERR"
FT   gene            525456..527663
FT                   /locus_tag="Ccur_04460"
FT   CDS_pept        525456..527663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04460"
FT                   /product="methionine-R-sulfoxide
FT                   reductase/methionine-S-sulfoxide reductase"
FT                   /note="PFAM: Peptide methionine sulfoxide reductase;
FT                   Cytochrome C biogenesis protein transmembrane region; SelR
FT                   domain; Redoxin; TIGRFAM: methionine-R-sulfoxide reductase;
FT                   methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94169"
FT                   /db_xref="GOA:C7MMM9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMM9"
FT                   /protein_id="ACU94169.1"
FT                   /translation="MISIGYVFAVFCAGLLSFFSPCILPILPVYIAYLSVDATSEKLSF
FT                   ARKLARTLAFIIGLSAAFFLLGFGAGALGGVISSPIFSIVCGVVVFIFGLYMAGLLKIA
FT                   PLMRERRFTLPKSIAGKKSVASAFLLGLIFSLGWTPCVGPILASILALAAEQGTAASGG
FT                   FLLAIYSLGLAIPFLVLSLGSDFLLSRVRNLNRYLPTIKLVGGLVLAALGLFMIISQAY
FT                   TLQTGASASRSLTPASTTESVKAAEDFTLPALDGSTATLSDYRGRPVYTKFWASWCPTC
FT                   LAGLDDFASLATDYNEAGSAQILSVVAPGQKGEVDESSFSTWATGQDLTFPILFDSDGA
FT                   QLSHFDIRAYPTSVFFDAEGRVVKKVTGEMTSDEVRAEIDALIAGKTGDTTTSVVDDGK
FT                   GTTVHIDTNNLHDIYFAGGCFWGVEEYFSRIPGVYDVVSGYANGTTENPTYQQVCSGTT
FT                   GHTETVHIRYDPSIVSLRTLATQLFKIINPLSHNQQGNDRGTQYRTGMYYTDEADASTL
FT                   SSVLAEEQTKYSDPIATELKPLENFSEAEDYHQDYLKKNPGGYCHIDFSSLDDVQLEAA
FT                   QSYVDPSEYTRPTDEEIKAMLTDAQYHVTQQEGTDPAFSGEYFNTFEAGIYVDIVTGEP
FT                   LFSSESKYASGCGWPSFTQPIDPAVIVERTDTSHGMVRTEVTSRVGASHLGHVFPDGPS
FT                   DKGGLRYCIDSSAIRFIPYDQMDAEGYGKFKDACAYGGDNS"
FT   gene            527935..528411
FT                   /locus_tag="Ccur_04470"
FT   CDS_pept        527935..528411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04470"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94170"
FT                   /db_xref="GOA:C7MMN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN0"
FT                   /protein_id="ACU94170.1"
FT                   /translation="MECAFRFAQREDTGKLIAFIKEFAAFQKVGETVRADEDRLRTWMF
FT                   DRGMAEAIFVEVNGKDVGFCLFNHGFSALQGKPSIYVECIYLYPEFRGKGLGSALFRHI
FT                   ASIARERDWVRVECASPDWNERSGGFYNSLGAEEMNGWTVYRFSGEALESLAHE"
FT   gene            528747..529538
FT                   /locus_tag="Ccur_04480"
FT   CDS_pept        528747..529538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04480"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94171"
FT                   /db_xref="GOA:C7MMN1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN1"
FT                   /protein_id="ACU94171.1"
FT                   /translation="MCECVTLLDTIDAYWDERSSSYSETIQRELTTEIYHHWWSVLADT
FT                   IPGFGKRSLRVLDIGCGPGFFSILCAQAGCSVDALDCSVKMLAHARQNLFHAGLNTADN
FT                   VQVRFHQGDARFLPFDDGVFDVIVTRNVTWNLEDPLGAYREWQRVLIPGGRLINFDAGW
FT                   YSYLSDVGIEAQRVMDQADDQLLDLPAACRATDDQCTRCERIAARLPLTRESRPAWDDR
FT                   TLRQLRFSQVQVHRNIHKRVWTPNEAAYYASSPLFMIVGVK"
FT   gene            529543..530499
FT                   /locus_tag="Ccur_04490"
FT   CDS_pept        529543..530499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04490"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94172"
FT                   /db_xref="GOA:C7MMN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN2"
FT                   /protein_id="ACU94172.1"
FT                   /translation="MAALVVRRLLALGALLVGISFISFLLMHLSPSDPALMMLSAQGVA
FT                   PTPDLLEQTRHDMGLDQPFFTQYINWLQGIFQGYWGYSYVYSAPVADVLLQRLPVTLTL
FT                   SFAALLLTLGIALPAGVTAALHPTKLSALLIRLFELTSLSMPTFWFGLLLIYLFALTLG
FT                   WFPAVSDASSAVGYLLPVVALSFSYVGRLIGQIRADVTAEVAKPYVEGLISRGMDTHRI
FT                   IWRHVLRNALLPSLTVAGLALGAMLSGSITTEMVFNLPGLGLASIEAITARDYALVQGY
FT                   VLVSALFFVMVNLFVDIIYRIADPRIRLEPSERRAFR"
FT   gene            530496..531332
FT                   /locus_tag="Ccur_04500"
FT   CDS_pept        530496..531332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04500"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94173"
FT                   /db_xref="GOA:C7MMN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN3"
FT                   /protein_id="ACU94173.1"
FT                   /translation="MNRKTFQINGRSAVFFVSAAGVAAVILLACIAPWITPCDPLATDY
FT                   ANTLCPPMPGHWFGCDVMGRDLLSRIIVGARISVLMGLAAVALPAIVGIGIGFIAAYIG
FT                   GWVDTLLMRVADLFQSFPEFILGVAIVGVLGPSMLNAFIAIIAVTWIRYARQTRSLVIG
FT                   IVHAPFIETARLNGCNAWQIAVRHILPAMLPQTIAMAVLDIGPVMLLLAAFSFLGLGVQ
FT                   PPTPEWGALLNDGRFYFSSAPYLMLFPGVAIFVTVLVFNILGTSFSRIINNKENRL"
FT   gene            531329..532984
FT                   /locus_tag="Ccur_04510"
FT   CDS_pept        531329..532984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04510"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle; TIGRFAM: Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94174"
FT                   /db_xref="GOA:C7MMN4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN4"
FT                   /protein_id="ACU94174.1"
FT                   /translation="MNASDEQTFEQGTSCHTLTKKSRQAVSRRAFAKGLIIGGAACAVG
FT                   ISAVGCGGSPDTLGVRDGGKSSVHDGSEPPASLTILYNDAPNSFDPVNKWDGWYTVCRG
FT                   LTETLVAFDTDMSLRPCLAVDWTNIDELTWQFTIREGVFFQSGRQMDPQAVKESLERSI
FT                   ERAPRAAKKVRIDSIDVDENTIVLHTTEPVSTLPGELAEPVFSIVDVEVVDTAPTHAGT
FT                   GPYEGDDVSSTESFTLRAYKGYWGGTATVAALTCRRAADANTRAIALRSHDADISSSLL
FT                   ASDLKTFENDPTFTTLTSESVRSVFVICNLRNSLLADRVIREALSKATDRETLGNLLLG
FT                   GNIRPNGLPFPSYLSYSRAVSDVAQTFDLSSAATLLDSAGYLDTDGDGIREKDGQRLSF
FT                   SLAYYSSRPEFLQLAPALQDAYRQIGIEIILQLYENIDTVYYNADFDLMLYNTTTVGNG
FT                   DPSYFLTLYFASDGSENAGGYANDEVDTLVEKMRGEFNQETRFELAAQATRLIMADCPN
FT                   IFIGSSVMNAVCISDVTGYSLYPVEYYGVTNKLW"
FT   gene            532988..534802
FT                   /locus_tag="Ccur_04520"
FT   CDS_pept        532988..534802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04520"
FT                   /product="ATPase component of various ABC-type transport
FT                   systems with duplicated ATPase domain protein"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94175"
FT                   /db_xref="GOA:C7MMN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN5"
FT                   /protein_id="ACU94175.1"
FT                   /translation="MAHDVMAGSTTHTTEGALRESSPVLSVYDLHVAYPDCEKEAVGGV
FT                   SFDLAAGELLGIVGESGAGKSTLLRALQCLLPSAKVNGRILLCERDLLTLSEEDMRSLR
FT                   GRQLAIIYQNPASRFDPTMRIGIQLAESIRLKEGCSRQIARKAARDLLQEFGFSNVGHV
FT                   FDAYPFELSGGQLQRAAIALALAFAPQVLLADEPTSALDTLSRRTTIDFLMQQAKAHGT
FT                   ALVLVSHDISLVAHTCDRMAVMQQGTFVEYGNTTHLLRYPSTALTRALIAATPRLDGNQ
FT                   KSRFFANTVSAVNGLSVADKLSATDDLSVASNLPTISDLSITNDLSLDADELPPTGKFS
FT                   VADELLVTDELLRFEKVSQRWRHGSDFVMAVSSFNLTLHEGESVALVGESGAGKSSVAR
FT                   IGALLDRPYAGQVFWHGRSVSNLSASALRALRPQIQFVAQDPVLAFDRHLTVERLLAEP
FT                   VRNFKVCPANKRIQHIHTLLEEVSLSPDVLNKRPFELSGGQLQRVAIARALASSPALLI
FT                   LDEATSSLDTIVQDQILCLLEDIQARQGITYLFVHHDLAVAQRLCNRIIVMRDGNVEAR
FT                   LAARDLGEGVEGFTGELVRARFSLGVEE"
FT   gene            complement(534958..535179)
FT                   /locus_tag="Ccur_04530"
FT   CDS_pept        complement(534958..535179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04530"
FT                   /product="phosphopantetheine-containing protein"
FT                   /note="PFAM: Phosphopantetheine attachment site; TIGRFAM:
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94176"
FT                   /db_xref="GOA:C7MMN6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN6"
FT                   /protein_id="ACU94176.1"
FT                   /translation="MATIDTVKDILSENLDIDPETVTEDSTFESLNIDSLDMVELTCDL
FT                   EERCDVDMGEPEGLETIGDLVEYIDGLN"
FT   gene            complement(535335..536297)
FT                   /locus_tag="Ccur_04540"
FT   CDS_pept        complement(535335..536297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04540"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94177"
FT                   /db_xref="GOA:C7MMN7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN7"
FT                   /protein_id="ACU94177.1"
FT                   /translation="MMYTVLFYYTLIIMLFYTIVAATSFSAYFVSRRRSFLFIAIGFIF
FT                   YFFDVSLVFKDDFVTPDAVFKAETFWEVGNPLATIITGLGTFLFLWMAICYYIGEKRKP
FT                   VLYVPIIVWTISSSLLFVAITDLQWREFMFYLQRELLLFFSYAFLAHRYITTKDESVHA
FT                   LLGRHRRAFFIALVLTIGIILENVYFQLLFDASGAPDNMWFFAERNPMENMLFICFGVV
FT                   ALRNIQQTLQLRYEAPPQRDDATMAESIDRILPLYCKNHGLSKRESEVLRLIIMGKDNQ
FT                   NIASVMQLALSTVKVHVHNILKKTGQPDRKTLAKNFWSD"
FT   gene            536666..538252
FT                   /locus_tag="Ccur_04550"
FT   CDS_pept        536666..538252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04550"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94178"
FT                   /db_xref="GOA:C7MMN8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN8"
FT                   /protein_id="ACU94178.1"
FT                   /translation="MAEATATAAPLAAEGSPKKEKKKFTFPSAFTILFIVTILAVVCTW
FT                   FVPAGQYSKLMYDAGSGSLQITSPTGEVTTVEATQESLDAMGVKIDISQFTGGAITKAV
FT                   SIPGTYESLPQHPVSVTEIPFAMVTGVIEGIDVMVFILCLGGLIGVVKATGAFESGLSA
FT                   LTKKTVGREFLLVFGVSCFMIFGGTMCGIEEEAVAFYPILAPVFIALGYDSIVTVGAIF
FT                   MASSVGTTFSTVNPFSAVIASNAAGTVFTEGMGIRLFGLIVASIVYLLYLRWYANKVKN
FT                   NPEFSYSYEDREEFKAMWDMEEADGEKHEFTIRKKIVLVIFVFAFILMIIGVMRLGWWF
FT                   PQMAAEFVTLSILVMFIGGWGKKGIGEAKMVDAFSQGASSLVPVALIIGLARGVNYVLN
FT                   QGLISDTMLYTASNMVVGMSGPLFIICLVLIFFVLGFVVPSSSGLAVLSMPIFAPLADT
FT                   VGIPRWIIVGAYQFGQYAMLYIAPTGLVMATLQMLNMKMSHWFKFVWPMMVFTLVFGSA
FT                   MLAICTVVFHV"
FT   gene            complement(538329..538832)
FT                   /locus_tag="Ccur_04560"
FT   CDS_pept        complement(538329..538832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94179"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMN9"
FT                   /protein_id="ACU94179.1"
FT                   /translation="METLTDSQKQIATVLIDWVAARREEGAESLLIDEGELAHELGASS
FT                   WKRSYLDDLNILCAYCDRMGYPTISLLVVVPGLNRPERALFAHAFKTTLPAAEATKRWN
FT                   DELKKIAKTKKTTWAEFKNNVAPAEEEPAKRKRSTTAKGNKAGKATDKKGTPLSKNPLN
FT                   SSRA"
FT   gene            539004..541961
FT                   /locus_tag="Ccur_04570"
FT   CDS_pept        539004..541961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04570"
FT                   /product="predicted Zn-dependent peptidase, insulinase"
FT                   /note="PFAM: Insulinase (Peptidase family M16); Peptidase
FT                   M16C associated; Peptidase M16 inactive domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94180"
FT                   /db_xref="GOA:C7MMP0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP0"
FT                   /protein_id="ACU94180.1"
FT                   /translation="MIEVNSRLHGFRVDSEEELPEIDGRAYTMFHEASGARLLYLKNDD
FT                   DNKAFSITFKTPPADDTGVFHILEHSVLCGSDRFPVKEPFVNLLKTSMQTFLNALTFPD
FT                   KTMYPVASTNEQDLLNLVDVYLDAVLNPAIYHDKTIFQQEGWHLEIDTPDAATSSTVKA
FT                   ADANNNRLSLRYNGVVYNEMTGAFADPESVLYHAMLRALFPDSCYAFESGGHPRAIPDL
FT                   TYESYLDTHARHYRLDNAYIVLYGNLDIDRMLAFLDERHLSRAQVRSRTAPNPVGSFAP
FT                   RRAVHEVEYMDTAPENACVGLAYVVGDANDFERTLAVDVLLDALAGGNESPIKRAVLDA
FT                   GLGGDFAAYMMDAQARPAVLFTLRNAKEGVADKLRQVVESEVKQLVSEGIPRDILEASL
FT                   SQLSFALRERDRGIADGVYLSMSALSGWLYSEDAATTYLHYEEPLARMRAGLTTDYFEE
FT                   VLRSLILKSDHMTLVDLQARSRTGLSDIQKRLDQLAENLTEADIHTIEQTVTDLRARQE
FT                   APDTPEDLATLPHLGVADIGAAPYETPLAVLDNRPISCLYHDLPTRNIDYVNYSFNMGC
FT                   LTWEDLPYASLLTSLFGSLATAERSAADIDVLSRQHLGALRFKIDTDVEAEDTSKVACR
FT                   FTISVATLAEERPFAISIPREVWESTCFDDAQRIRDILIQRRIGMEQSFANEGHTRAAD
FT                   RVASYLFPSGVLLEQIYGVDFYFFLKDLIDHFDERFEDLIARLDGVRHRLFVREGCTVS
FT                   FTGDREELDAFWNEAGDLGLPCAQAGEPNVLLIPAPQVKREAFVVPSDVCFVAKGADVS
FT                   AFGTYDGKWGVLANVLSLDYLWNEVRVKGGAYGVGFRRTPMGYARYTSFRDPHVDETLS
FT                   RYDVAGQWLASFSPDTTEMEGYIVSTVASHDAPVKPWVIARRQDSAYFSHYPANWREQL
FT                   RDQVLATTPEMLRSCALSLEAIAASDAVCAFGSKALLEGARAGTFDTVVTLLENQ"
FT   gene            542116..543039
FT                   /locus_tag="Ccur_04580"
FT   CDS_pept        542116..543039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04580"
FT                   /product="MazG family protein"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase domain;
FT                   TIGRFAM: MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94181"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP1"
FT                   /protein_id="ACU94181.1"
FT                   /translation="MKLSDETAQYHKVPNPQTATDHPAFNAFVETIAILRAPNGCPWDV
FT                   KQTHESIAKNMLEEAFEAVAAIEEADRDHLIEELGDVLLQVVLQAQIAADAGEFTIDDV
FT                   AQAVNEKIIRRHPHVFGAEAALSVAGIDIASVKDADDVAGLWDVVKAHERVLKDAARAE
FT                   KLRAQGINADVPRGLLEDVPAAQPALMQAQDISRKAVGCGFDWEDVEGVWDQVREEIDE
FT                   FKAAPSRSREAEEEFGDILFSLVNVARKEHLDAETCLRRSCDKFRRRWAAMEAQAYAMG
FT                   RRIDSFSPDELEELWQQAKCTLSSGA"
FT   gene            complement(543147..543779)
FT                   /locus_tag="Ccur_04590"
FT   CDS_pept        complement(543147..543779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04590"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94182"
FT                   /db_xref="GOA:C7MMP2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP2"
FT                   /protein_id="ACU94182.1"
FT                   /translation="MKKTIWDWYAPFYQRAMIPDKKAYQWMYDHISHVVVDKTVLEIAT
FT                   GPGLLAKHIASAAKTVTATDYSASMIKEAQKGTHPENLIFEVADATHLPYAARAFDVVI
FT                   IANALHIMKKPDKALQEIRRVLKNDGLLIAPNFVNHAKIGALWTSILKMVGIGFEHRWT
FT                   KETYLHYLESQGWKIEFTESITARLSICYVECTSKLLGKQPDEEKSQ"
FT   gene            complement(543897..543972)
FT                   /locus_tag="Ccur_04600"
FT   tRNA            complement(543897..543972)
FT                   /locus_tag="Ccur_04600"
FT                   /product="tRNA-Ala"
FT   gene            544070..544630
FT                   /locus_tag="Ccur_04610"
FT   CDS_pept        544070..544630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94183"
FT                   /db_xref="GOA:C7MMP3"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP3"
FT                   /protein_id="ACU94183.1"
FT                   /translation="MPKALRIALPIVLLASVYCAFAASMQPDSGDAADAVMNIWFASMI
FT                   IIGMANVVNACLDRGEGSPRRLAFWDMLLKLCLIPFYLFVFVGGLLLSFVLAIIPGFIF
FT                   VTPILAAMLAVIDYVLLLLTSSYGFASVVRAQKQGLITKGTAVVLGILHVFFVADVVAA
FT                   IVLYAMIRNAEKPVLTAGSPSES"
FT   gene            544847..549448
FT                   /locus_tag="Ccur_04620"
FT   CDS_pept        544847..549448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04620"
FT                   /product="FOG: WD40-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94184"
FT                   /db_xref="GOA:C7MMP4"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP4"
FT                   /protein_id="ACU94184.1"
FT                   /translation="MRVKIPRYASNRKPSSALLRLKEKSECPPPLSSPGSEVPTMFGHR
FT                   SLCFNATRSSYEYVSAADTANASDASTSIAPLPSAMLRVLLAIVLAVSLCPLPTTAYAL
FT                   DEESSAQATPLSASSAENAPSSVSSTATDLESSATESSETSAVFADRAAVSNDDDDDYW
FT                   SGDDDDWPGDDDDDDTDDNTGSSSSTGSDSSGTSDNTSTTESDAYLDSVVAKLTGEGFS
FT                   GWIPKLTYESDTNINQVLINHLKDLGVDTTGLTVTVSEVTFANTNPNAQVGISTNETDN
FT                   GAITYYKGDPDKVGSWATPSLQRVNKIVFKLSHDGKTKEYSPARTFAVPWNTDAAKTLL
FT                   ESKAQVLSLSFAAGDTALSVTKDFPLPSKIPGVNWSTISWSSSSTAITVKPPLYKLGDG
FT                   SAVVTRPNQDEQVVLEATISGLANFGMPEGASVTRSFTVSVAGDSSAIEAEQQALQQKV
FT                   DAAFTTGALKYSDSTAALNPESITDDMQLPRPRTLKVDGKQYSIAYQASNDALTINGYR
FT                   ANVLRPEPGTPARSVDITLTVTSKKNPAISASKKLQLTIEPIDQADVQAELNLMAQAKA
FT                   AYGNALAAGKDAAALTGNLHPFQKAYIAQDGSLTWAYTAADARSAVQGIVPVELPGYDS
FT                   MGSSDQARLFASSSPATIANETLRLTRPDYDTEVTVSSVLSSEKYARYALRYPDNADFK
FT                   ALASQPVSAKFTVFGTKGHVLHLDVSCSIIGVDSFGADQQWVSETPLTVEQGTTAAQVT
FT                   EQLLSAAGLLHESQGAGDTGAGSDYYLSSITSPLTGHSLSWDQATGKYWQLFVNGLPSQ
FT                   VGAGAVVLHAGDCITWYYSAYGQSLNDEAHLQVSCSVIGPNATGQQVFWVPLSTVSLPS
FT                   GATAADASEMMLTQAGLVHESQGTGPSYYLAKIVSPFTGEALSWNQETGQFWQLFINGT
FT                   SASSGAGSIALAAGDKIEWIYSSADETIPDPHGSIGTVAVDPNAQGDPTLSSDWPTFAA
FT                   HGPSMSGADTPTPDQSAHAIWTAHLKDANDWSTYASDPILVGDTVLTAVGSELQMRSAQ
FT                   TGDIIASTPLAAPIDSVARMTFKSGIVYVPLHGGRMQAIAVTSSSLTTKWYTESLPDVG
FT                   GNAMQSLSNVTVANGCVYFAATAATWSASTGGWLVCLDAATGAVRWKQKSASAGYYWSG
FT                   STAVASSLVVADDAGNLQSINAASGTVTSTISLGAGVRSGVITDTDGRHVYAVSTDGVL
FT                   HKVAIDSDGVLHADGSVNFAASSTSTPVLVGGKIYVGGAAHTTHATEWGSAPDGLLAVI
FT                   DAQTLTVEHAISSLEEGGAIGADVKSAPLVSTQDGQTYVYFTANTPPGGVYVYRLGDAT
FT                   ARELFVPEADAQNYCLASPIAASDGSLYYVNDSGNLFKLVATQKPFNPDNPNTPEKKVP
FT                   VTPHNPDGLNNQTGTSIGNGPAYNDASSVRFALRSNVLDSRATGSALEASEEQVSSARA
FT                   SSEAAASKLDAAASGTRTPSESLDGAVPVMLSEDAVDQVNQLPIWAVAGLVVGIAGLLI
FT                   LVFGRRRSKDEDK"
FT   gene            549445..550185
FT                   /locus_tag="Ccur_04630"
FT   CDS_pept        549445..550185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94185"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP5"
FT                   /protein_id="ACU94185.1"
FT                   /translation="MKDARWRWIATAACCVLIVVSAWTLGSYFLGSSGASEDLFTTVAP
FT                   AESDASSGVTTTGDLIPKQEDDTADQSDGAAGEDTGSSDDPTPPLAAADSAYATQSGDP
FT                   QSSDSSSRSSDGSSVAGGSSASSATTSGSSSSSSSSGDQLTHIQVNITVDGTAAGSNIS
FT                   SALLSIPAGSTVYDALKATGASVNARSTVYGMYVAGINGLAEKEYGAQSGWIYYVNGQF
FT                   ADRACDRWRLSEGDYVKWVYVSDN"
FT   gene            550215..551114
FT                   /locus_tag="Ccur_04640"
FT   CDS_pept        550215..551114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04640"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94186"
FT                   /db_xref="GOA:C7MMP6"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP6"
FT                   /protein_id="ACU94186.1"
FT                   /translation="MTTSFDILHPAVQAVWCALALGLTMTAFHPVLAPIALMGGFVANS
FT                   MVQGVQHTVASLRWQLPLLILITLANPLFSASGSTLLIQVGPWALGTGEVFLNIYAESL
FT                   AWGAVAGCVFVASMQWFAFTARLMTSDKAMALSGPFLPTVSLMVSMTLRLMPQLARRGQ
FT                   YINAVLHACTSAGPAQAGMQKGISQRIAQHVRMLSSLMVWGMEDSLERSRVMRARGWGN
FT                   ASTHTRYRTRRFRCADAIALAVVLVLGVLCAVLAWVACSQFTFYPKMSTLIWWWGYGAY
FT                   AMFFLVPSFVVVLERVRW"
FT   gene            551108..552730
FT                   /locus_tag="Ccur_04650"
FT   CDS_pept        551108..552730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04650"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94187"
FT                   /db_xref="GOA:C7MMP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP7"
FT                   /protein_id="ACU94187.1"
FT                   /translation="MVVMHTCAMGRPPALEWSHFTFAYPGGQPLFAPIDIAVREGEFVL
FT                   FVGDTGSGKTTLLTSAKAEIAPAGERNGHIKLFGHEVCEGQSDIAYAAQDPDNQLICDT
FT                   VWHEMAFGLENAGTQPDTMRRRVAESAYFFGIGNLMHRSVESLSGGQKQEVNLAAALAL
FT                   QPRILLLDEPCAQLDPVAAKNFLHLLLRVNRELGITVVVATHEPEQVANYATRCVELST
FT                   RGARPLDLERFATRPLDVRCLDVSLDKIPHEDSLVQENGQVSDSSQASLEQRVKGSHAQ
FT                   QVNADHTQGMPTISSNKFRFKTATFRSTVSLRDAYVRYGKGESWVLSGCDFEAQPGSVQ
FT                   AIVGGNGCGKSTLLLALAGILRLERGRQKNSLAAHQAFLPQAPQALFTCDTVAEELTDW
FT                   QANSTYSDADITRQMHDLGLEGLANRNPLDLSGGQRQLVAFAKLALTNPHLLLLDEPSK
FT                   GLDAQTKCVLRRELRRMADQGCTIILATHDLPFAALVADRVSLLFDGQMVCSLPPQEFF
FT                   RENLIYQAQANRFTDLVIAETSK"
FT   gene            552741..553430
FT                   /locus_tag="Ccur_04660"
FT   CDS_pept        552741..553430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94188"
FT                   /db_xref="GOA:C7MMP8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP8"
FT                   /protein_id="ACU94188.1"
FT                   /translation="MRTRWIAEMVILCLVPVGLGACAWFQWDASALLSFVVAVAAIVLF
FT                   FVDFETSKPALRQIMPTVVLAALAAAGRILFAPIPDVKPVSAICILAGAVFGRRCGFMT
FT                   GALAALVSNFFFGQGAWTPWQMYSWGLVGYLAGVLSAQGWLDHKPILYTYSFLSALVFG
FT                   LIMNGWYVIGFVHPLTWESVLLAYAAGFPFDVIHGVATVGFTAIIYCPWKQKLVRMREK
FT                   YALSGSA"
FT   gene            complement(553519..553842)
FT                   /locus_tag="Ccur_04670"
FT   CDS_pept        complement(553519..553842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94189"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMP9"
FT                   /protein_id="ACU94189.1"
FT                   /translation="MCKDRKQVGYVAAAADEGSLLNAPSSVAVDNGATPSGHLSPADGD
FT                   IALPSTHPSAAATPAKKAISSTSPDSRQPFRAPNEDDDGYDPYSDIHDARVPEPLFEED
FT                   PWS"
FT   gene            complement(553861..554715)
FT                   /locus_tag="Ccur_04680"
FT   CDS_pept        complement(553861..554715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04680"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="PFAM: ParA/MinD ATPase like"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94190"
FT                   /db_xref="GOA:C7MMQ0"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ0"
FT                   /protein_id="ACU94190.1"
FT                   /translation="MANTESLSEEEKQMLQGCHGAEATEPTVLSPNSNSHIHHVIGVVS
FT                   GKGGVGKSLITSLLASAQQKRGKKVAILDADVTGPSIPKAFGVSNPLTADADGIIPAQS
FT                   QSGIKIVSTNLMLPADDMPVAWRGPVVSGAIRQFFNEVNWGDIDYMFVDMPPGTSDVLL
FT                   TVFQSLPIDGIVTVSAPQELVSMIVGKAVNLASQMDVKTLGLVENMAYYTCPDCGKQHF
FT                   IFGEPQGKEVAKKYHIPAYATLPIDPNFARLCDAGKVEEYEVGNALDPILEQIESVSTA
FT                   DNK"
FT   gene            555057..557102
FT                   /locus_tag="Ccur_04690"
FT   CDS_pept        555057..557102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04690"
FT                   /product="small GTP-binding protein domain protein"
FT                   /note="PFAM: Elongation factor G C-terminus; Elongation
FT                   factor Tu domain 2; Elongation factor Tu GTP binding
FT                   domain; Elongation factor G, domain IV; TIGRFAM: small
FT                   GTP-binding protein domain; translation elongation factor
FT                   EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94191"
FT                   /db_xref="GOA:C7MMQ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ1"
FT                   /protein_id="ACU94191.1"
FT                   /translation="MAAPATEHVRNIVLVGQDGAGKTSLAEAMLHVSGKTPRMGTTHDG
FT                   KSYLDYDEEEIRHRFTLGTSIAPIPYKDYKINLLDTSGQPDFIGDALASMQAAEMAMFV
FT                   IDAATGPQVMTTRLWHEAEHMRLCRSVFINHIDREGANFDVAMATLHARFGSRLGAVTL
FT                   PIGEEAAFTGVIDILRMKARYFEAGGERVEDIPEAYADAAQIAREKLCDLVAEADDELM
FT                   MKYLEGEELSQDDLENLLDKAIAQEIFIPVFVGSTIIEQGILNLMEDICTYFPHPRSHG
FT                   AFVLADGKEIFIDEAGEPAAFVFKTIADPYVGRLSFLKIIGGVLSPGIELINSRTGKRD
FT                   RLAHLYVMMGKTTEDVKSAKAGDIIVVPKLTDARTGDTLSESGALALDPLPLPQPLYLV
FT                   AIEADNKKDEDKLGTFLARAAETDPCLHIERDEETGQTVIHAMGDTQVETLLARLQSQS
FT                   DVSAHLVPLRIPYRETIRSSAEAQGRHKKQTGGSGQFGDCWLRIAPHPGEGYEFIDEVT
FT                   GGHIPRNYIPAVDKGVQEAMAEGFLAGYPMVDITCAVFDGSYHSVDSNEMAFKTAARIG
FT                   FRAACEKANVVLLEPMANMSIEVGEAYAGVVMGDISTRRGRIVGTDSNDTGDTIILVRV
FT                   PYAEVVSYTKDLRSLTRGTGSYSIELSGYEEAPANITQKLVEQYRK"
FT   gene            557213..559036
FT                   /locus_tag="Ccur_04700"
FT   CDS_pept        557213..559036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04700"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: Glutamine amidotransferases class-II; SIS
FT                   domain; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94192"
FT                   /db_xref="GOA:C7MMQ2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ2"
FT                   /protein_id="ACU94192.1"
FT                   /translation="MCGIVGYTGGKMAKDVLIEGLERLEYRGYDSAGIALQDAGKLTVV
FT                   HRVGKVSGLAEVVRFLDNPGTCGIGHTRWATHGAPSERNAHPHTSCNGDIAVVHNGIIE
FT                   NFAELRERLEKAGHVFTSDTDTEVVAHLIEEAYEGDLRAALAAACSQIVGAYGLAVVCA
FT                   QEPGRIVVTRKDSPIVLAHGDAGSYVASDIIAVIEASRDVTVLGDGQFAIMEPDGISYT
FT                   DAEGNPIEPKIMHVDWDIDVAEKGGYPDFMMKEIHEQPRVVRDTLAGRMTNGVLSIEEL
FT                   GMTLEELRLIDRVYIIACGTSYHAGLIARQLIEGWSRIPVEVEVASEFRYRNPIITPST
FT                   LVVAVSQSGETADTLAAIRDARIKGAKVFGITNVIGSPVARESDGVIYTKANKEIAVAS
FT                   TKSFLGQVVSLTLLAMVFAQAKGKLSIPQIRLLFKELADTAEQIEMVLSDTTDIDRAAL
FT                   ACKDAHDALFIGRGMGAAICYEGALKLKEISYLHAEAYAAGEMKHGPIALLTDGFPVIA
FT                   VATQSPVYDKVVSNIQESKARGALVIAVATEGDEEISRYADYVMYVPKVRDAFSPIIAS
FT                   VPLQLFARAVAIARGCDVDKPRNLAKSVTVE"
FT   gene            559231..559770
FT                   /locus_tag="Ccur_04710"
FT   CDS_pept        559231..559770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04710"
FT                   /product="phosphopantethiene--protein transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase
FT                   superfamily; TIGRFAM: phosphopantethiene--protein
FT                   transferase domain; holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94193"
FT                   /db_xref="GOA:C7MMQ3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ3"
FT                   /protein_id="ACU94193.1"
FT                   /translation="MRSAATPQATAGAVGLGVDLVNIERMQKVIGRSPTFTTRVFTVDE
FT                   RAYCDSTAQPHVHYATRFAAKEAVLKALGTGIAQGIAPADVEVVRLSTGAPKVRLHRRA
FT                   AELAKHKGVRDIPLSLSYTHLDAVACAMVITDDSQRAQAERVDPMEELMRQFKEARTWL
FT                   DDIPAPISNQTEALAQ"
FT   gene            559767..560645
FT                   /locus_tag="Ccur_04720"
FT   CDS_pept        559767..560645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04720"
FT                   /product="yjeF-like protein, hydroxyethylthiazole
FT                   kinase-related"
FT                   /note="PFAM: Carbohydrate kinase; TIGRFAM: yjeF C-terminal
FT                   region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94194"
FT                   /db_xref="GOA:C7MMQ4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ4"
FT                   /protein_id="ACU94194.1"
FT                   /translation="MRSYDASSLAQLLPYPQREANKYTRGKLTLLVGSRTYPGAAGLAA
FT                   LASQRAGAGYSEVYVEDSVVSQLQIYHPSLVVKEWSAWDMTDEVASTAKRPHAYVVGSG
FT                   FDSQDPFIAGITHRLLKRAQAPVLVDGGALKLMPARKIRDLCKRRYEKGFATVITPHGG
FT                   EAKVMASVFALPTDDPEELSLTLSQAYGAITVLKGPDTYISDGDSTYRMEEGTAALSKA
FT                   GTGDVLAGVIGAFMAQAMDPVDACVLGTTLHARSGVLAARDLGPISVCAEDVIQYLPQA
FT                   IRALENERTVS"
FT   gene            560746..561279
FT                   /locus_tag="Ccur_04730"
FT   CDS_pept        560746..561279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04730"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94195"
FT                   /db_xref="GOA:C7MMQ5"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ5"
FT                   /protein_id="ACU94195.1"
FT                   /translation="MPSARWKNDWDLVIGGVALLVIGLVCLFYPGMTLAILAMLVGVGF
FT                   LVAGAASLVSYLRLRTYLLPVRWTLGYAIVDVVIGLVFLLHPLAVQAVLPWLCGLFVLL
FT                   LGVYEMVAALGLRAVAVDAWRWAFASSLISILMALIFFFVPQILAILIGLFAVMQGISF
FT                   IVYGYSFSSSELMR"
FT   gene            561279..563456
FT                   /locus_tag="Ccur_04740"
FT   CDS_pept        561279..563456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04740"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="PFAM: BRCA1 C Terminus (BRCT) domain; NAD-dependent
FT                   DNA ligase adenylation domain; Helix-hairpin-helix motif;
FT                   NAD-dependent DNA ligase C4 zinc finger domain;
FT                   NAD-dependent DNA ligase OB-fold domain; TIGRFAM: DNA
FT                   ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94196"
FT                   /db_xref="GOA:C7MMQ6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ6"
FT                   /protein_id="ACU94196.1"
FT                   /translation="MADDATPTLFDQDDVGARIEALRREIEHNSWLYYAQDAPAISDAA
FT                   FDSLMRELRQLEAEHPEFYDPTSPTQRVGGYVGEQFAAVTHAERMYSLDNAMDLDELDA
FT                   WMDRTFEALGTDVPLCCELKIDGSGIAVTYEDGRLMRAATRGDGVVGEDVTANIRTVRD
FT                   VPLRLRAEALDALTDVEEALELRGEVYMPKKSFNALNAAADREGRQEFANPRNAAAGSL
FT                   RQKDPTITAQRDLSTFTYATASNAALTLPGQWELLEWMRNAGFHVNPDVRLCHSRDEVR
FT                   AFCKEALDKRQSLPYEIDGVVVKVNDFSLQDRLGFTARAPRWAIAFKFPPEEKTTLLRD
FT                   ITVQVGRTGALTPVAELEPVSVSGSVVSRATLHNEDEVRRKDVRVGDTVIVRKAGDVIP
FT                   EVLGPVLSLRPADAQPWHAPTSCPSCGSPVVREEGGAILRCVSLDCPAQAHERLIHWAS
FT                   RGALDIEGMGEEVIGRLLESGRVVDVADYYHLTEYDLATLDMGRVNKDGEAIHLGSTVA
FT                   AKIVGQIDQSKHRGFARVLFGLGIRHVGKTTAEAIAQAYPSIEALREAKMDDLAAIEGI
FT                   GPIIAESLFVFLRTPQNVQVIDRLLAAGVVMEEAALTPRAPQTLSGLTFVLTGSLVQSG
FT                   MTRTEAGDALKAMGAKVSGSVSGKTSFVIAGEAAGSKRDKAVSLGVPVIDEAAFLHILE
FT                   TGQAPAGSDLASQAAAHQDFNDSESDDSDAH"
FT   gene            563586..564317
FT                   /locus_tag="Ccur_04750"
FT   CDS_pept        563586..564317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04750"
FT                   /product="hemolysin A"
FT                   /note="PFAM: FtsJ-like methyltransferase; S4 domain;
FT                   TIGRFAM: hemolysin TlyA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94197"
FT                   /db_xref="GOA:C7MMQ7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ7"
FT                   /protein_id="ACU94197.1"
FT                   /translation="MQRMRLDDVLVERGFADDRAAALRIIIAGEVKVDMQVAKSAAMHI
FT                   APDSALEVKSHSRFVSRGGEKLQAALEAFDQQVEGLRCIDVGSSTGGFSDCLLQAGARA
FT                   VTCVDVNYSQLAWSVRTDTRVTVFERTNIRQADPAVLGAPFDLIVADLSFIGLARLARV
FT                   FARLGQEGSVFIGLVKPQFESKQGEADGGVVTDEAVRLRTVHEVEDALATAGFTVTGVI
FT                   ESPITGKRSGNVEYLVRAVLK"
FT   gene            complement(564534..566255)
FT                   /locus_tag="Ccur_04760"
FT   CDS_pept        complement(564534..566255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04760"
FT                   /product="predicted xylanase/chitin deacetylase"
FT                   /note="PFAM: Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94198"
FT                   /db_xref="GOA:C7MMQ8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ8"
FT                   /protein_id="ACU94198.1"
FT                   /translation="MEEQSKYENHHRERPVVHKRTKRTEREKHNAEAEGNLPSTHDQDT
FT                   ASFPPVTSQPETMPKDSYRGQRPHLTSVPDPQVTAHASISSENNLAHETSSATREPRQH
FT                   RAPISQVSSVESASAVAQGNNTAAPNAAQGDNVKAPSAMSGSNPAAAVHAQSYQESTEQ
FT                   GSSFVPVGAHIRDYNMAAAHSRQHLGIGVKIFFVLIAAGVVAIVCWWMLFSPISITLNG
FT                   KMTTVDRGSNVSAIVKSQNVNVSPGRLLAVDGSVIDQTGGETFTATLDGQAVNGNAGVK
FT                   ENSTLTITDGADKTEDYTETTKPIPSQWVDDGTRGAFHEVVGEAADGIAATRTGKTSGI
FT                   TVDNQVVKEPVNPTLTRYSIDTGGEKVIALTFDDGPWKDQTAELLDILDQNNAKATFFV
FT                   VGNRIGDTPGGGDLVKREYDSGHQVSSHTWDHAAGSGKGVNLGYMTEDEQINEIVKGQQ
FT                   AITDATGVEANKIVRTPGGNYSLETAQIVHPYVDVEVDWNIDTEDWRRPGAAKIESAIL
FT                   SAKPGNVILMHDGGGDRSQTVQAVADALPKLREQGYRFVTIEELWEYHKKAQQQSN"
FT   gene            complement(566310..567674)
FT                   /locus_tag="Ccur_04770"
FT   CDS_pept        complement(566310..567674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04770"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized ACR (DUF711)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94199"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMQ9"
FT                   /protein_id="ACU94199.1"
FT                   /translation="MQITPEEVSETLAMVSQQHLDVRTITLGLNLRSCTDEDINIMARK
FT                   VYDRMTHAAENLVPTAEQLEREYGVPIVNKRISTTPIAEICAATKATDFTPIAEAMDKA
FT                   GKAVGVNFIGGFSALVQKGATRADEVLMDSIPAALSATDFVCSSVNVASTRAGINMDAL
FT                   WKMANTVIACAKQTAEHDSIGAAKLVVFANAVQDNPFMAGAFHGAGEADEVINVGVSGP
FT                   GVVRNVLADLPESASMTEIAEAIKATAFKITRVGELMAREAADRLGYQQGILDLSLAPT
FT                   PAIGDSVADILETIGVGRCGGPGTTAALALLNDCVKKGGVMASSSVGGLSGAFIPVSED
FT                   AGMIRAAQDSTLSLEKLEAMTCVCSVGLDMIAIPGNTTPETIFGIIADEAAIGMINNKT
FT                   TAVRVIPAIGKKAGDTLEFGGLLGSAPVMPVNQYAGSVFAHRGGRIPAPLNSLKN"
FT   gene            568008..569345
FT                   /locus_tag="Ccur_04780"
FT   CDS_pept        568008..569345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04780"
FT                   /product="Na+/H+ dicarboxylate symporter"
FT                   /note="PFAM: Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94200"
FT                   /db_xref="GOA:C7MMR0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR0"
FT                   /protein_id="ACU94200.1"
FT                   /translation="MQNSKSQAQPWFKKIGTTGWIFIGLVLGIIVGVLCNVFVPNESVL
FT                   FTYGVNGVCYVVGKGFIRLMQMLVVPLVFCSIVCGAASMGSGAMLGRVGGLTIVMYILT
FT                   TLVAITLALGVGFLVNPGIGLDLGSIAQVELKTSASTSVADTLLNIIPSNVVDAMANGT
FT                   MLQIIFFALVLGFLLGKLGTRVDVVNRFFHQFNDIMMSMVSLVLAVAPIGVFCLIVNTF
FT                   SNLGLAALFPLAKYVGGTYIGLFVQLFITYLLLLALVARVNPLRFFRKMLPVMGFAFAT
FT                   SSSNATIPLNMETLEKKIGVDPQISSFTIPLGATINMDGTAIMQGVAVVFAVQAFGIDL
FT                   GFSGYLTVILTATLASIGTAGVPGVGTIMLTMVFQSVGLPVEGVSMLMGVDRLVDMGRT
FT                   TINITGDAVVTTCVARINNMFNRDLFNKSDGDTGQDSGSTSAPTAA"
FT   gene            569349..570104
FT                   /locus_tag="Ccur_04790"
FT   CDS_pept        569349..570104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04790"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94201"
FT                   /db_xref="GOA:C7MMR1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR1"
FT                   /protein_id="ACU94201.1"
FT                   /translation="MEFLIVCPLAFLAGFVDAIAGGGGLISLPAFLFAGLPVHAAIGTN
FT                   KLSASMGTAVATIRYALSGYMVWPLAGVGIAMGLLGSWSGSNLALLTDDTAFKLIMLVI
FT                   LPFVAFHVLRTKDLSAQADHPYSLVPSLVITGIIAGVVGIYDGFYGPGTGTFLMLLLTA
FT                   VGHQDIRCAAGTTKAINIATNISGLVVFLVNGVVWLPLGLAAGAFSIAGNWIGAGHFTK
FT                   KGSAITRPIMLVVIVLFAIKLVVDLITSL"
FT   gene            570248..570619
FT                   /locus_tag="Ccur_04800"
FT   CDS_pept        570248..570619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04800"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94202"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR2"
FT                   /protein_id="ACU94202.1"
FT                   /translation="MAYTKDPSALTEPTFYILLCLHEPRHGYAIMQHVHELTEGRVNIG
FT                   AGTLYGALNSLIEKGWIRAADASQSSSRRKQYIVTDEGKQAFLAEVKRLSSLIADAQDV
FT                   VGGINTNSMELNSTNSSDF"
FT   gene            570669..571226
FT                   /locus_tag="Ccur_04810"
FT   CDS_pept        570669..571226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94203"
FT                   /db_xref="GOA:C7MMR3"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR3"
FT                   /protein_id="ACU94203.1"
FT                   /translation="MSTTLKKTFTDFSAEEAWLNEMSAKGQALVAYRGMSGYTFVAAEP
FT                   GAWQYAIEILDGKGTTRDNYLSFLKDVGIEVVSIYACRAYLRKKNDGVPFELHSDLKSR
FT                   LEQAQKGNIPWTSIPLSQVVLALILITSVFSQVPESSNVAKGIVIGMAIILVTVAAIEF
FT                   FIYGKPYRRRIRELKQAIMIKE"
FT   gene            complement(571282..572052)
FT                   /locus_tag="Ccur_04820"
FT   CDS_pept        complement(571282..572052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04820"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF364)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94204"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR4"
FT                   /protein_id="ACU94204.1"
FT                   /translation="MADMDPWYIYDTLIEGVPEGIPVTDYCIGSNWCYVDAGCGCGISH
FT                   AVRGGGRRTFREDPCSIDLHALAKLAKSWNFEEATLGTAALNAWYSRREAIEEKGTFID
FT                   TEHVGRAEESNPFTLLKESYTGEKVTVVGHFPNVNSMFATADVTVLERNCASPLDTPDS
FT                   ACEYILPQQDYVLMTGTTFINKTMPRLLELSQKATTIVVGPSAIPSVVLAEAGAQAIAG
FT                   SVVVDKEPAKASIKGGTKEQWRTGIKKFFWTPQD"
FT   gene            572559..573245
FT                   /locus_tag="Ccur_04830"
FT   CDS_pept        572559..573245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04830"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94205"
FT                   /db_xref="GOA:C7MMR5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR5"
FT                   /protein_id="ACU94205.1"
FT                   /translation="MPLTVEKPVAVVAEKPVAILESNPTTTARTCTDRRSARSQAALRR
FT                   ALIELIEQEGLDAITVGDICLRADLTRGTFYNHFKDKEALLSALEFEVIADLEHLQARL
FT                   ADMNVTALAWYVARKKPLPFLVELFDYLRLQGDFLHAVLGPGGDASFGARLRDSVCTCL
FT                   IESILHEQYRTNPTPFVGYYVAFFASAYLGVINRWIETGMKENSEEMALIAQRLLFIKP
FT                   GESISL"
FT   gene            573316..578301
FT                   /locus_tag="Ccur_04840"
FT   CDS_pept        573316..578301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04840"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /note="PFAM: CoA enzyme activase uncharacterised domain
FT                   (DUF2229); BadF/BadG/BcrA/BcrD ATPase family; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94206"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR6"
FT                   /protein_id="ACU94206.1"
FT                   /translation="MEATEKTTLSVQENVPEQAVASVQESAPAQSPTAVQDTPSIQEGT
FT                   AVQDTQPAQEDATAQHIPSAQEAASTQKAITGNLHIGIDVGSTTVKLAILDDENQVRYS
FT                   IYQRHHADVRATIVEVLKKAAEEYGEETMTTAITGSGGLLLGQWLSIPFIQEVIASKTA
FT                   VETFIPQTDVAIELGGEDAKIIYFDNGIEQRMNGTCAGGTGAFIDQMAALLDTDASGLN
FT                   ELAARHTILYPIASRCGVFAKTDVQPLLNEGAKKEDISASIFQAVVTQTISGLACGRPI
FT                   RGHVAFLGGPLQYLPELRKRFYETLNLDDEHIIVPENAHLFVAAGCAIAGIGETDPERL
FT                   NDIVARLESLGDLQGTEVVRLPPLFANDEEFHEFEQRHAKEKVRRRDLASFEGKAFLGI
FT                   DAGSTTFKAALVAEDGSLLWSYYTSNKGDVLETAKAGVQKLYNELPRHADGSCPVEIGH
FT                   ATVTGYGEGLLLEALRVDSGEIETVAHLRGAQEMLPDVQFILDIGGQDMKCLRVKDGVI
FT                   DSIMLNEACSSGCGSFIESFAAGLNLPVREFAVTANSAKNPVDLGSRCTVFMNSRVKQA
FT                   QKEGATVGDIAAGLAISVIKNALFKVIKMRDPHDVGTQVIVQGGTFLNDSVLRAFEQLS
FT                   QVNAVRPDIAGNMGAFGAALLARDRYRDAVRRAEASGASAATVTTTLLGSEALSVLSPT
FT                   HRTLRCKACGNHCLLTVNDFGVDETTGKHRRFITGNRCEKGLGQVSARSAVPNMFEWKS
FT                   HRLFDYEPLAASDAPRGRVGIPRALNMYENYPFWFTFFTELGFRVEVSDPSTKKTYEAG
FT                   IESIPSENACYPAKISHGHIMNLLAKHPDFIWMPCAKWERQEDEGAGNHFNCPIVMSYS
FT                   ESLRLNIDELHTSDVAFLNPFLPYDQKDKLKKRLYVELVENHPEIMAKYGPAPKRRDID
FT                   RAVDAAWEEDLKFKDDVHKKGEEVLHWMEEHQSHGIVLAGRPYHNDPEINHAIPELLCG
FT                   FGLAVLTEDAVAHLGKLERPIRLVDQWMYHTRLYAAAKFVTERNDLDLIQLNSFGCGLD
FT                   ALTTDQVQEILEASGKVYTVLKIDEVSNLGAARIRVRSLLAALKEQQDERAEAQSAPSC
FT                   PAGALADKLVADFEARRAASDGSFEAEAARKLVAAGVTGAAATAGATAETVHESSTEKT
FT                   GAQSESGSQTSDSVASGKEASTIASQRSSASTEFPRVEFTQAMKDAGYTILAPQMAPIH
FT                   FDLLLPIFRANGYNLELLPSVDHGAVDAGLRYVNNDICYPSILVTGQIMEAVTSGRYDT
FT                   DKLAVLITQTGGGCRATNYISLIRKALRAAGLGHIPVISLALQNNLDESNEGFKITPSM
FT                   LQQALYALSYGDLLMTALYRCRPYEAEPGAAENLFNQWMATCAKQIESGENRKRFARTV
FT                   RAIVDDFDTLPLVGEGSKPRVGVVGEILVKFHPTANNQLVDQIEAEGCEAVVPGLIEFF
FT                   LFGIAGRIFQKDPLGRSGKGALAARGILKYIESVRRPVFEAMEASNRFEPPTDIFTLAD
FT                   YAEEILSLCNSMGEGWLLTAEMVELIRHGAPNIVCAQPFACLPNHVVGKAVIKELRRRY
FT                   PESNIVAVDYDPGASEVNQLNRIKLMIAVAKANLAEAEQDARQARTASYEKPQPACVAC
FT                   GIDWDIEAARIEEEVRQRELVKR"
FT   gene            578304..579203
FT                   /locus_tag="Ccur_04850"
FT   CDS_pept        578304..579203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04850"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94207"
FT                   /db_xref="GOA:C7MMR7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR7"
FT                   /protein_id="ACU94207.1"
FT                   /translation="MAMGTLFLCPTPLGNLGDMTPRALDALRGANTVLAEDTRVTGKLL
FT                   AAFDIKAHLERMDEQMLSRKVDQIVDRLVAGETMAFCSDAGMPGVSDPGSRLVAAARSA
FT                   GVSVCVLPGATATATAYVASGFSCPRFYFGGFFPRKATAATHLLESVASLDAVLLFYES
FT                   PHRLVAALKRIASVYPHRRVAVCRELTKIHEEVQVGYSGEIADLFAHRAKKEPIKGEIV
FT                   IVIDAPSADEAADRCKDAASSAAARAVELVMNERHSCKDAATALQHEFGLSRNAAYEIA
FT                   QQARSSGNFPKITSDDHE"
FT   gene            579324..579878
FT                   /locus_tag="Ccur_04860"
FT   CDS_pept        579324..579878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04860"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="PFAM: Protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94208"
FT                   /db_xref="GOA:C7MMR8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR8"
FT                   /protein_id="ACU94208.1"
FT                   /translation="MIEDNLTFVDGIEVRIHRKCVKNLRIRVVAPDGHVEASTPLCMSR
FT                   AQVEAFVRSRAEWIARQQQRLQTSPQRIAELASKEECAAWRDLIAALVPPLVEKWEEVL
FT                   GVHAGSLAYRNMRSRWGSCQPETGRICINTRLALYPPECLEYVVVHELAHLLEANHGPA
FT                   FYAILDRALPTWKSARDKLRS"
FT   gene            580085..581209
FT                   /locus_tag="Ccur_04870"
FT   CDS_pept        580085..581209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04870"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="PFAM: Cation efflux family; TIGRFAM: cation
FT                   diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94209"
FT                   /db_xref="GOA:C7MMR9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMR9"
FT                   /protein_id="ACU94209.1"
FT                   /translation="MADNQREHIIIRTSLIGIIGNIALAAVKAVIGLVSNSIAIVLDAV
FT                   NNLSDALSSAITIIGAKLAGRTPNRAHPFGYGRVEYFSTILIGVIVLFAGITSLRESFG
FT                   RIIAPETPSYETISLVVIAIAVVAKVALGRYFTLRGKAASSASLVASGTDALMDAAISA
FT                   STLAAALAFIFFGISLEAWLGALISLVIIKAGFDILREAIGKILGERIDADVASSIKQT
FT                   VCSVKGVRGAYDLILTDFGPERLWGSIHVSVDEHMTAEEIDSLTRRIETEVTKKHQVFL
FT                   HTVGIYSANASDVADPEVKRVRQIVEEITSAHSHIKEVHGLFIDPSVKQVSFDVVIDFD
FT                   APDRQGEWQEIYSAAKRALPDYKVRVALDADISD"
FT   gene            581550..582632
FT                   /locus_tag="Ccur_04880"
FT   CDS_pept        581550..582632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04880"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94210"
FT                   /db_xref="GOA:C7MMS0"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS0"
FT                   /protein_id="ACU94210.1"
FT                   /translation="MVKRLVGIGACGVVLSALICMQLASSAYADTDELSELQQQVESTA
FT                   KDYDDALARLDDLNAQIAENQARLDEINQSLPGQQQRSAVSLKTLYILQQEGGSLIDLV
FT                   LDSESIADFIQRIEYLDCIHDHNTAEVRKLDALKSELEAVQSDLSSQQKEVQQAADRAE
FT                   RTLKSAQSAREEAEQRAIALAAAQAAEAKQQAQEAAVAQVATEAGQDAANTAVDNSSQD
FT                   TSANYSGTVKSDDVDWSSDKKAFVNKWSGRIDSYLSGSPLAGQGQVFAEAAWDYGVDPR
FT                   WSPAIAYKESSLGAHCFKPHNAWGWGSSSWSSWDEAIRAHVSGLARIYGSTLTPEAARK
FT                   YCPPNSTDWYNTVLSQMQSI"
FT   gene            582793..584373
FT                   /locus_tag="Ccur_04890"
FT   CDS_pept        582793..584373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04890"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="PFAM: tRNA synthetases class I (M); TIGRFAM:
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94211"
FT                   /db_xref="GOA:C7MMS1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS1"
FT                   /protein_id="ACU94211.1"
FT                   /translation="MSKGTFSITTPIYYVNAAPHLGTAYTTIGADVLSRYKRMDGYDVA
FT                   FVGGMDEHGQKVADTAAKKGMTPQAWCDSMEPAFLDAWNLLDITYTDIVRTTEERQTRT
FT                   VQRFWGDLYEKGWLYKDSYDGWYCVHEETYYAESDLEKDEDGTFVCPECHRPVQKASGE
FT                   ENWFFKLSEFQDRLLAFYDEHPDFIQPLTRRNEIVSFVKGGLKDLSISRSTFDWGIPLP
FT                   FDTGHVAYVWADALLAYFTGIGYADEARAGEFEARWPMQYHFVGKDITRFHCVIWPAML
FT                   MAAGLPITHKVFGHGFLLTKGEKMSKSKGNGVMPADLVRIFGVDAYRYYFMSDVQFGHD
FT                   GNISMERMVQVYNADLANTWGNLVSRVFNMTGKYFDGKVPEAPSSAVENPLRELANNLY
FT                   ETYDACMAAVDFTGAAAAVQQLASRVNLYVEDSAPWNLAKDPARADELAAVIYNALEAC
FT                   RIIALFMSPFMPRTSDEVFHRLSLDAASDSTDIESQSAWGLLPAGNAVEKGEPLFPRLD
FT                   LEAIDLNLE"
FT   gene            584387..585352
FT                   /locus_tag="Ccur_04900"
FT   CDS_pept        584387..585352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04900"
FT                   /product="Mg-dependent DNase"
FT                   /note="PFAM: TatD related DNase; TIGRFAM: hydrolase, TatD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94212"
FT                   /db_xref="GOA:C7MMS2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS2"
FT                   /protein_id="ACU94212.1"
FT                   /translation="MASEQEDQPVFYDALIHQRRRHGHYRTIDGPLPPLEHPLADSHCH
FT                   LASLSQRDLSLARAALWKVDFICDITDPVEDAGRTYTQLPAWELSARSWMSVIAPETEA
FT                   SLSRIRLACGCHPHNAKDFTEFVEARLITHLKDERTCCVGEVGLDYHYDLSPRDLQQRV
FT                   FRRQIRLAHESGLPIALHVREAHEEALAILDDEGFPAAGTILHCCSLSPHDLEPWLDRG
FT                   CSIAYGGALTFKKLDEAREGMKMVPIDRLLLETDCPYMTPEPLRGTENSPEFIVFTAER
FT                   LAAERGISAGDDRRDFLATLHANTLSLLDRPATSWQTHTS"
FT   gene            585352..585921
FT                   /locus_tag="Ccur_04910"
FT   CDS_pept        585352..585921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04910"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94213"
FT                   /db_xref="GOA:C7MMS3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS3"
FT                   /protein_id="ACU94213.1"
FT                   /translation="MCGSPADGICRRAAQTALHLLAEQHPTDEVKLIDVAALNMSWCVG
FT                   CNRCKDLGRCFMRDDMDEVIATLSRASSLSVVAPVYFAGPSAPYKALLDRLQPLFWNRM
FT                   HNAGKTDVRRSARLLVVGQGGDPHGFDPLVVCTRSALAVAGFLLDVVEACIGQDAEEIL
FT                   RRVPAWIGCSHDKIADEVQGGFSYGC"
FT   gene            585911..586801
FT                   /locus_tag="Ccur_04920"
FT   CDS_pept        585911..586801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04920"
FT                   /product="dimethyladenosine transferase"
FT                   /note="PFAM: Ribosomal RNA adenine dimethylase; TIGRFAM:
FT                   dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94214"
FT                   /db_xref="GOA:C7MMS4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS4"
FT                   /protein_id="ACU94214.1"
FT                   /translation="MDAEGERLSPLASVRATRAVLEAHGLATKKALGQHFLINEGVVRR
FT                   ICDVAELSCEDDILEVGPGIGTLTVALLHCARRVAAIERDVDLPAVLAETCDFAHDRFE
FT                   LIRCDALSVGPDDLSFAPNKLVANLPYAVAATLVLDVFERFNSIQSATVMVQSEVADRM
FT                   AAHPGTKNYGAFTVKLALFAHPVSRFTVAPTNFFPPPRVQSTVIRLDRAEQDNLSPDER
FT                   RCARMMADAAFATRRKTVANSCRAYFAGRVDAASIDQVLAASNIDPRRRGESLSLEEFK
FT                   CLGKQAYKMGLLSRQ"
FT   gene            587194..587529
FT                   /locus_tag="Ccur_04930"
FT   CDS_pept        587194..587529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04930"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF1021)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94215"
FT                   /db_xref="GOA:C7MMS5"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS5"
FT                   /protein_id="ACU94215.1"
FT                   /translation="MELEKQIQIIDAIRTHLDGLVGQRLSVRANMGRSKIIESEGVLVQ
FT                   IHPQLFIMEVEHRRGRKARQSYQYVDILTGTVELSQDGESLFAALISELAQDPEEQKEP
FT                   ILSVAEN"
FT   gene            587635..587710
FT                   /locus_tag="Ccur_04940"
FT   tRNA            587635..587710
FT                   /locus_tag="Ccur_04940"
FT                   /product="tRNA-Ala"
FT   gene            587924..588835
FT                   /locus_tag="Ccur_04950"
FT   CDS_pept        587924..588835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04950"
FT                   /product="rRNA methylase"
FT                   /note="PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94216"
FT                   /db_xref="GOA:C7MMS6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS6"
FT                   /protein_id="ACU94216.1"
FT                   /translation="MEQIYPHTPDSALSLQSAYAPSAGLELIHPDTIDDSRLDPYRRTS
FT                   DMLLRERGLFIAESDKVINRALDAGVHLRSLFLEEKWLAKTRPVLDRLGHEHTAKAIPV
FT                   FIVTHEQFRAVTGYEVTRGALAVFERLVLPRPEALLKNARRVAILEDIVNYTNIGAAFR
FT                   SAAALSIDAVLLTPSCHDPLYRRAARVSMGTVFQVPWTRIGAKAHSGSTGDWVESGIDL
FT                   LHRFGFKTVALALDDDALPLNDARFAACERLALVLGTEGDGLAEQTRMLCDWMARIPMA
FT                   PGIDSLNVAAASAVAFWETRIR"
FT   gene            589248..589970
FT                   /locus_tag="Ccur_04960"
FT   CDS_pept        589248..589970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94217"
FT                   /db_xref="GOA:C7MMS7"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS7"
FT                   /protein_id="ACU94217.1"
FT                   /translation="MSEEKKEQETTTEQTTTEEQQAAAEPAAKKKKWPIIVGVIVIVVA
FT                   VAGIGFWNWHNQPTFCNAFCHESMNAYVETYEQDANTQGTDKWGNAVSNTNAMLAVTHK
FT                   EAGVNCLGCHVPTITQQLTEVSETITGDYYYPLEEVGTKALQANSGHDDSSGDQFCLKS
FT                   GCHDMTREDLTQATSGMSFNPHRWQHGETECSECHKSHRASVFYCTQCHSEAAAAMPDG
FT                   WVNYSEGQQLEKNSVNAS"
FT   gene            590035..590211
FT                   /locus_tag="Ccur_04970"
FT   CDS_pept        590035..590211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94218"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS8"
FT                   /protein_id="ACU94218.1"
FT                   /translation="MSVGPFVFCQTRFFTEALRRHGGVYYPNTIAQAYFFRHTAIVMGI
FT                   CLDADSSKEKRYR"
FT   gene            590208..590879
FT                   /locus_tag="Ccur_04980"
FT   CDS_pept        590208..590879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04980"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94219"
FT                   /db_xref="GOA:C7MMS9"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMS9"
FT                   /protein_id="ACU94219.1"
FT                   /translation="MNAKTKRRLVVVTGIIVMVMVVVLAFVASSSTAKTVSVDEAASGQ
FT                   VSNQRIQVTGNVLKDSYAIEGNTLAFTIYDPDNAEASTLPVTYDGAAASTFGNDVTAIC
FT                   TGKVGDDGVLRATELVTKCPSKYESGTSALTVSRLVGYDQGIVDKTVRVTGSVVAGSQN
FT                   AAGQGDRFVLADTDDPSQTISVIYDGAASDAMLADGSQVVLTGNVGSDGKFSATDIALQ
FT                   S"
FT   gene            590911..593043
FT                   /locus_tag="Ccur_04990"
FT   CDS_pept        590911..593043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_04990"
FT                   /product="cytochrome c biogenesis factor"
FT                   /note="PFAM: Cytochrome C assembly protein; TIGRFAM: c-type
FT                   cytochrome biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94220"
FT                   /db_xref="GOA:C7MMT0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT0"
FT                   /protein_id="ACU94220.1"
FT                   /translation="MAIFGLMGLLVAFAGVAVSVVCLIAGMIVRQRGSHSTGETILWGG
FT                   HVAVVVAFVALTFCCVLLVVAFVSGDTSIEYVVKGSSKQTGLMGTFFRISGLWEGREGS
FT                   LLFWGWLISLFATVISIRDMKRMDKLDSVALIVMQIVLAGFVGILLFSESNSPFVAMAA
FT                   SYFDADGNLTGAASLWGMNPLLEHWAMAVHPPALFIGYAGLTVPFAYAVATLVVGDSSD
FT                   TWVRKCQRYLMVSWLLLGIGIGLGSVWAYVVLGWGGYWGWDAVENASLLPWLVGVALIH
FT                   SLTVYRQRGAFKRWSIMCACITFAFVVLGTFISRSGLIQSVHAFAGDPVSLYLFGTLIV
FT                   VSILAGAIGLAFRWKRFGAKSVSDEDVDSLASREAAYYFNNVIMVILAVLICYLTVASA
FT                   LPRWLPFGGSAVSTGTFDAIARPLGIIYCAVVAICPLLGWAKTDRVLFLRRAKLPAICA
FT                   AVLFIVLMCYWWFYLCPTYDAAVAAGGSTAEGYLAAGPAFYYKGLAAVGFLVASLLLFN
FT                   TLFMCARTVSDWSRSRGVNPVVGFFKMIAHNASRVGGFISHFAMAIILIGLICSSMFVT
FT                   EKTGYIPYDSTNDTAPDFTIQDFTLKYTGNSIVEGDSGNDIYYTVEYDVYRNDSYVGHV
FT                   SPNVQLVKSTQQTKSNTGVIHFADEDLFVIYKGVNGNGAFSMDVRVNPQISLVWAGFAL
FT                   LIVGAGVAAFGGRGRN"
FT   gene            593057..593827
FT                   /locus_tag="Ccur_05000"
FT   CDS_pept        593057..593827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05000"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94221"
FT                   /db_xref="GOA:C7MMT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT1"
FT                   /protein_id="ACU94221.1"
FT                   /translation="MVKAHADVAEADNNASMKEDNPILSLEGVSKVFGRRRAVDSITLD
FT                   VPRGAFVSVFGPNGAGKTTLLRILSTLSRPTRGTVRLAGIDVVANPDKARAHIGLISHQ
FT                   SMLYGDLTAQENLMLSARLYGIVDASARVDEMLEAVELSHRRLDVTRTFSRGMTQRLAI
FT                   ARAFLHDPDIVFLDEPYSGLDPHAVEIFDDLIERMRENRTFVMVSHDLSKGFASCTHAL
FT                   VMARGRNVAYARRDEIDYAAFEDLYRHTVGMGVA"
FT   gene            593827..594540
FT                   /locus_tag="Ccur_05010"
FT   CDS_pept        593827..594540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05010"
FT                   /product="ABC-type transport system involved in cytochrome
FT                   c biogenesis, permease component"
FT                   /note="PFAM: CcmB protein; TIGRFAM: heme exporter protein
FT                   CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94222"
FT                   /db_xref="GOA:C7MMT2"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT2"
FT                   /protein_id="ACU94222.1"
FT                   /translation="MAVETKTPSTFAQYRTLLGKDLRREFRTKEMLTSMGIYALLVLVV
FT                   YGAALSQTASGFDILQMSAGLLWALIVFTSLLGLNRSFAHERENGCLEGILLVPLDRSV
FT                   IFLAKATGNLVFLLVVELIILPLFAFFFLTTTTLAPTWPLIAAPLALGTVGIAGIGTLL
FT                   ATITASTRGKDVLLAVLFIPLVYPLLYACVSASTVVLAGGDIEGAFNLSLALAGGYDVI
FT                   MLLLSWVLYDFVVSA"
FT   gene            594785..595525
FT                   /locus_tag="Ccur_05020"
FT   CDS_pept        594785..595525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05020"
FT                   /product="ABC-type transport system involved in cytochrome
FT                   c biogenesis, permease component"
FT                   /note="PFAM: Cytochrome C assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94223"
FT                   /db_xref="GOA:C7MMT3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT3"
FT                   /protein_id="ACU94223.1"
FT                   /translation="MHNSLAARLTPFMLAVGALLTTAGFILAFTTAPPVNGATVDGVEM
FT                   IGDTLVSNQLLFSQKIFYFHMPVAIASFLALVGTAYCGIRFLASRDAAWDLRARVSTEV
FT                   ALIFVIMVMASGEMWERFEWGVWWTWEPRLTTYFILTLLVMGYFVLRAAVDEPERRAVF
FT                   ASVFGIIMFIDVPICFAITRLVPSGVHPTIFRTDSGLSPDMLMPLLLALFGMMFIAYGL
FT                   YLLRVRTAELENRLEHAKEILDEE"
FT   gene            595529..595747
FT                   /locus_tag="Ccur_05030"
FT   CDS_pept        595529..595747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94224"
FT                   /db_xref="GOA:C7MMT4"
FT                   /db_xref="InterPro:IPR030888"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT4"
FT                   /protein_id="ACU94224.1"
FT                   /translation="MNAVLEQIYATILPSAPYVIAAYAFMWLALLAYTVFLAVRLSRAE
FT                   AQMALLAAALDRRETNKTADILKKQED"
FT   gene            595751..596578
FT                   /locus_tag="Ccur_05040"
FT   CDS_pept        595751..596578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05040"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94225"
FT                   /db_xref="GOA:C7MMT5"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT5"
FT                   /protein_id="ACU94225.1"
FT                   /translation="MKAVIPAAGMGTRFLPATKAVPKEMLPVVDRPVIQYIVEEALDSG
FT                   ADEVIIVNNRTKQAIEHHFAPDAELEATLTARGKTALAEKVQHAGSLPVTFVYQDEALG
FT                   LGHAVHCAAAVTGGEPFFVLLGDVIAEDGSMLARMREISEAHEGANVIAVLPVAREEVS
FT                   RFGVISGSEVSAGVWKVNSLVEKPAVDEAPSNLTVFGRYLLSPRVMELLAGVAPGAGGE
FT                   IQLTDALDAVLAEEEMYALVIDDDDGFDTGTPETWLDANVRLAARSRKAHDIR"
FT   gene            596946..597842
FT                   /locus_tag="Ccur_05050"
FT   CDS_pept        596946..597842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05050"
FT                   /product="cobalamin-dependent methionine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94226"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT6"
FT                   /protein_id="ACU94226.1"
FT                   /translation="MPDIQMRFHHDMLTLSSPLESTLIAQGFDLSFGVSLLSVLEPEAV
FT                   SAALRLQVAAGAPCLVAPTAGVTHARLAHQRAADRDINIAQAAKSLATAFTTQHVLAEI
FT                   GATGLPIDPNSKSSLTANRDEYLRAARAIGDADIDAFFVNGLTGAADARCALMGVRQVF
FT                   ATPLIASVDVNEEGIANDGTGLEDIVAVMADLEADVVGFCTSADSEGAARLAQRAAHAC
FT                   DRPLLVQLNVQKQPSSTLFSHARGQLDIPYADPSSMVQAADCLRAAGAQFIRAVGAATP
FT                   AYAGALAAALAGTEPIR"
FT   gene            597848..598114
FT                   /locus_tag="Ccur_05060"
FT   CDS_pept        597848..598114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94227"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT7"
FT                   /protein_id="ACU94227.1"
FT                   /translation="MMRQPISNINRSEDYGVLQRLVNELYAHREYASRLDVVVLAESYD
FT                   LPADLDEIVSLLPSGVYIRQTLCDQLNSAITGHAWGQVYGTVE"
FT   gene            598837..600144
FT                   /locus_tag="Ccur_05070"
FT   CDS_pept        598837..600144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05070"
FT                   /product="Recombination protein MgsA"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94228"
FT                   /db_xref="GOA:C7MMT8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT8"
FT                   /protein_id="ACU94228.1"
FT                   /translation="MDTLFTEMEQEAKRKAAPLAVRMRPRSLDDLLGQQEAIGPGSWLH
FT                   AAIAADSLSSVILYGPAGTGKTSIAHIIAESTKAEFVEVSAIGGTVSDLRREIAAAEKR
FT                   LTSHGMRTILFVDEIHRFNRSQQDALLHAVEDRVVVLVGATTENPFFEVNSALLSRSRI
FT                   VELTSLSDEEIASVVQRALVDERGLAGAYSLDDEALDAIMQVSGGDARSALTTLELACD
FT                   MARAEDTHAITAAMVKKAVPHRAVPYDKNKDMHYDIVSAFIKSMRGSDPDAALYWLARM
FT                   IDGGEDPRFIARRILIAASEDVGNADPQAVLVAAAAFKAAEVIGYPECRINLAQAAVYL
FT                   ALAPKSNACEAGIDAALSEVRNGPVREPPSYLRDRHRPGSDQYGTYRYPHNYPGGWVDQ
FT                   RYLPEGLERGCFYHPTERGWEAYRVDAARRDRPDGE"
FT   gene            600222..600899
FT                   /locus_tag="Ccur_05080"
FT   CDS_pept        600222..600899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94229"
FT                   /db_xref="GOA:C7MMT9"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMT9"
FT                   /protein_id="ACU94229.1"
FT                   /translation="MDISSFAQAALPVVFAIVGIALVVLLIELVRTIRSARTMVDSVNE
FT                   KLTPTLSNIEKMTDDLMPAISKVDPLVERVQLTVDAANLELMRVDKILEDVSDVTDTVS
FT                   SATDAIDNITKTPSRIVTSLSEKVHGALTGNKPSSQSARLAAEHARAEREQEAANAVKP
FT                   STQPSDDSGATKVDVQTETTEQTAVSPQAETVEQTQVGAQTETKPSDSSANSDSTNSDT
FT                   QAL"
FT   gene            600904..602121
FT                   /locus_tag="Ccur_05090"
FT   CDS_pept        600904..602121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05090"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94230"
FT                   /db_xref="GOA:C7MMU0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU0"
FT                   /protein_id="ACU94230.1"
FT                   /translation="MSDHRAETSASSQVSKSPSLQSTVTNPWFYRAAMVWAAIGSIVLL
FT                   YLCGQVLTILAVPVGIAVWTAVIVFCLRNVVNRLVRYMPRAVAVSLSYVLMIVVFGLVV
FT                   WLMSSPFFGIGAQFSSIIESTPQLAGEISRWYTELSGTYPDIMQSPQVAQWLVDIQNSL
FT                   ITWTQQAASSGISGLASVGASAANSFICIGFALVVAYWVLLDAPAMGREAYRICGDAHA
FT                   AELRFIHETFTRVVGGFIQGTLLQCLIIMVLCMIVFFVLGVPNAMAFALICGILNIIPV
FT                   VGPWLGGVAAALAALSVGPWSALLSLVFTIAIQQVVYTFVSPKIMSSSVDVHPMIVIMA
FT                   MMCGSALGAQMSGFMGSITGMLLSIPLAAFAKALIVHVLERRTGRAIAASDGVLFKQED
FT                   TPPDAR"
FT   gene            602375..605011
FT                   /locus_tag="Ccur_05100"
FT   CDS_pept        602375..605011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05100"
FT                   /product="alanyl-tRNA synthetase"
FT                   /note="PFAM: tRNA synthetases class II (A); DHHA1 domain;
FT                   Threonyl and Alanyl tRNA synthetase second additional
FT                   domain; TIGRFAM: alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94231"
FT                   /db_xref="GOA:C7MMU1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU1"
FT                   /protein_id="ACU94231.1"
FT                   /translation="MTTAEIRERYLRYFESKGCKRMPSSSLIPDDPSLLLTSAGMVQFK
FT                   PYFLQQKHLEAPYIGTTTAQKCVRTNDIDLIGTDGRHLSFFEMLGNFSFGAYFKEEMCA
FT                   WALDFSLNELGLPKEKLYFTVYEDDDETIEIWKNLGIEASHISKMGEEDNFWRAGPTGP
FT                   CGPCSELYYDQGPEVGCGRPDCAPGCECDRFLEYWNCVFTQYDAQEDGTLKPLPKKNID
FT                   TGMGLERMAAILQSVSSNFDTDVLRGLVAVGERLSGRSYGASDADDRALRVMADHSRSM
FT                   TFMIADGILPSNEGRGYVLRRLLRRAVMKGHLLGIEGAFLGSFVDEIIQVMGSEYAELV
FT                   ENRDLIKRVVASEEERFGSTLRQGRAYLQEALDGLSGGLLSGEVAFTLHDTYGFPLEVT
FT                   QEICAESGIEVDVEQFNHLMDEQRSRARRATQDDAEAAWSTYDGSMAALLEQVGATVFT
FT                   GYDENKSAGHVRALLRDGESVCTLSAGEAGCVVLDRSPFYAEMGGQVADTGTITSPDGA
FT                   SCARVTDVKAPESGLIVHYVQVEQGSFTIDDEVIGSIDVARRERIRRNHTATHILHKVL
FT                   SEVLGNHVKQAGSYVAPNRLRFDFTHFEAIDRATLDEIENVANRVIMEAHPVHTYETTL
FT                   DEAREQGVTALFGEKYGEVVRVVDIDGFSRELCGGTHVRNTSEIGFVKIVSEQSTGANM
FT                   RRIEAVTSFDALAYTDRMRDELRQTAAVFGVPLFDVNERAAIATEQLKTLQAQAKRAKK
FT                   IAVASDIRTLVDKAISTSRAGYPVLIYRLDGMDAGSLRNTWDIARAHLGETCAVVLASD
FT                   NEGKPLIMAAGTDAAVAAGFDAGAIIKEVAGAISGGGGGKPSMAQAGGKDPAGLDEALD
FT                   IARRMLL"
FT   gene            605021..605443
FT                   /locus_tag="Ccur_05110"
FT   CDS_pept        605021..605443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05110"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="PFAM: Uncharacterised protein family (UPF0081);
FT                   TIGRFAM: conserved hypothetical protein TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94232"
FT                   /db_xref="GOA:C7MMU2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU2"
FT                   /protein_id="ACU94232.1"
FT                   /translation="MRVLSLDIGQVRCGIAISDPTGRVASPVCVLPSGEVIGCARSFKR
FT                   LLDDWQPDLLLAGLPLTLSGSSGGQAQRIRAQAQQIADTSGLPLEFVDERLSSQEAKRM
FT                   LREEGLTERDMRGKIDMIAASIFLQAWLDRQRAKKR"
FT   gene            605458..606669
FT                   /locus_tag="Ccur_05120"
FT   CDS_pept        605458..606669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05120"
FT                   /product="conserved hypothetical protein TIGR00247"
FT                   /note="PFAM: Aminodeoxychorismate lyase; TIGRFAM: conserved
FT                   hypothetical protein TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94233"
FT                   /db_xref="GOA:C7MMU3"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU3"
FT                   /protein_id="ACU94233.1"
FT                   /translation="MALHRQVTYSSRPNRAARMAHAKGERQFRTYDTSLIQPRHSRGRL
FT                   IVVALAALLLVALIGFGIHSCLKAPEVELIDESTSVTFTIPEGASTADIARILQENRLV
FT                   ARASDFSDAVKARGVASSLKPGTYTLTGGLDVSDIVDTLVSGPNSSTLTIPEGYTLART
FT                   AAAVETATDGRISAAEFTAAASDATAFSDQFPFVAEAYNGSLEGFLFPKTYEVLISDTA
FT                   DSLIRKMLSQYQSETATLDYSYASAAGLSSYDVLKLASMVEREADDTNRSRVAGVFYNR
FT                   LAANMALQSDATIAYLVGGDPTHDDLSIASPYNTYLNKGLPAGPICSPGLDALSAACQP
FT                   EQNDYLYFYFVKNSDGSMSYFFSRTYEEHQQAIAQTQGSDSDQTQEESDSSGEARDSSS
FT                   SDES"
FT   gene            606692..607282
FT                   /locus_tag="Ccur_05130"
FT   CDS_pept        606692..607282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05130"
FT                   /product="HAD phosphatase subfamily IIIA"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD superfamily (subfamily IIIA) phosphatase, TIGR01668;
FT                   HAD-superfamily hydrolase, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94234"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU4"
FT                   /protein_id="ACU94234.1"
FT                   /translation="MKLLSPERYFSRISDIDIPHDLLDVGISHVLLDFDNTILSRATHD
FT                   IPPDALRWIEQAKQAGITLCIVSNNWHASPFDVARTLDIAVVAKACKPLPFGLLVARGK
FT                   VGARSNNAVVVGDQLSTDVLGAHLLGMRAWLVCPLAEEDLKHTVALRRLERSLIGSRLP
FT                   EGAPACEGSSFAVDYSLHSDSLQPSGTKGGTAQ"
FT   gene            607279..608373
FT                   /locus_tag="Ccur_05140"
FT   CDS_pept        607279..608373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94235"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU5"
FT                   /protein_id="ACU94235.1"
FT                   /translation="MKHITVIGDGACAHLVAQALSFEADLRKVPWDIRLRAQGDAQALL
FT                   ADAETIGIVAPLSTHARAAYEVASIRAASCQATGACDVVLKRGQAAAGMSSWGKAFVSL
FT                   LREQGFNLNGSQIAICSTEPAAGSFALAAATAGAKRIVVITPDKVQAARAARGWVSSWG
FT                   TVLDTAFDLGPAPDDERSLHEAYRSTNFQFGSFATSTKALRSCDIVLCLPEEQPISSAS
FT                   EHTTDSAASARDIVAYGGISSSSSGQYSAESVVRSDVVGSDTDTNVVASVREDSDDNAY
FT                   QASSSIPFNLFHADQVVLAPIADDPVGITRITQTGATVVDLRSCCDALAACVMVDALHI
FT                   VRAPQVFSWHEMFTSMSSRTERAC"
FT   gene            608413..609585
FT                   /locus_tag="Ccur_05150"
FT   CDS_pept        608413..609585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05150"
FT                   /product="chorismate synthase"
FT                   /note="PFAM: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94236"
FT                   /db_xref="GOA:C7MMU6"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU6"
FT                   /protein_id="ACU94236.1"
FT                   /translation="MEFITAGESHGPCLTAIISGVPSGLRIDADQIDADLKRRQSGYGR
FT                   GARQKIEQDRVSIESGVRFGVSLGTPIALVIANRDWKHWTNRMAPIGRAPADLVREVTP
FT                   RPGHADLVGALKNDTDDCRNILERASARETAARVAAGGIAKELLGALGVEVFSYVRRIG
FT                   SAAMEDEVSLADIASYTPTDIELSDVRCPSPEASEKMKGMIDVARIQGESLGGEFRVVA
FT                   TGLIPGLGDFASGPSRLTARIGQALFSIPAIKGVEFGLGFKAAALSGSAVHDPIIQSTR
FT                   SGFGRTSNNAGGLEGGMTTGLPLVVTAAMKPIPTLRNPLATVNMDTMEVAQASRERSDV
FT                   CAVPAAAVVAEAEVAMVLADAYLQKFGHDNMADVKAHLDQYCQRIKTASK"
FT   gene            609599..610705
FT                   /locus_tag="Ccur_05160"
FT   CDS_pept        609599..610705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05160"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; TIGRFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94237"
FT                   /db_xref="GOA:C7MMU7"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU7"
FT                   /protein_id="ACU94237.1"
FT                   /translation="MPNVKVVVNLTNAPSYDVRIGEGISSSLGERIRSLVPQASRAVII
FT                   SDSNVAPLYVQPIRASLKEAALRPLDIVVPAGEPSKSIECLGEIWRALASKQVDRDCVV
FT                   VALGGGVVGDLAGFAAATYLRGVSFVQVPTTLLAMVDSSVGGKTGIDLPEGKNLAGSFL
FT                   QPRYVCADLDTLSTLDGREWTCGLGEIAKSAVIDSDEFFFWLVEHATDIAQRKSDIVQE
FT                   AIMRCVVFKANVVADDEFERSGRRACLNYGHTLGHAIETLAGLGTYSHGACVAEGMRFA
FT                   ARLGAALAGASLDFVHEQDKLLDTLGLVPLDFSAAVDDIIDVMKNDKKSRAGKINFILP
FT                   RDVGSWTLQTVEEDVLREHLDAWARSKG"
FT   gene            611037..612176
FT                   /locus_tag="Ccur_05170"
FT   CDS_pept        611037..612176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05170"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /note="PFAM: Creatinase/Prolidase N-terminal domain;
FT                   metallopeptidase family M24"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94238"
FT                   /db_xref="GOA:C7MMU8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU8"
FT                   /protein_id="ACU94238.1"
FT                   /translation="MSKNATVSEKRFNRLVATMQAEKLTAFLARDTSDITWLTAFEGVF
FT                   DDEQAHALLVSASDYCLHTDSRYASACRAAAQSSPVTVDDRRVSHAWWAADYLSHADIQ
FT                   PTTEEHVAFGIDDGITLAEYRVLVTAFAGELPDLQIVETHDVIKRLRAVKDAGEVVRLR
FT                   AAQAITDVAFTHIVSFIKPGMTERAVQLELEDFMRRHGAQDLAFSSIVASGANGANPHA
FT                   TPGEDKLEAGQCVVMDFGARACGYCSDMTRTVFMGEPDAHLVQAYRTLREANEQVEAML
FT                   KPGVTGAEAHALAEAVLAAGGYGGKMGHGLGHGVGIDIHEEPVLSPRNTAVLETGNVVT
FT                   VEPGIYLEGDFGMRLEDFGIITEDGFEVFTRSTHEMVII"
FT   gene            612306..612866
FT                   /locus_tag="Ccur_05180"
FT   CDS_pept        612306..612866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05180"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="PFAM: Elongation factor P (EF-P) OB domain;
FT                   Elongation factor P, C-terminal; Elongation factor P (EF-P)
FT                   KOW-like domain; TIGRFAM: translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94239"
FT                   /db_xref="GOA:C7MMU9"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMU9"
FT                   /protein_id="ACU94239.1"
FT                   /translation="MAISTADFKNGICIEYNGKLWTIAEFQHVKPGKGGAFVRTKLRDV
FT                   RSGRVVEYTFNSGTKFDSVRLEERSMQYLYTDGADYYFMDPTSYEQMGIPADVVGATAQ
FT                   WLKENDEVTLQYAGDELISLTPKMFVELAVAETDPGFKGDTVQGGTKPATLETGAVVQV
FT                   PMYVNVGDVLQIDTRDGRFIKRV"
FT   gene            complement(613181..614503)
FT                   /locus_tag="Ccur_05190"
FT   CDS_pept        complement(613181..614503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05190"
FT                   /product="putative cell wall binding protein"
FT                   /note="PFAM: Putative cell wall binding repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94240"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV0"
FT                   /protein_id="ACU94240.1"
FT                   /translation="MADLPAGTESWDMEPYEIANTGNAVIPTTLKHIWGSHESGVYGQI
FT                   GSGKKDYASETLTIPAGADVTISNMKINSSVKVIVEKGAKLTLDDSVAFGPIEVNGGTL
FT                   STGARSTTTDTITLNEGSTLENANLNSHAHYLTDGSYTAPESTTPVVVNGNVTIKGNVT
FT                   ITGDEGTAGTAGQAGMVIKSGTVTISEGSTLTISGGDTVEVYPSAGGSGIVMSEGSQIK
FT                   GAGTLITTGGKSYQNKAGHGIDGVGIVDVGTLKATGGASAPEDYPTVTGRHGQAGDGVV
FT                   PTVKVRATNLSSQGGTGEHPGSDKVTPYDPSEPDPQPQTGWQQVDGTWYYYNTDGSMVT
FT                   GWLQLDNTWYYLQNWGGMALGWQDVDDTWYHFDASGAMQTGWLQLDGSWYYLKDWGGMS
FT                   LDWEEIDGTWYYLGSSGAMVTGTQIIDGTVYRFASSGALVS"
FT   gene            614732..615730
FT                   /locus_tag="Ccur_05200"
FT   CDS_pept        614732..615730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05200"
FT                   /product="membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /note="PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94241"
FT                   /db_xref="GOA:C7MMV1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV1"
FT                   /protein_id="ACU94241.1"
FT                   /translation="MDTASLEPSVTYSESLFFAFDVPCSLTVAAFSGVEEALDSCVAEC
FT                   QRFEEIFSHTRSTSELSRLNGALGMPVSVDPQLADLLRLALDYCAATEGLFDITAGELA
FT                   HLWNFHRAQMPTSDDIRRAHSHTDFRQVHVNGQVVCIDDAAARVVLGGIAKGYIADKLR
FT                   DALRAAGIRSAAIDLGGDIAVLGARPDGKPWEVPVADPRIVAGNAAFVLVCDAAVITSD
FT                   VYERFFEEAGKRFHHIVDPRTGYPAQSDLVAVSVIARDALDGDGYSTALLIMGLRRAYE
FT                   FVEAHDGIEALFFREKGAPIATSGLRHMKAAQISAPLGDESHPVWEPVFCS"
FT   gene            complement(615866..617113)
FT                   /locus_tag="Ccur_05210"
FT   CDS_pept        complement(615866..617113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05210"
FT                   /product="Na+/serine symporter"
FT                   /note="PFAM: Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94242"
FT                   /db_xref="GOA:C7MMV2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV2"
FT                   /protein_id="ACU94242.1"
FT                   /translation="MVRRIWNQWNEWSLIGRIVCGLIIGTILAILMPGSEAIVLLGTLF
FT                   VSALKAVAPILVFFLILAALANASKVGNMKRVVILYVISTFIAGIISVFACYLFPLHLT
FT                   LVEAAEKSAPSGIAEVISNLLVSVVANPVDALSKANFLGILTWAILVGIALRTASEGTK
FT                   QVFDSIAEAIQKVVRWVIAFAPFGVLGLVYNAVSTSGLGIFTEYGALILVLVGCMLVIA
FT                   FITNPLMIWVNIKKNPYPLVLRCLRDSAITAFFTRSSAANIPINLELCRKLGLNEDNYS
FT                   VSIPLGATINMAGACVTITVMAMAAAQTMGVQVDFITAVILCVLAAVSAAGASGVAGGS
FT                   LLLIPVACSLLGLPNDIAMQVVGIGFIIGVIQDSCETALNSSSDALFTATAEYAEWTKK
FT                   GIDYTPGADRETAPVA"
FT   gene            617358..619262
FT                   /locus_tag="Ccur_05220"
FT   CDS_pept        617358..619262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05220"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="PFAM: Conserved carboxylase domain; HMGL-like;
FT                   Biotin-requiring enzyme; TIGRFAM: acetyl-CoA carboxylase,
FT                   biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94243"
FT                   /db_xref="GOA:C7MMV3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV3"
FT                   /protein_id="ACU94243.1"
FT                   /translation="MPKLQLMDTTIRDGQQSLWATRMPVGDMLPILPAMDKVGYWAIEA
FT                   WGGATFDTCLRFLDENPWERLRQIKAKTPNTRLAMLTRGQNLVGYKHYSRDIVNRFLKA
FT                   AQRNGVDVFRVFDALNDIRNVTDSAEAVKEAGGWFEGAISYTISPVHTLDSYLEYAQQL
FT                   KELGADSIAIKDMAGMLTPYRTERMVRALNDEIGLPVHVHCHYVGGMAPANILKAAEAG
FT                   AAIADTASAPLAFGNSQPAVEMIVAALQESAFSTGYDLDLLFEIAEYWEEVRRRTHHKR
FT                   GVSSLTHMKVYSHQVPGGMMSNLMAQLEVQNAADRIDDVMREIPKVRAEVGYPPLVTPM
FT                   SQIVGTQAVFNVITGKRWGVVSKEMKDYICGYYGKAPGPMDAEIVKKVVGDSAILPPDV
FT                   APSSLVTTTYESVADEIGDLAKTEEDVLMYALFPNEARTYLSKHRTSEKVDFLMEGESS
FT                   GTKEDDYVDINQIRELVRVAEESGVGEIVVEEEGARIAVRMPGMMSVAPAAVPAANGAA
FT                   PVAASASVPAAAPAAPVADAANTRPASWKPVCAPMVGTFYAAPAPGEPAFVSVGDEVTA
FT                   GQTLAIIEAMKLMNEIGADEMGTIREVCIEDAQPVEFGTVLFYLEPHNTAEATGPESA"
FT   gene            619262..620614
FT                   /locus_tag="Ccur_05230"
FT   CDS_pept        619262..620614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05230"
FT                   /product="biotin carboxylase /acetyl-coenzyme A carboxylase
FT                   carboxyl transferase subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: Biotin carboxylase C-terminal domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94244"
FT                   /db_xref="GOA:C7MMV4"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV4"
FT                   /protein_id="ACU94244.1"
FT                   /translation="MFDKVLIANRGEVALRVMRACREMGIKTVAVYSTADADTLPVRYA
FT                   DEAVCIGPAPAGKSYLVMSNVIAAAKTTGAQAIHPGYGFLSENAEFARACADNDLVWIG
FT                   PAPECIERMGDKSRARDTMKACGVPTVPGSDGTIESVEEARAFAESVGWPVLIKASAGG
FT                   GGKGMREVHDPADLEAQFTAAKTEAQAAFGNDDVYLEKLVLRPRHVEIQVLADAFGNFA
FT                   ALCERDCSIQRRHQKLLEEAPSPALDEVTRTAMCEAARRAVEAVGYRSAGTIEFLLDSD
FT                   NKFYFMEMNTRVQVEHPVTEMITGVDIIKEQLRIAAGEKMLSASRERFVPNGHAIEFRI
FT                   NAEDPDQEFRPCPGTIERLVVPGGPGVRIESYLEQGSHISPYYDSLIAKLIVWGSDRDE
FT                   AIARGRRALSEFVIEGPGIKTTIPFHQRVLDIETFKAGNACTDFIETEMGE"
FT   gene            620618..620965
FT                   /locus_tag="Ccur_05240"
FT   CDS_pept        620618..620965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05240"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94245"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV5"
FT                   /protein_id="ACU94245.1"
FT                   /translation="MSDLNVEGMALADGVLETIISIAVQEVEGVARVGGASAAGGLFSS
FT                   RKAKPVTRGIEVSTDEDDGIAVSVRIEVVFGQVLPEVAQAVRTAVANAVLTQVGAHVSS
FT                   VDVYIDGIRFE"
FT   gene            620975..621463
FT                   /locus_tag="Ccur_05250"
FT   CDS_pept        620975..621463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05250"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="PFAM: NusB family; TIGRFAM: transcription
FT                   antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94246"
FT                   /db_xref="GOA:C7MMV6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV6"
FT                   /protein_id="ACU94246.1"
FT                   /translation="MAKRHERTLARRMAVQVLYEGEITDTLASEIVLRPDAVPDGGALP
FT                   AYAVSLVEGVCAHRVAIDNKIAAASENWSVGRMPLVDRAIMRLAVFEMTHCDDVPLSVS
FT                   INEAVELAKEFGGADDSARFVNGILGRIARQDNEDAELPELSDMSDAVDESDTAGEKA"
FT   gene            621460..621798
FT                   /locus_tag="Ccur_05260"
FT   CDS_pept        621460..621798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05260"
FT                   /product="Exonuclease VII small subunit"
FT                   /note="PFAM: Exonuclease VII small subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94247"
FT                   /db_xref="GOA:C7MMV7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV7"
FT                   /protein_id="ACU94247.1"
FT                   /translation="MNGTGADQADDLTFEGVNDRLTEIVDAVSNDDISLEEALDLFEEA
FT                   IDLGMQASSLLEEGIVQESPDKDSALHESDGAGIASNPTGIKPNPVDPVGIAYNPVSTT
FT                   SNFSSPAE"
FT   gene            621896..623785
FT                   /locus_tag="Ccur_05270"
FT   CDS_pept        621896..623785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05270"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="PFAM: Transketolase, pyrimidine binding domain;
FT                   Transketolase, C-terminal domain; TIGRFAM:
FT                   1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94248"
FT                   /db_xref="GOA:C7MMV8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV8"
FT                   /protein_id="ACU94248.1"
FT                   /translation="MNHKRILDSIESPQDLKGMSVSDLTTLCNELRTEMVKVTSQNGGH
FT                   LASSLGAVETIVALHSLLDCPDDKIVFDVGHQAYAHKLLTGRRSRFSTLRQLDGITGFP
FT                   NPDESPYDVHPSGHASDSLSIAMGLAKARDLSGTSNKIVALVGDAALSGGMAFEALNHI
FT                   GQEQTPMVIVLNDNGMSISRPIGALVRHLGNLRASSQYRHTRDALQEAMEDRGPLTQGL
FT                   LDLGRNMKESMKQFVIPHAMVFEQLGITCTAPVDGHDVGLLREMFSVALAADAPVLVHV
FT                   VTRKGAGYAPAEASPEKFHGISAFDIKTGLTKKKPATAPTYTSAFASALMAEAKVDPDI
FT                   VAITAAMKSGTGLADFAATYPERFIDTGITEEHALGLASGLAAGGKKPVVAIYSTFLQR
FT                   AIDQVIIDNALPHQHTVLAIDRAGLVGDDGPTHNGVFDIAYLRMIPHMKIMAPSNEVEL
FT                   ASALHTALADTSGPVALRYPRGEAEGAINPNGPETWKPGQSLVRRVGDDVAILAFGRLV
FT                   NEALGAADLLAKAGIEARVVDMRWCKPLDEEAIAQAATTRLIVTAEEGVIAGGAGEGVL
FT                   GVLAQRNLACPSLLLGIPDRFVEQGKIPALFKRLGLDAAGMARRIEQALRDKS"
FT   gene            623935..625218
FT                   /locus_tag="Ccur_05280"
FT   CDS_pept        623935..625218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05280"
FT                   /product="Na+/H+ antiporter NhaD-like permease"
FT                   /note="PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94249"
FT                   /db_xref="GOA:C7MMV9"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMV9"
FT                   /protein_id="ACU94249.1"
FT                   /translation="MFTQPQIIAIVVFVGVMTLVATEKVHRCLAALAGALILVVTGVIS
FT                   FDTGISHIDFNTIGVLLGMMLFVSVIKESGLFEYTALKAAQIAKGDPWRIMVAFILITA
FT                   MLSALLDNVTTVLLVGPMTLVVCRMLEINPIPFFLTEIMASNIGGTATLIGDPPNIMIG
FT                   SAANLTFFDFVANDAPAVVVILAVVILAFRFMYGRNMGVDETHRAAIMKLNPKEKIRDL
FT                   SLFRKSLVMIALVVVFFMVHGQLGLESSVIALSAACIMMLIGRADLELSVFNVEWTTIG
FT                   FFCALFMVVGALSETGVITMLAEWIMDITNDNPLAMMIVILWASAIISAVLDNIPFVAT
FT                   MIPVITAIGMTGVDVVPLWWALSLGACLGGNGTLIGASANVVLSSISTKEGYPISFMDF
FT                   TKVGFPVMILTVAVATVYCLIRYGLPMM"
FT   gene            625803..626774
FT                   /locus_tag="Ccur_05290"
FT   CDS_pept        625803..626774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94250"
FT                   /db_xref="GOA:C7MMW0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW0"
FT                   /protein_id="ACU94250.1"
FT                   /translation="MGGSVIPSLPIMSLLFSGIIEAVLSVEISSEAVIAVLVAGVVGAV
FT                   SSAASSIFVWHFLMHVGVKPPRWQPFLLCLFCMALCIVVTAAHPSSVIDACDRSLVAGI
FT                   LMAAAWSDGTCRLIPDALSYGGAGLHLILLIGAHLYAGTQSAIPSAVFHAVLNAFGMVA
FT                   LLAVAALCCYKSRGYRSTDKTLSSRLLLRAPIDSRRSPVESICAISSRTSAVATTPVVP
FT                   AAPSELTRRSSDNSTLSAAPIGGGDIKLIACITFCCGWWSTLSLVGVACLLALASAILR
FT                   QLYSRLHAAKNRKPFSVYPRLLSHATFPFVPSIAVAFWVVSL"
FT   gene            627040..628251
FT                   /locus_tag="Ccur_05300"
FT   CDS_pept        627040..628251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05300"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="PFAM: S1 RNA binding domain; TIGRFAM: ribosomal
FT                   protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94251"
FT                   /db_xref="GOA:C7MMW1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW1"
FT                   /protein_id="ACU94251.1"
FT                   /translation="MTEIKNPSVIDYEDVPDDQMNAMIDGTLTEFDEGDLVDGTVVKIE
FT                   RDEVLVDIGFKSEGVIPARELSIRKDADPSDIVNLGDSIEALVLQKEDKDGRLILSKKR
FT                   AEYERAWISVEEKFKAGEIVSGEVIEVVKGGLILDIGLRGFLPASLVDLRRVKDLDMYL
FT                   GTPLEARVIEMDRNRNNVVLSRRVLLEEGRKNERAEILSRLTKGMRLKGTVSSIVDFGA
FT                   FVDLGGIDGLVHISELSWSHVNHPSEVVKVGDEVEVQVLDVDLQRERISLGLKQTTEDP
FT                   WVKLVESYPVGSIIDGKVTKTVPFGAFVELGPNVEGLVHISEMANKHIEAPTQVVHAGD
FT                   EVKVKVMEINTERRRISLSMKAAAEDLGIEIAVAEPDPAALEEKAARQAKRAAREAEEE
FT                   EQED"
FT   gene            628429..629031
FT                   /locus_tag="Ccur_05310"
FT   CDS_pept        628429..629031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05310"
FT                   /product="dephospho-CoA kinase"
FT                   /note="PFAM: Dephospho-CoA kinase; TIGRFAM: dephospho-CoA
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94252"
FT                   /db_xref="GOA:C7MMW2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW2"
FT                   /protein_id="ACU94252.1"
FT                   /translation="MKRCVLIGGIGSGKSTVSRMLQEHGAACVDLDDCGHEVLLNPTVI
FT                   SMLTETFGEDILDAQGQIDHAALAQKAFATPQATVRLNAITQPRLLRIAQKRLDDLEAD
FT                   GCAIAFVEISAYDGPDGTFAPLFRTDDAVISVTAPKRLRIERAIGKGYSEQDVRNRIAR
FT                   QVSDAQRALWADFVISNKGTLADLQAHVDAIWKKITA"
FT   gene            629135..631261
FT                   /locus_tag="Ccur_05320"
FT   CDS_pept        629135..631261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05320"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="PFAM: Type III restriction enzyme, res subunit;
FT                   Helicase conserved C-terminal domain; UvrB/uvrC motif;
FT                   TIGRFAM: excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94253"
FT                   /db_xref="GOA:C7MMW3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW3"
FT                   /protein_id="ACU94253.1"
FT                   /translation="MPHLSNIDGSTMEGKLPDVRLAGQPFRVVAPFEPSGDQPAAIRAL
FT                   AQGVQDGLRYQTLLGVTGSGKTFTMAKTIESLQRPTLVLEPNKTLAAQVAAELREFFPD
FT                   NAVVYFVSYYDYYQPEAYVPSTDTFIEKDASINEEVEKLRHAATSALLSRRDVIVVASV
FT                   SCIYGIGSPMDYAGMAVFADKDKPIDRDQMIHGLIDIQYDRNDYELTRGTFRVRGDALD
FT                   VFPPYADNPIRLEFWGDEIESITEIDNVTGEVLNSYEALPIWPASHYVTAKPKMDHAIK
FT                   TIREELRERLAQFKEEGKLLEAQRLEMRVSYDLEMMETMGFCSGIENYSRHLDGRSPGE
FT                   PPYTLLDYFPRDFICIVDESHVTVPQVRGMHEGDRSRKVTLAEHGFRLPSCLDNRPLRF
FT                   DEFEQRVGQFIYVSATPGDYENRVSQKTVEQIIRPTGLLDPEIIVRPTASQIDDIIDEA
FT                   RARAQNHERTLITTLTKKMAEDLTDHLLDQSIKARYMHSDIGTLERVDILRELRQGKFD
FT                   VLVGINLLREGLDLPEVSLVAILDADKEGFLRHYRSLIQTIGRAARNAHGQVIMYADKR
FT                   TDSMDLAITETQRRRALQMAYNEKHGITPQTIKKDINDIMDYVQQEAGDVSAEQINQEL
FT                   ASLSRGEVMRVVAAMEEDMRQASADLDFDRAASLRDQIVRLKSQVEGQSEEDVLAGLKK
FT                   TARKGSDFGRRKRA"
FT   gene            631313..632800
FT                   /locus_tag="Ccur_05330"
FT   CDS_pept        631313..632800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05330"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="PFAM: B12 binding domain; Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94254"
FT                   /db_xref="GOA:C7MMW4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW4"
FT                   /protein_id="ACU94254.1"
FT                   /translation="MKIRFLEPGNPPYRPSPLNWFVYDRTIRTPSNGMLILATILHRRY
FT                   EDVYCYSESISRIVWDDVLDADVICLSIFTFSANRGYELADYIRQHSSAVIIIGGLHAT
FT                   LCAEEALAHADYVLTGEGDESLPRLVAALETHTVTDGIPGVYYWRAGRPTCDTPAVLPH
FT                   DIETIPDRTLLYRFKEMAGHSTIWAQVHASRGCPYHCDYCSLVAAFGSGVRCRAPETVV
FT                   EDIRQAIDFFDTGHHRLARMLWITDDNFFANRSWAISVLQALIESDINYTFTIQARYEV
FT                   GFDDEMLDLLARAGFIEIAMGIEFLEDEAFELYHKTSTYSQIEQSVANIKRHGLRVRGL
FT                   FIVGADNHEVGVGDRLADFVISHDIDGVLVQSMYFIPGTPVYKTHQDQLFDTSNWSRNM
FT                   GKVVHYPQHMTAVQLQCEMIHATKRIYSFKRLVQALLCKRGINRTLFLGEWLWYVFVRA
FT                   DLRRDLSYLREKDRQEQVAHHKPHNLQCLGIGTSSTL"
FT   gene            complement(632829..633743)
FT                   /locus_tag="Ccur_05340"
FT   CDS_pept        complement(632829..633743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05340"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   cysteine synthase A; cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94255"
FT                   /db_xref="GOA:C7MMW5"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW5"
FT                   /protein_id="ACU94255.1"
FT                   /translation="MTVKAVQSIDELVGNTPLVTLKVSDNANVYGKLESQNPGGSVKDR
FT                   IAKAIIDDAFERGLINKDSVLIESTSGNTGVGLAMVAAARGLKLIVTMPETMSVERRNL
FT                   IKAYGAELVLTPGADGVPGADARAKELLASTPNSFAPSQFTNPVNPQIHYRTTGPEIWK
FT                   DTEGTIDIFIAGVGTGGTLSGAGKYLREQNPNIKIFALEPEESPILAGGAPGKHKIQGL
FT                   APGFIAETMDMNIFDELLHVTSETALAYQRKLSQEQGILVGISSGAAAAAAAEVAARPE
FT                   SAGKTIVAILPDTGERYLSMISE"
FT   gene            complement(634031..634426)
FT                   /locus_tag="Ccur_05350"
FT   CDS_pept        complement(634031..634426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05350"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF454)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94256"
FT                   /db_xref="GOA:C7MMW6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW6"
FT                   /protein_id="ACU94256.1"
FT                   /translation="MNIKKILYLILGCLGLGLGAVGAVIPLLPSVPFLLVAAYCFARSS
FT                   ERLNTWFTHTKLYQDNLADYVAHRGMTRKTKIRIMSVVTLLMGIGAVLMGRKGIVVGCL
FT                   VLLCVWIIHIIYFTFGVKTIPANQEAE"
FT   gene            634643..635101
FT                   /locus_tag="Ccur_05360"
FT   CDS_pept        634643..635101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05360"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: Transcriptional regulator; TIGRFAM: rrf2
FT                   family protein (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94257"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW7"
FT                   /protein_id="ACU94257.1"
FT                   /translation="MKISTKGRYALRLAIDVAQHQLAGPVPLRESAKRQGISVKYMEQL
FT                   AAQMTHGGLLTSTRGAHGGYRLARLDTDITAGDILRVSEGGYAPVACLEDDFGICPHRG
FT                   ACETIAFWEGLDQAIERYVDSVTLADLVAQAQQAASRAQEAFPLRHSR"
FT   gene            complement(635019..635960)
FT                   /locus_tag="Ccur_05370"
FT   CDS_pept        complement(635019..635960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05370"
FT                   /product="4Fe-4S protein"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94258"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW8"
FT                   /protein_id="ACU94258.1"
FT                   /translation="MIFYFTATGNSLEAAQTIAEATHDSLADMGSAFRQGTFGFHVEQG
FT                   ENLGFIFPVNTFTTPALVDEFLRWLCFITPNGNDFVPGYCYCVITCGVFVGNTAGFFAK
FT                   MLAKYQHIKLDASFSIRNVNNCIILTGPGSTRKQKRLNEGAHRTARSIAFQIDSKRMVH
FT                   AEDRNPLGLVLSAFTGKEHKPSSTRRFSLNRGRCSRCGICWDICPTNVIYQDEDGFPTW
FT                   EADRCTRCFACLQRCPLEAIQYGTSTTRRQRYTNPILDANPTFTAAIAQSVDMSIPEPE
FT                   EIIHPINGNDEEEMPPAHETQPAVPGQPDLPA"
FT   gene            complement(636030..636512)
FT                   /locus_tag="Ccur_05380"
FT   CDS_pept        complement(636030..636512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05380"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-Tyr-tRNA(Tyr) deacylase; TIGRFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94259"
FT                   /db_xref="GOA:C7MMW9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMW9"
FT                   /protein_id="ACU94259.1"
FT                   /translation="MRALVQRVNCAQVFIDDDTDKTLAGIISGEPNRAIEKGIVVLLGV
FT                   GHNDREEDAHRLWRKISSLRIFEDDTHKTNLSLAEVNAQALIVSQFTLFADVSHGRRPS
FT                   FARSASQEQALSLYRFFCKQVIDTLPSAAFGEFGADMRIALENDGPFTIWIDTDEL"
FT   gene            636749..638485
FT                   /locus_tag="Ccur_05390"
FT   CDS_pept        636749..638485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05390"
FT                   /product="DNA repair protein RecN"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: DNA
FT                   repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94260"
FT                   /db_xref="GOA:C7MMX0"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX0"
FT                   /protein_id="ACU94260.1"
FT                   /translation="MIDELHVQNIALIRDAMLLPARGLTVITGETGAGKTALIGALNLI
FT                   VGGRADASLVREGSQGLSVEARLCSLASASRVSSNGNANESADTDTRKLTHADTDKSAD
FT                   VDGDTVVQRTLSAEGRSRVHIDGHIASVGQLADSVGETIDLCGQHEHQKLLSSSNHRAL
FT                   LDAWAQDDLASVKKEFSEAYQAATQAARVVEEIQHTGDLSDDAIERARFIVRRIDEVDP
FT                   QPGEYEELAARLPLLENAESLARSIEGAHAALSADDAALDALGRSASLIDEAATVDPSL
FT                   AAFAQSLREALYVVEDVARDIRSYGDAIDVDLGSLAVLQDRMGAMQDLMRSWGPTMEAV
FT                   LIARDDARRTLSLADGLDDRLREALAQQEQVEDVLARAAERLHHARSKAAPQFAEAVCA
FT                   QMERLSLGGVQLECAVEMLAREKWTEAGSDAVEFLFRPGTDMTARPLAKIASGGEVSRV
FT                   MLAIKVVLGAVDESETLVFDEVDAGVGGAAARSLAALLVDLAKTHQVIVVTHLPQMAVY
FT                   ADAHYVVRKTQGSTPETTLTALSESDRVSEIARMLSGDTGKAALDHARELLAEATEYKA
FT                   TA"
FT   gene            complement(638655..640010)
FT                   /locus_tag="Ccur_05400"
FT   CDS_pept        complement(638655..640010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05400"
FT                   /product="uncharacterized domain HDIG-containing protein"
FT                   /note="PFAM: HD domain; Poly A polymerase head domain;
FT                   TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94261"
FT                   /db_xref="GOA:C7MMX1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX1"
FT                   /protein_id="ACU94261.1"
FT                   /translation="MLDTLMNPPVQRIIETLEQAGVEAWLVGGCVRDGLIGRPIHDIDI
FT                   ASSASWQETVRLCQAAGMTTVETGTQHGTVTIIADGTPFEVTTFRGEGQYQDGRHPEYV
FT                   FPVDSIDEDLARRDFTINAMAWNPSRGLHDPYGGQADAAAKIIRAVGKAQQRFDEDALR
FT                   ILRGARFASQLGFTLETETAHAMNEAAHNLARISAERIAAEMDALLKGSFVHDALMNCA
FT                   PVICAAIPELSCTCGFDQQSKYHSFDVYEHLAWATQQTPKKSLVRWCAFLHDIGKPATM
FT                   VVDEAGAGHFPDHAAVGEAMARNLLKRLRFPTRFIHDACLLIRYHDIPIAPTPRATKRM
FT                   LQRLDGREDLFRDLCALKRADSLAHAPQWRGGTKAADAAEKCLDAIIEQNAAFSRSALA
FT                   INGNDVIKLGVPAGPAVGKALDAALNAVIDETRRNERDSLLDLVRELMVKGI"
FT   gene            640399..641337
FT                   /locus_tag="Ccur_05410"
FT   CDS_pept        640399..641337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05410"
FT                   /product="Protein of unknown function DUF88"
FT                   /note="PFAM: Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94262"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX2"
FT                   /protein_id="ACU94262.1"
FT                   /translation="MPDQTERKPFALLIDSDNVSAKYIQGIMNELTSRHGQVTYRRIYG
FT                   DWTSSQMGKWKDVLADYSLTPMQQFPNTKGKNATDSFLIIDAMDILYEGKIEGFCIVSS
FT                   DGDFTRLASRLRDAGMTVVGMGEQKTPRSFRSACTVFTGLELLIDTDDGETPAPSGENS
FT                   ISKRDVADAIVNIINEGNGQGQHLGSVGSRLVNVYPDFDVRSFGYSQLSKFLESFDNLQ
FT                   LDRRDNAVFVSLKDTDRLRDQVDAFVVDLARRAGAEGVNLGYLGGLIHSSFPDFSVKDY
FT                   GYSKLSKFIRDVEGVLLVDDESGTRVVIDCE"
FT   gene            641698..641771
FT                   /locus_tag="Ccur_05420"
FT   tRNA            641698..641771
FT                   /locus_tag="Ccur_05420"
FT                   /product="tRNA-Gln"
FT   gene            641775..641851
FT                   /locus_tag="Ccur_05430"
FT   tRNA            641775..641851
FT                   /locus_tag="Ccur_05430"
FT                   /product="tRNA-Glu"
FT   gene            complement(641864..642040)
FT                   /locus_tag="Ccur_05440"
FT   CDS_pept        complement(641864..642040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94263"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX3"
FT                   /protein_id="ACU94263.1"
FT                   /translation="MYSEGFKAKALKRHCCAIIASRKVLRKIQSKDPERDQDAIRCDQK
FT                   QRQNVKQVRAISF"
FT   gene            642323..645046
FT                   /locus_tag="Ccur_05450"
FT   CDS_pept        642323..645046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05450"
FT                   /product="DNA-binding transcriptional activator of the SARP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94264"
FT                   /db_xref="GOA:C7MMX4"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX4"
FT                   /protein_id="ACU94264.1"
FT                   /translation="MYDFLEHCACNGSAPEQFSERKMLFRNALLARMMADRTRVRYLVA
FT                   PELFGKSSLACSYARFVFAFNDVWWVNGKSACLLRDLDDGSLMQDFPQVIPAGGLVVLD
FT                   DVPSLGKDRAQKFWEFCQTMVTSGREVVVAATPGTDPLAAFRSSCVVIGSRDLLCTDEE
FT                   CSALGVRPLRTESSFRLIDRVAGLAQHSSPQYERFLHALIADGQQDRAVLSFVVLSLEE
FT                   ATTDEIACVLNTSFDVTDINVESLPFIQFNATTSTFSAKGFPLASIVRAYAPYFQSDAG
FT                   DSGLGLDDVLVGRVADILMRKRRFERACGFVAALCSPSKRSEWLRRWQDVMAGAGALAP
FT                   AEAVFATLTRYREGSHIDLQVGSLLRRVMAGDQTAALKLLQSARRSDCSLSLRLRCAST
FT                   ALMAPEHSAEVLRDFSLTEAAHALASVGGESSLSSQVRALLVFWQHIMHSENEELDLLS
FT                   VARHLDADSTSDDAAWAFACLLRVRGTCDSHTCASIAQYLHTLPQAEGGIGFIFLHRLL
FT                   AELQLDKASIAAVPMSDMCQKLQAKLNTQRELFARLVPEGDFHTPTSKESLRLAGLKEN
FT                   SSLSAHEEDSQAFASEGSSRMSVSEEFTRCASTTLDYSVSTTSNHATFGATHCTQRPSS
FT                   TANAMATASSVDNPPDITPLLQVRLFGSFSVSHGEEPVDMARLSRQKTRALLAILLLYP
FT                   GQDIPGDTIAFMLWPRSDGAKARRNMYSVLSKLRGALKLPDGTCPYLKRAQGVVALVPS
FT                   LVRSDCDQVGALCRSLRFDHLEPAAIVDAFNALRLQYAGEFLPGNIEDEPIARARRLWQ
FT                   GRTVDAALHAAQRLEEADCLQEALSVAEQALEWDTHREDCHGRLMRLQARCGQRPAAVE
FT                   TWLRYLDMMRAFGLDASKTMNALYEEIIGNSLGVIA"
FT   gene            645230..648067
FT                   /locus_tag="Ccur_05460"
FT   CDS_pept        645230..648067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05460"
FT                   /product="protein translocase subunit secA"
FT                   /note="PFAM: SEC-C motif; SecA Wing and Scaffold domain;
FT                   SecA DEAD-like domain; TIGRFAM: preprotein translocase,
FT                   SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94265"
FT                   /db_xref="GOA:C7MMX5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX5"
FT                   /protein_id="ACU94265.1"
FT                   /translation="MGFLSKILTVGEGRQLKKYHGIVEVINGLEPAMEKRSDDELRALT
FT                   GQLRGRVQAGEDLDAILPEAFACVREASKRTLGLRHFDVQLIGGMALNAGQIAEMKTGE
FT                   GKTLVSTLAGYLNALGGNNVHIVTVNDYLARRDSEWMGRVYRFLGMKVGLIQNGMQPSQ
FT                   KIPAYQADITYGTNSEFGFDYLRDNMVTRADRRVQRGHHFAVVDEVDSILIDEARTPLI
FT                   ISGAGTQAADTYRRFARVMPGLKRDIDFEMDEAKRTITATETGLVKIENRLGIEDLYND
FT                   PSGQMPNHLQQALKAQFLFHRDKDYVVADGEVKIVDEFTGRIMEGRRWSEGLHQAIEAK
FT                   EGVAIKEENQTLATITLQNYFRLYEKLSGMTGTAMTEDAEFREIYKLPVMAIPPNRPVA
FT                   RKDENDLIYRTIDAKFNAVADDIERRNEAGQPCLIGTVSIENSEKLSRLLDKRGIAHET
FT                   LNAKNHEREAHIIAQAGRVGAVTIATNMAGRGTDILLGGNAEVMADDLLRARGFDPDID
FT                   PDFKPDVEAEEETEPVAPSEADRAQALAEARAITTDEHERVLAAGGLCVIGTERHESRR
FT                   IDNQLRGRAGRQGDPGSTQFYLSLEDDLMRLFGGDRMDRVASMMERTDMPEDMPIQAGM
FT                   VSKAIESAQRQVETINFGARKNVLEYDDVMNLQRKAIYEERNAILDGKDLTERIPEIAE
FT                   EAARTVVEENCPDRSPSDDWDMRAVDLWVSQMDGRNSFSAENIDHEDDPEALIEAVTEE
FT                   LVSAFDEKREILGDEIMKSLESQIMLRIIDTRWMDHLSNMDYLKTGIGLRAFGQRDPLV
FT                   EYKNEAHRAFGEMTSGMYETFLRTVLRLQIATREEVPQNQEADPTERSMSYSSPEGTLN
FT                   DSSLSTAQRVAAASRAAHGAPAAVPNVPREVVKPQTYVKDKTDPYANVGRNDPCPCGSG
FT                   KKFKKCHGANLTARN"
FT   gene            648151..649245
FT                   /locus_tag="Ccur_05470"
FT   CDS_pept        648151..649245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05470"
FT                   /product="peptide chain release factor 2"
FT                   /note="PFAM: RF-1 domain; PCRF domain; TIGRFAM: peptide
FT                   chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94266"
FT                   /db_xref="GOA:C7MMX6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX6"
FT                   /protein_id="ACU94266.1"
FT                   /translation="MADSVEVNKAAERLTEAHSFLHIDARKQRLAELDQQTAQPGFWDD
FT                   IDRAQAVSKEASDIRTLLDTYEHAHTLLDDWRCALDLAQDDPDFATEAQKAADELSRLL
FT                   DDFEIESWFGNRFDEGDCIVTINPGSGGLEAQDWCDMLFHMYTKYAENRGWKVRVLDAP
FT                   LGEVIGIEHASFQIEGRFAYGMLRSEIGVHRLVRISPTDDKKRRHTTFASVEVMPVLPD
FT                   DIEVNLNPADVRVDVYRASGPGGQCVNTTDSAVRLTHIPTGTVVTCQNQKSQLQNKEAA
FT                   FRILRARLFELEERKRQEEIEALRGEKRENSFGSQIRNYVLYPYQMVKDLRSGIETGNV
FT                   DAVLGGDLDQFVIGYHRWNASRGA"
FT   gene            649385..650212
FT                   /locus_tag="Ccur_05480"
FT   CDS_pept        649385..650212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05480"
FT                   /product="transketolase subunit A"
FT                   /note="PFAM: Transketolase, thiamine diphosphate binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94267"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX7"
FT                   /protein_id="ACU94267.1"
FT                   /translation="MDPQGLCAIADDMRVDIVKMIAEAGSGHPGGSLSCIDILAALYFG
FT                   GVLTHDPEHPDDPSRDRFILAKGHAAPALYTALAHAGYFPREELMTLRKLGTRLQGHPD
FT                   CSLLPGVEVSTGSLGQGLSIAAGMACGLRLNGSNVHVFCLLGDGECEEGQVWEAAMFAA
FT                   HEHLGSLVAIVDANGLQIDGAVNDVVQTGTLSDKFHAFGWDVSEVDGNDVKAVRDLLMS
FT                   LKSSPSNHPQAVIAHTIKGKGVSFMEGQAGWHGKAPNAEELTRALSDLARTKE"
FT   gene            650217..651194
FT                   /locus_tag="Ccur_05490"
FT   CDS_pept        650217..651194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05490"
FT                   /product="transketolase subunit B"
FT                   /note="PFAM: Transketolase, pyrimidine binding domain;
FT                   Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94268"
FT                   /db_xref="GOA:C7MMX8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX8"
FT                   /protein_id="ACU94268.1"
FT                   /translation="MVQFATSEQAALKKATRAAFGPTLVELASAGVPVVAVDADLSGST
FT                   TLKKFAESAEGAGRFFNVGIAEQNMIDVAAGLSLTGNVAFTGSFAVFGTGRAYDQIRNT
FT                   VCYSRLNVKVCPTHAGISVGPDGGSHQMLEDIALMRALPNMTVLVPADYASARAALKLA
FT                   ATTPGPVYVRMGRAAVPAVYADEVELECGRAYVLREGTDVTIIACGVEIREALAAADIL
FT                   ERGGITAEVIDAFSVKPLDEQTIIASARKTGCVVVAEEHSVHGGLSSAVAELLAEEYPV
FT                   PCRFVAMRDRFGKSGSFEELMSYFGLDAAAIVEAVESVVARKTL"
FT   gene            651243..652085
FT                   /locus_tag="Ccur_05500"
FT   CDS_pept        651243..652085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05500"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="PFAM: ABC transporter; TIGRFAM: Type II (General)
FT                   Secretory Pathway (IISP) Family protein; cell division
FT                   ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94269"
FT                   /db_xref="GOA:C7MMX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMX9"
FT                   /protein_id="ACU94269.1"
FT                   /translation="MTNADIQGAAAHAAHSAGERQNQAKQVTAQLSSTLPDLDLDATPQ
FT                   PSGTPVITFDHVTKVYPAQPNKPALYDISLQVFAGEFVFLVGHSGSGKTTLTRMIIREV
FT                   RPTEGHIYIADEDLATMRNWRVPYLRRNIGTVFQDFKLLPNKTVFENVAFALEVIGKSR
FT                   HVIRTQVPEVLRLVGLQDKLDKRPDQLSGGEQQRVSIARAIVNRPPLLVCDEPTGNLDP
FT                   QTSRGIMDLLERINRTGTTVLVATHDREMVDNMRRRVIALEKGRLTRDQDRGVYGFDV"
FT   gene            652078..652992
FT                   /locus_tag="Ccur_05510"
FT   CDS_pept        652078..652992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05510"
FT                   /product="cell division protein"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94270"
FT                   /db_xref="GOA:C7MMY0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY0"
FT                   /protein_id="ACU94270.1"
FT                   /translation="MSSFAYFFSESLKGFARNLSTALGSIVTIFLSLLIIGIFLIGGFI
FT                   VDNIVKSVEDKVSVTAYISDDASQEDIDAVESYIRGLDGVAKVGFTTKDQALENFKNSM
FT                   TGNPEIVEQLDGQNPLPASIDVELSEAQQVETVASQIESNATFKKIADNADDPSDSLKY
FT                   GQKTVEKLFTVTNYIRYVGMALVALLIFIAFVFINNTIRLSILARRKEIAIMRLVGASN
FT                   NFIRGPFLMEGALHAIIGAGFAMLVMEVLHRVAMPQMQSALPWLPVSVPESSFLMIYLT
FT                   LLVSGLLIGLLGSTLAMRRYLKV"
FT   gene            653035..654309
FT                   /locus_tag="Ccur_05520"
FT   CDS_pept        653035..654309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05520"
FT                   /product="C-terminal processing peptidase"
FT                   /note="PFAM: Peptidase family S41; TIGRFAM: C-terminal
FT                   peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94271"
FT                   /db_xref="GOA:C7MMY1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY1"
FT                   /protein_id="ACU94271.1"
FT                   /translation="MLRKTRDSASYSEKHNLRLIKFMVSLLCIVLAFVGGFILRGNDAV
FT                   LDRLGMRNTSGSGDLNPGMTVSGNTYDSLSARVAEIQGILNKESVDSYDLDATTSNVLN
FT                   ALTSSTNDSFVHYYDATHYATYLKDVSANYAGVGILFSERKGKAFAVDVFNGSEAESVG
FT                   VQEGDYVVSIDGDRGTDGVWTAAEATKAVTREAGSSVVITFRRPSSPDADGGSEYTVTL
FT                   SCTRYDEPNVTTELIDSVGYIKLTQITQNSDSLVLDAITDLADSGAQSYVFDIRDNPGG
FT                   YLTQAVDLASLFVKSGIAVQINTKSAQTNRTVTGNTATDAPLVLLVNRNTAGTAEVLAG
FT                   ALQDNKRATLIGVQSMGKGSVQSVKELSFGGALRYTSAYYLTPLGYTIDKVGIAPDVQV
FT                   QPGDDDSVDTQKNLAVETAQSLVRE"
FT   gene            654438..655673
FT                   /locus_tag="Ccur_05530"
FT   CDS_pept        654438..655673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05530"
FT                   /product="peptidase family protein"
FT                   /note="PFAM: Peptidase family M20/M25/M40"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94272"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY2"
FT                   /protein_id="ACU94272.1"
FT                   /translation="MNEEQLSFLETMVATPSVTGCEHLVASLVRERLADVADEIDTDVM
FT                   GSVHARVRGTGVPNDAALSAQTDGGASGEEAAGVTNEAETAGVTNETAAATASDEVTAA
FT                   TASDEAAPRVPSVLIAAHMDEIGLMVNYISDEGFLSVKPVGGVDAGLLPGLRVDVHTDE
FT                   GALRGVVGRQPIHLVPADERKQVAPFEKLVIDLGMPADMVKQRVQIGDTVTYGVGFERF
FT                   GDGMAVSRAFDDKAGVFIGIGVACELARGPRAAADFILAATVQEEIGLRGGLTSAYSVD
FT                   ADVCLAFDVTHATDYPGIDKAKHGNIVCGGGPVIARGPNINPVVFNRLVAAAQAEGIDY
FT                   QIEAEPGVTGTDAGEMQIQRGGKACGLVSLPLRYMHTPTEVINLSDVDGCIKLLARFIR
FT                   DLDADVSFVPGM"
FT   gene            655677..656144
FT                   /locus_tag="Ccur_05540"
FT   CDS_pept        655677..656144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05540"
FT                   /product="SsrA-binding protein"
FT                   /note="PFAM: SmpB protein; TIGRFAM: SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94273"
FT                   /db_xref="GOA:C7MMY3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY3"
FT                   /protein_id="ACU94273.1"
FT                   /translation="MAREEKLIARNRSARHEYEVLSTYECGIQLAGTEVCSLRENNAQL
FT                   TDCFALVRRGEVWLMNLHIAPYSHGNLANRDPDRNRKLLLHRNEIRTLQEQTRERGRAL
FT                   IPLKMYFAKNGLVKVELAVCRGKKLYDKRQDLRRRDAAREVERTLKERSRY"
FT   gene            656217..656567
FT                   /locus_tag="Ccur_05550"
FT   CDS_pept        656217..656567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94274"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY4"
FT                   /protein_id="ACU94274.1"
FT                   /translation="MSATHEDTEQEVVYVYVDEDGNEIEVSDDDLEDYEVVEEYEEEYE
FT                   QDEEELEEGEERGGDSSAKSAGEDNPLSYDNVQETTDNLNDIAREGVAAARELKETYDD
FT                   IKGLFSIGNWLK"
FT   gene            complement(656825..657016)
FT                   /locus_tag="Ccur_05560"
FT   CDS_pept        complement(656825..657016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05560"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: Ribosomal L28 family; TIGRFAM: ribosomal
FT                   protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94275"
FT                   /db_xref="GOA:C7MMY5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY5"
FT                   /protein_id="ACU94275.1"
FT                   /translation="MSKVCEVCGKTPVAGRNVSHSHRVTNRMFHPNVQRVTIKDDKGRV
FT                   RKANVCTKCLKAGKVERA"
FT   gene            657287..657634
FT                   /locus_tag="Ccur_05570"
FT   CDS_pept        657287..657634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05570"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF322)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94276"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY6"
FT                   /protein_id="ACU94276.1"
FT                   /translation="MAESITGDLHVANDVLADLVGNAALSCYGVVGMAAPTAADGIAKI
FT                   LPASRLRRGVVVDTSQAGVHVDLYVVIEYGTNINTVSQNLIEAVTFALTNYAQVPLAGV
FT                   DVHVQGVKVRK"
FT   gene            657699..659330
FT                   /locus_tag="Ccur_05580"
FT   CDS_pept        657699..659330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05580"
FT                   /product="predicted kinase, dihydroxyacetone kinase"
FT                   /note="PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94277"
FT                   /db_xref="GOA:C7MMY7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY7"
FT                   /protein_id="ACU94277.1"
FT                   /translation="MAETYTTNDILNAIAAASKALGERKDEVNRLNVFPVPDGDTGTNM
FT                   SLTVKMVVDNLAALPIGASGADIRRAITTGALMGARGNSGVITSQILRGLCEGAAECEA
FT                   FDVPSIDHAFDTASTTAFQAVRKPVEGTILTVLKDTAAAAHRANKKKMPLEEALSFIVS
FT                   EAYASVQRTPDLLAVLKENNVVDAGGFGLAILIDSFVAALTGREAPLGDELAIARSAEP
FT                   KVAIEQINDWEGSAYRYCNEFLVDSDTLDKNEALDFLATMGDCELCVGDNPKFKVHVHS
FT                   NHPDQVLAYFLERGQIFEVFIHNMQLQAADRTAKLAEEQQREHKPLGFVAVAAGAGNAR
FT                   ILESLGVDYVVSGGQTMNPSTKDLLDAVNSVNADAVIVLPNNKNIIMAAQSCAEVSNIP
FT                   CEVVPTTSVPQAFSALIACNPTGGLEENVRVMTDALADVRTGEVTTAIKDAKDAHGNPI
FT                   KAGDVIGIADGSIEAVAQTVDDAVEALLEHLEADEYDTLTILAGDEMTDDAFNALVESI
FT                   ESTYDDLEVDAHRGDQPLYPIVFSLE"
FT   gene            659357..661582
FT                   /locus_tag="Ccur_05590"
FT   CDS_pept        659357..661582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05590"
FT                   /product="RecG-like helicase"
FT                   /note="PFAM: DEAD/DEAH box helicase; OB-fold nucleic acid
FT                   binding domain; Helicase conserved C-terminal domain;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94278"
FT                   /db_xref="GOA:C7MMY8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY8"
FT                   /protein_id="ACU94278.1"
FT                   /translation="MGVDKHTTQRKAARALASSRLSAVLAFDGPVSQVKGVSAGRASVL
FT                   ASWGVRTVRDLIDRFPHRYLDMSERTTIAAATIGQSCTVAGWIHEIKLKRPKPRLDLVE
FT                   ITLRDATGTLLVTCFRQPWLADRLHEGDTVALSGKIEFSYGFKRMTNPYLEVVEGSLDA
FT                   VEGIIIPIHPAGGKLTAAWVRRLVSSALSLCAGLDDPLPLDLRVQYRLMSRQTALQCIH
FT                   FPHTMDEARLARRRLAYEEVFLLELNLMISQRAEAQGASPIAHRIDGPAVRALAKALPF
FT                   TLTEEQMVARDEILHRMAAPTSASHMLLGDVGTGKTAVALFALAAATDSGNQALMMAPT
FT                   EVLAAQHAASAGSLLDAAGVSWALLTASTPTDERACIREGLSNGSLTVLFGTHALLEPD
FT                   IAPRSCSLVVIDEQQRFGVEQRRTLREKGPGCDYLTLTATPIPRTLALALYGGMTLSYL
FT                   TKRPRNRAGTTTRVLVHSRRGEAYEIARDALDAGHQVFVVCPLIGKPASDAQTKHTREA
FT                   AADEEEGYAYARIAIEDEGDLHDDDIHAAREEARFLQEKIFCGYSVGVLHGRMPATEKR
FT                   ASMERFAAGEVDVLVATTVIEVGIDVPNATVMIVEDADRFGLSQLHQLRGRVGRGDVPG
FT                   EVCLISSTKNPVALERLAAMERTENGFELAEFDLSLRREGDILGNRQHGASSLRLVNVI
FT                   RDRAIVETAYRDARTLIEADPDLSQPDHAALRLELSRTFSPHGEGVS"
FT   gene            661585..662151
FT                   /locus_tag="Ccur_05600"
FT   CDS_pept        661585..662151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05600"
FT                   /product="putative methyltransferase"
FT                   /note="PFAM: DNA methylase; TIGRFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94279"
FT                   /db_xref="GOA:C7MMY9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMY9"
FT                   /protein_id="ACU94279.1"
FT                   /translation="MRVISGIYRGRRLVAPAGRGTRPTTDRVRESLMSTIASARGGWDD
FT                   AIVLDAFAGSGALAIEALSRGARWACLCEQDRAALQAIKENTAFITDDSFQIVRGDVLG
FT                   RIVVHPPTPYDIVFLDPPYALDARLLATLLQRLEAAEQLADDALIAYEHDAGRSYAELT
FT                   RLETLSLATSKVYGDTVVDLFRRTI"
FT   gene            662148..662678
FT                   /locus_tag="Ccur_05610"
FT   CDS_pept        662148..662678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05610"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="PFAM: Cytidylyltransferase; TIGRFAM:
FT                   pantetheine-phosphate adenylyltransferase, bacterial;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94280"
FT                   /db_xref="GOA:C7MMZ0"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ0"
FT                   /protein_id="ACU94280.1"
FT                   /translation="MSTPSVRPERRALVPGTFDPITEGHLDIIRRAAQIFDEVLVAVAA
FT                   SPAKGGHGRLFTLEERVSLVRTSTADISNVRVEPFSELLVEFARRMQADVVVKGLRAIT
FT                   DFEYEFQMTAMNYEIERNIETVFIMSPPQYMYLSSSIVREIASLNGPFEQFVSPCVYEA
FT                   LCEKYHLDRTDCK"
FT   gene            662864..664419
FT                   /pseudo
FT                   /locus_tag="Ccur_05620"
FT   gene            664462..664734
FT                   /locus_tag="Ccur_05630"
FT   CDS_pept        664462..664734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05630"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94281"
FT                   /db_xref="GOA:C7MMZ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ1"
FT                   /protein_id="ACU94281.1"
FT                   /translation="MAGAAPSFYPLTCGLKLISEHGYDTTTAQDIVQAVGVSTMTFFRH
FT                   FLSKEDVVLGMSPDSNAIIAAAEALKSSSKDLYPVKLPMLFYRWL"
FT   gene            665239..665715
FT                   /locus_tag="Ccur_05640"
FT   CDS_pept        665239..665715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94282"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ2"
FT                   /protein_id="ACU94282.1"
FT                   /translation="MDETGVLGLLEELSILLEDAKPVFGKGNLRQVDVAAAFEIIDDIR
FT                   DSFPSEFAQSRQIVRERQSLLDDAEAEADRMIEDARSQALTIASEQEIVRISQQQADQI
FT                   MADARELERETRAGAEDYADEVFGHVEQSLDTLLGNVRRCRERLNSSSLGTTAR"
FT   gene            665874..666296
FT                   /locus_tag="Ccur_05650"
FT   CDS_pept        665874..666296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05650"
FT                   /product="predicted metal-binding protein, possibly
FT                   nucleic-acid binding"
FT                   /note="PFAM: Uncharacterized ACR, COG1399"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94283"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ3"
FT                   /protein_id="ACU94283.1"
FT                   /translation="MQSTGKMLILDGTVSGIGNTACARCLDEFEIELTGTIEGCYLLPG
FT                   TPAPTDMDSDEYDVLPMNRIIDVEPLIIAALLVDIPLVPLCRPDCRGICPDCGINLNEA
FT                   SCDCAARRAAARQQEEKAANPFAALESLDLGQPKED"
FT   gene            666434..666613
FT                   /locus_tag="Ccur_05660"
FT   CDS_pept        666434..666613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05660"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="PFAM: Ribosomal L32p protein family; TIGRFAM:
FT                   ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94284"
FT                   /db_xref="GOA:C7MMZ4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ4"
FT                   /protein_id="ACU94284.1"
FT                   /translation="MAVPKGKKGRARTHARRSVHDRIAQPARSVCPKCGEVKLPHRVCP
FT                   SCGFYRDREVIETA"
FT   gene            666882..667904
FT                   /locus_tag="Ccur_05670"
FT   CDS_pept        666882..667904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05670"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="PFAM: Phosphate acetyl/butaryl transferase; TIGRFAM:
FT                   fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94285"
FT                   /db_xref="GOA:C7MMZ5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ5"
FT                   /protein_id="ACU94285.1"
FT                   /translation="MNDTVTIAVDALGGDAGASVVLPGVAAALAQDSHLQVILCGPADI
FT                   VEPFAREHERCQAQVTTEEIAMGEHPATAVRKKRDSSLVVGCRLVKEDRAQGFFSAGST
FT                   GAVLAAGTMVVGRIKGVARPALCTVLPSPAKPVILCDCGANADCKPEYLLQFAQMASIY
FT                   AKTVLGRENPRVALLNIGSEEAKGSRLAQEAHALLKDKFPGFAGNAEGNDVLAGSFDVF
FT                   VTDGFTGNVCLKTIEGTARTLMGALSGVFRANPLTMLAAALVKGGLVDLKRSLSSDETG
FT                   AAPLLGVRGAIMVGHGSSNEQAVKNGVLTSARVARLGVSKIIAQTILPETASGTIIEGK
FT                   "
FT   gene            667967..668806
FT                   /locus_tag="Ccur_05680"
FT   CDS_pept        667967..668806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05680"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: Double-stranded RNA binding motif; RNase3
FT                   domain; TIGRFAM: ribonuclease III, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94286"
FT                   /db_xref="GOA:C7MMZ6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ6"
FT                   /protein_id="ACU94286.1"
FT                   /translation="MVTHDEQREKLDRAQEVLGYRFSDEHFLLSAITHPSAVEGMPVKF
FT                   SYERLEFLGDSILGAVVADAAFHRFPDLDEGGLTRIKVSLVAGSSLSQVANELGFADFI
FT                   IFGQSEAGTGRRGLHSALENVYEAVVAALYLDGGMEVARSFIVQTLLGYMSIDMAREPE
FT                   NPKSALQEKLQEDGITPTYKLIETQGPPHDRTFVAAVYAGLQALARGVGRTKKEAESKA
FT                   AQTALSHLPDEKHKRHKDKGKDKAEHRKKGATSHSQDNDTGEKPIPDTVASNTAGRE"
FT   gene            668810..672364
FT                   /locus_tag="Ccur_05690"
FT   CDS_pept        668810..672364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05690"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM:
FT                   chromosome segregation protein SMC, common bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94287"
FT                   /db_xref="GOA:C7MMZ7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ7"
FT                   /protein_id="ACU94287.1"
FT                   /translation="MHLKSLVLKGFKSFADRSVLSFEPGITAVVGPNGSGKSNVSDAVL
FT                   WVLGERNAKNLRGQAMEDVIFAGSAVRKPVSVAEVELILDNTDGTLPVEYSEVSIARRM
FT                   YRSGESEYLINGTIARRMDVLDILHDSGLGTGTHSIISQGHLASILQSRPEDRRALIEE
FT                   AAGVLKHKQRKARSERKLERMDASLTRVRDIVAEVERTLRPLERKARRALAYKEVSAEL
FT                   AQVKLGLSVDDLRKLQVSWDEARTRDTQLTDKLSDMRATIEHAEKQAETLQHRLQVETA
FT                   DAGQATALLRRAEGISDKLDSNVLVLREKKRSLASYLAEMQLSLEAGTSRLQEAEGRQQ
FT                   EAREAADAAVQAREAADAALKRAQDEADEIQAHKRVLQQKSDEATRARRDALAQLEAAR
FT                   ARQAQMLKQLAENEAAEEMLSTQTAQLTERLEAARRTAQVADEAQVDAQAACEAARVSD
FT                   ETAREAVGKALHERDKARGVVDQARNDRDSAQARFKGLEELERARTQENPLRAWGANAA
FT                   AQPSGPARILEAIRVSDSQMEPLVSQVLADDVWALVARDESEAFNLIDRALAADTVGSI
FT                   SVAYGAQVDTRAQSLSDAPSGAVCLLDYVEADPTVQEALQSLSGDVLVCKTLDDARGAC
FT                   RAGWRAVTPDGVMALPTGTIHLLRADAEGSSARDALSVHGRLEEARKAADSAEKALAAA
FT                   QQRVVAAEDNLRQHQAKNLETSQALAQAKGMAASAAEDARRAAEDLKGLEREAESLAES
FT                   RRAARAALDASRPDAAALDDRIRALSVTIDEATSTINELRDQLAPVRSQADRAVANLAE
FT                   AKLASATAKERTDYAARILIAREQDIKQARRAQLSLSEGIQRKGIAASRIDPLLTSLET
FT                   LCAAARSRAARLETASVASQEATAALHEQINVAREEVRKAHDAFDTANEHLSDLRVEAG
FT                   RLEMRVEAAISTIVDECATPLETALSLPELDDRSTAEASAFKLQRKIDGMGTVNPDAAE
FT                   EYEQLKERFDYLNTQLEDMLTARRSLARIVTIIDERMKDDFANTFARVDDNFRRIFEVL
FT                   FPGGSGSLELVDPDDMENTGVEVNAQPSGKRILKMSLMSGGEKSLVALALLFAVYKTRS
FT                   TPFYILDEVEAALDDTNLRRLAAYLDSIRHETQFIMITHQRRTMEMADVLYGISMQADG
FT                   VTKVMSQRLDKALRYAEG"
FT   gene            672368..673522
FT                   /locus_tag="Ccur_05700"
FT   CDS_pept        672368..673522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05700"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="PFAM: SRP54-type protein, GTPase domain; SRP54-type
FT                   protein, helical bundle domain; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94288"
FT                   /db_xref="GOA:C7MMZ8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ8"
FT                   /protein_id="ACU94288.1"
FT                   /translation="MFESVKQGMSRTRQMFTERMNVLLDRGPAVDEEFWEGLEEALILA
FT                   DVGAPAALDIVEALRVEATRHALPDAYAVMDALADQIASSFTTEGQGLFEENPVLVLFV
FT                   GINGAGKTTTVGKIAAHSKAHGRSVLLGSADTFRAAAIEQLEEWARRSQVEIVERERGS
FT                   DPASVCYDTIERAEALGSDLVLIDTAGRLHTSDDLMRELQKVVSVVRRRAAMPVRTVLV
FT                   IDATTGQNGLSQARAFDKALDLDGLIVTKLDGTAKGGIALAISHELSLPIVKVGVGEQL
FT                   DDLQEFDAHDFAAALIGAEAVYETDGEARDSATENLASSNLVSQAPSEPEPEPEPEPER
FT                   VTQAAESFATAAPDTTYAEEPKPQEGRFRRLFKWRGRKREDDAR"
FT   gene            673512..674924
FT                   /locus_tag="Ccur_05710"
FT   CDS_pept        673512..674924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05710"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="PFAM: Signal peptide binding domain; SRP54-type
FT                   protein, helical bundle domain; SRP54-type protein, GTPase
FT                   domain; TIGRFAM: signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94289"
FT                   /db_xref="GOA:C7MMZ9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C7MMZ9"
FT                   /protein_id="ACU94289.1"
FT                   /translation="MLDSLSERLQGIFGGLRGKGKLTEEDIDAAMRDIRLALLEADVNY
FT                   KVVKSFVARTKERCLTAEILDSLTPAQNVVKVVLDELTGLLGGDSPRLELTSRIPNVIM
FT                   LVGLQGSGKTTAAAKLAYLLKKRNRNPLLVACDVYRPAAADQLQTLGDEIDVRVYRGEG
FT                   KDPVAIAREGVQDAIDHLRDVVIVDTAGRLHVDEDMMAEASAIKDAVNPDQILMVVDAM
FT                   TGQDVVNVAAAFAERVDFDGVIMSKMDGDARGGGALSVREVTGKPIKFISAGEKPDSLE
FT                   EFHPDRLAKRILGMGDVVSLIETAAQLQEDQLADEAAERMLKAQLNLNDFLEMNKRVRK
FT                   MGGIQKLVSALPGGDRALSQGQVDMSALDRMETIIFSMTAEEREHPDVLNGSRRARIAR
FT                   GAGVTVTDVNQVMKKFNETKKMMKQFMPTEEVSSRGKKGKKRKGKRRRTLPGMGGMGAV
FT                   DLKKLQDMIGQM"
FT   gene            675152..675775
FT                   /locus_tag="Ccur_05720"
FT   CDS_pept        675152..675775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05720"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="PFAM: Translation initiation factor IF-3, N-terminal
FT                   domain; Translation initiation factor IF-3, C-terminal
FT                   domain; TIGRFAM: translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94290"
FT                   /db_xref="GOA:C7MN00"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN00"
FT                   /protein_id="ACU94290.1"
FT                   /translation="MSAIDESYQKEVFAIAAKEPRLNEAITAREVRLIGYDGEQMGICA
FT                   TEEAQHVADMAGLDLVEIAPNAQPPVCRVMDYGKFKYEQAIKAKQARKNQSKIEIKEMK
FT                   FRPKIDVGDYTTKKKHVIRFLEQGNKVKITIMFRGREMAHPEQGLSILERLADDLKDMA
FT                   AIEAQPKMEGRNMHMVIAPLASAIKKKKDVVAKGGKAKQGKEEE"
FT   gene            675779..675976
FT                   /locus_tag="Ccur_05730"
FT   CDS_pept        675779..675976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05730"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: Ribosomal protein L35; TIGRFAM: ribosomal
FT                   protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94291"
FT                   /db_xref="GOA:C7MN01"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN01"
FT                   /protein_id="ACU94291.1"
FT                   /translation="MPKMKTHSGTAKRFRVTGSGKIMHAKAFKSHIMTKKSQKRKRNFR
FT                   HETELAHADQKMIGRNLGIR"
FT   gene            675998..676351
FT                   /locus_tag="Ccur_05740"
FT   CDS_pept        675998..676351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05740"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="PFAM: Ribosomal protein L20; TIGRFAM: ribosomal
FT                   protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94292"
FT                   /db_xref="GOA:C7MN02"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN02"
FT                   /protein_id="ACU94292.1"
FT                   /translation="MPRVKRAVNAHKKRRVVLKRARGYYGAKSRSYRAAKEQVRHSLQY
FT                   QYRDRRNKKREIRRLWITRINAAARLNGMSYSTFMNGLKKSGIELDRKVLADMAVNDAA
FT                   AFAALVEVAGKAL"
FT   gene            complement(676792..677133)
FT                   /locus_tag="Ccur_05750"
FT   CDS_pept        complement(676792..677133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05750"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94293"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN03"
FT                   /protein_id="ACU94293.1"
FT                   /translation="MRIAVASDGLDVAQHFSQCLNFNYYTTQSYQIIDSQNIPAQGLSA
FT                   EEYAQLMEGIGVDALIGNNISPDAQEAFSLRGIDIVSSASGRAIDAAAAYIDRCADVLV
FT                   ADVPQDDDE"
FT   gene            677262..677360
FT                   /locus_tag="Ccur_05760"
FT   CDS_pept        677262..677360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN04"
FT                   /protein_id="ACU94294.1"
FT                   /translation="MLPLNGDKYKACGKGREKGMMKRGAILTANVD"
FT   gene            complement(677397..679052)
FT                   /locus_tag="Ccur_05770"
FT   CDS_pept        complement(677397..679052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05770"
FT                   /product="DNA/RNA helicase, superfamily II"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94295"
FT                   /db_xref="GOA:C7MN05"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN05"
FT                   /protein_id="ACU94295.1"
FT                   /translation="MSKTFHDLGLSEKALAAVDLLGYTDPTPVQEQAIPAVLAGRDVIA
FT                   AAKTGTGKTAAFSLPTMDRLGHARHGQGPLLLIVTPTRELALQIESVCRTIAKRSGHRV
FT                   TCVVGGVSYNPQIDSLRRGTDVLIATPGRLIDLMNQDAAHLNQVETLVLDEADRMLDMG
FT                   FLPDMRRIVAACPTQRQTLLFSATIDSAIEDNMAHLLNNPVFVEIAHRGETADTIEQYR
FT                   IPVDHRHKNDLLIALLNERGGTRIIVFARTRHRVDTCVRKLRKAGFAVEPIHSDRSQNQ
FT                   RKRAIEALEAGKCDILVATDVLARGIDIPNVNYVVNLDMPDQVEDYVHRIGRTGRAGEA
FT                   GCAISFVTPENKAILRDIQKLIGKDIPEMSVESFDSSASDNALAAKATRANAQNDPELA
FT                   TAAREDKSRKKAKSSRSSRREHNTEDQRAGGQQRGHKNPRGNKSNRNNSERHFDESERS
FT                   EQQGTRRGRTRRDQRNEYENPHKTRGTAKKQRKKNQRAGAAHESERNRKGRSANDVRGD
FT                   FRKGRTTSNSHGDFRPGRSQRARRDAQHRRSQRG"
FT   gene            complement(679165..679374)
FT                   /locus_tag="Ccur_05780"
FT   CDS_pept        complement(679165..679374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94296"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN06"
FT                   /protein_id="ACU94296.1"
FT                   /translation="MVFNDTGDRMQHSIAGCSRTYMKTIFVNIRATKHKSADGMLIRCV
FT                   STRTESGTSPLRYSARCCLYRFRL"
FT   gene            679501..681336
FT                   /locus_tag="Ccur_05790"
FT   CDS_pept        679501..681336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05790"
FT                   /product="CTP:phosphocholine cytidylyltransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94297"
FT                   /db_xref="GOA:C7MN07"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN07"
FT                   /protein_id="ACU94297.1"
FT                   /translation="MELSKSEFDVLVALKLDFPQTQRDIARSRHLSLGAVNRAYRSLQE
FT                   AGLINAFQLTPAGEKQLSTYRVDNAIIMAAGLSSRFAPISYERPKGVLMVRGEVLIERQ
FT                   IRQLQQAGITDITVVVGYMKESFFYLEDLFGVKIRVNEEYRQRNNNSTLMLVRNQLGNT
FT                   YICSSDDYFTENVFEPYVYRAYYAGVYQDGPTDEYVMELGPANRIRSVSIGGPCGWSML
FT                   GHAYFDRRFSKQFISILESIYRLPETAPKLWEDIYREHVKELDMVMRPYDATVIYEFDS
FT                   LAEVQAFDHDFLTNVDSAIFDHICSVLHCKREDISDIEPIKQGLTNLSFRFSAQGGSYV
FT                   YRHPGVGTEEIISRKSESFSQKVAADLGIDGTFIYEDPTEGWKISHYLVDCEMLDYHNH
FT                   EQVAQAMQIARTLHSCGVTSDFTFNLNEKTRQTIALLDRGRAASFRDYPELVERAQRLY
FT                   NVVSAQGVAPVLCHNDFYAPNFLVGKDRIDLIDWEYSGMSDYASDLGVFICCSDYSYDE
FT                   AIEVLELYFERPLTPDELVHCVSYISIASFYWFVWALYKEMCGESVGEFLYLWYRYAKD
FT                   YGIRAEKLIAAAKGDGGRTASKNIREITNRGTLWN"
FT   gene            681327..682535
FT                   /locus_tag="Ccur_05800"
FT   CDS_pept        681327..682535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05800"
FT                   /product="ethanolamine utilization protein"
FT                   /note="PFAM: Ethanolamine utilisation protein, EutH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94298"
FT                   /db_xref="GOA:C7MN08"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN08"
FT                   /protein_id="ACU94298.1"
FT                   /translation="MELIGTAVVYLIMACALVGCAASVIKPESELGKEFVAGIDAIGPI
FT                   FLPVAGIMASAPYLTAFVSAVFGPAYSALGADPAMAATTFIAVDMGGYQLADALAQTRE
FT                   SWIMAMMTGYMAGATIVFTIPVALKMLVKRDRKYLALGVMSGLLAIPIGVLVASVIIAF
FT                   SHPVVREAVSTNAEAAYQLALSFSQIGLNLIPLIIICLTLAAGLKFKPDAMIRGFIVFG
FT                   RVMESALKIVFVLVVIEYFTGIFTTLFGSFGFEPIIADDADKFRALEVSGAIGMMLCGV
FT                   FPLVYLIKRYLAAPLAKIGGLFGLSSDATAGLLAASANVLAALSMVKDLKARDKVIVIS
FT                   FAVCCAFLFGDHLSFTANFQPTLIVPVLVGKMAGGIAAIAFSYVFAVKKAEELEKLDEA
FT                   AGA"
FT   gene            682653..682727
FT                   /locus_tag="Ccur_05810"
FT   tRNA            682653..682727
FT                   /locus_tag="Ccur_05810"
FT                   /product="tRNA-Glu"
FT   gene            682954..684795
FT                   /locus_tag="Ccur_05820"
FT   CDS_pept        682954..684795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05820"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94299"
FT                   /db_xref="GOA:C7MN09"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN09"
FT                   /protein_id="ACU94299.1"
FT                   /translation="MEIRFTKRTALLIACDIAATFLSYFFASLITGLADEVFATHEIYF
FT                   LLGVAVVINLGFFAAFRLYNDLWEYASVDDALRITFTVGLSTLVTAVFLWLAGQWIPIR
FT                   VYVAALIIMVFFVGGSRMFFRVLRSKRREIERAHADEERPRTLIVGAGETGSLAIMRMA
FT                   SKDPQMPGEPIVAVDDDKKKRNLRVHGVRVAGTSEDIIELVERFGIEQIVVAIPSASIN
FT                   DRKRIYSICTQTTCQLRTLPNVRELKLDEINDIALRDVNVADLLGREEVVLNTRLVSGY
FT                   IAGKTILVTGGAGSIGSELCRQMCPVAPARIVVFDMWENDAYLLKRSIQEQYDDIDVQV
FT                   EIGNICDESRLRDVFEKYHPAAVFHAAAHKHVPLMEMCPREAIQNNIFGTLNTVRLAHE
FT                   FGVARFIFISTDKAVNPTSVMGATKRMGEMIIQHYAQKSNTVFAAVRFGNVLGSNGSVI
FT                   PIFKKQIKEGGPVTVTDPGIERFFMTIPEASRLVIQAGGMATGGEIFILDMGEPVKIVD
FT                   LARALIQLSGLEVGKDIEIVYTGLRPGEKMYEELLMNEENTLPTKLSGIMISTGREVSF
FT                   EEVEAKLVSLKESMSADDATALRVLEQAVPTYTITKN"
FT   gene            685161..685580
FT                   /locus_tag="Ccur_05830"
FT   CDS_pept        685161..685580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05830"
FT                   /product="Glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="PFAM: Cytidylyltransferase; TIGRFAM:
FT                   cytidyltransferase-related domain; glycerol-3-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94300"
FT                   /db_xref="GOA:C7MN10"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN10"
FT                   /protein_id="ACU94300.1"
FT                   /translation="MKRVITYGTFDLFHYGHVNLLKRARELGDYLIVAVSTDEFNWEAK
FT                   GKKCYFPYEQRKSLVESVRFVDLVIPETSWDQKLSDIKRYHIDTFVIGDDWKDRFNFLE
FT                   EAGVEVVYVPRTPEISTTQIKADLGSQGLSPLVED"
FT   gene            685654..687213
FT                   /locus_tag="Ccur_05840"
FT   CDS_pept        685654..687213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94301"
FT                   /db_xref="GOA:C7MN11"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN11"
FT                   /protein_id="ACU94301.1"
FT                   /translation="MASSRVANSLKNVFAAWGGQALYALASFVVRAVFVATLAQEFVGL
FT                   ETLFASLLTILTLADLGVGSAIVFALYEPLATDNKEVVKSLMRLFKRAYIVIGIVIIVL
FT                   GIILAPNVRLLLGADAPDIPLLEVYFFCFVLNTGISYFFSYKGSLINADQKSYIVYLIQ
FT                   YSFLTVMCLFQIAVLVITHNYLVFLICMIASTLFQNIVIALTANRMYPYIKEKDVKPLD
FT                   RGILRSIEKNVVGLMMHRIAGVASTPVNNLVITSFVGLATTSLYGNYLLVIQAMERILA
FT                   KVFDSIIASVGDLGVREGEQRQYEVFQTAFFVNALVFGGVAGGMMCSFNSFITLWVGSD
FT                   WCLPDYLVILIVLLFFVKGMRSAGETFTSAYGLYWITKWKAVLEAIFLPVLAIILVQPY
FT                   GMAGVLIASMISSLGISTVYEAWAVYRHGFHMPLRAYIRMFSLYVLVCVVAMLAAFWLC
FT                   TNMALTGIVGFLVNGLVGMVITAGVVVLVFGRTRPAREAFGIAARIFNHVIAKLPFYKA
FT                   QG"
FT   gene            complement(687303..688175)
FT                   /locus_tag="Ccur_05850"
FT   CDS_pept        complement(687303..688175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05850"
FT                   /product="LPS biosynthesis protein"
FT                   /note="PFAM: LICD Protein Family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94302"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN12"
FT                   /protein_id="ACU94302.1"
FT                   /translation="MRKLKLDEIRAIQMDILLRVDKLCQEEDLAYELAYGTLIGAVRHQ
FT                   GYIPWDDDIDLIMPYPDYRKLIDIVNKQGTGGILDGRYRFAAALVESDLPYHASFMKVY
FT                   DNRTRAESSALRSSQGFREGVFIDIFPLSGLPTNEADRTEVLERFRRINDGRYYCVTKP
FT                   QRWEFNPLYPKRAAKNAWGYLSARFKPASWWVARCADVLENLPAPDDSPWTCVLPSWGA
FT                   DGKTFLEGNPWFPTKRVSFEGHDLPIPENYDFILHRQYGDYRKLPPKEEQVTSHDQDFY
FT                   LLEEGDLES"
FT   gene            688285..689340
FT                   /locus_tag="Ccur_05860"
FT   CDS_pept        688285..689340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05860"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94303"
FT                   /db_xref="GOA:C7MN13"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN13"
FT                   /protein_id="ACU94303.1"
FT                   /translation="MDSIQTSPDSAREPLGLITLGIVAYNEHDALPDILSDVLAQDFPR
FT                   SYIEIILVDSASTDDTRAIMEEFAQTYSGVDNGFKSVRVLDNSARIIPAGWNVALRAFS
FT                   GDAFLRIDAHARIPSDFVRMNVTVLNEGEYVCGGSRPATVSPDTPWTRTLLMAEESAFG
FT                   SSVADYRQGSEKKYTSAVFLPAFRREVIERVGLYDERLLRTEDNDYCYRIRTAGFRIRF
FT                   DARIHSTQVARNTLGGMMHQKYGNGYWVGRTAFIQPKCLHAYHFAPFVMVVGALVLALS
FT                   AAITSWWIPLVGCVVLYLALCVVLAVRSAMKTDRRFAVFLALPLLFPCIHVSYGIGTSA
FT                   GLLAGIACGRK"
FT   gene            689346..690200
FT                   /locus_tag="Ccur_05870"
FT   CDS_pept        689346..690200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05870"
FT                   /product="LPS biosynthesis protein"
FT                   /note="PFAM: LICD Protein Family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94304"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN14"
FT                   /protein_id="ACU94304.1"
FT                   /translation="MAEAEYADVATGKLRELQLCELDLMQRFVAFCKKHDIRYYMIGGT
FT                   LLGAVRHGGFIPWDDDVDLGVPRPDYDRFLELAEAEFTDKDTKVISIHHDQSSRQGMAK
FT                   ITSSKMQIINRSANVELKQDVWIDIIPLDGFPAPGLASCLHKARLMFWKVMDATTEFDY
FT                   VVDTKRKRGFPQDQLVSILGFLCRYIHPFGHDYHRIFMKMEDALRKYPYDESTRCINMY
FT                   AAQGFREVFPREAMGEGAPILFEGEPFTAPAQMYKVLTIIYGKDYMSPPPIDERNYHNS
FT                   EVL"
FT   gene            690213..692078
FT                   /locus_tag="Ccur_05880"
FT   CDS_pept        690213..692078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94305"
FT                   /db_xref="GOA:C7MN15"
FT                   /db_xref="InterPro:IPR029468"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN15"
FT                   /protein_id="ACU94305.1"
FT                   /translation="MKARKNTSERYTITLAHGSLRGIAVSLQAALLPLAIIIFTAGWYL
FT                   FDFDVMLAGVACLFVANVLYACLNLRDRLLFLFLHAGIALFLLSRPLIAEFDEKLTWKL
FT                   SSPEATFFALAALFISLACCFIGDVVFSACVSYNKRRVAQRAQLRPTLVCDALQQADQQ
FT                   GESAAETHADGRVFRHESARLLSVRFSLAGLTNTLASSEKVRCLRIATALLFIVCLVGA
FT                   LAEGAILVVHMRGMHYEEFYLTSTSDYVPWSIDLLKVMLPYMLCGYLATLPRRRPATLA
FT                   LTAFIITAIPMLMIGSRADFVIDVLFAALYCVLRQIIDTDERWITRRVVIAAVILIPVG
FT                   IFALGMMDYIRSDKANPEFTFARQIVDALYKQGVSFTILGHGFDVNGQIQDLGFKFYSM
FT                   GGVITNFTQGFIGTTFFGFHDLGSANSPDLALYGNSYAHAMSYFAHPNYLGGEGYGSSY
FT                   LLELYADFGYGGIAVGSFVISFCLGALSRSIGRSWFWGMIALISSQLVFHMPRGYAGEW
FT                   IDFMITTRFLLAVVLIICLAALVAFAMRGWVKDCTTHIPSLMTVAPRLSGKVPLHDTIT
FT                   SSGLAVGSQAGAGHLVDNPARGTPATFNSFGIPLVSAILVPKQKR"
FT   gene            692088..693170
FT                   /locus_tag="Ccur_05890"
FT   CDS_pept        692088..693170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94306"
FT                   /db_xref="GOA:C7MN16"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN16"
FT                   /protein_id="ACU94306.1"
FT                   /translation="MFNFSTVCESVRRHWIPIAIITAVCLLAGVGSSYLRSDGTVDASP
FT                   KYTAEAAVYAIGYGYGEQNHIGDSYNYQQNETLMSNDIRRIMVSAEVAGEVRAKYGSDV
FT                   TITVPWWYDTKSNSTISSRYVFVNVVASDAQTALDAAQEIADKTVEIAKDRVPISYIEV
FT                   AEPATLTSTDAQKAGDWGSNALVSSSSTTGQATASSPSLSVKNIVIFLFVGLAGSIVLF
FT                   AAWDILSRRVRSATDIERLLDIPVLAHLAAGDSGEVAASAVAALTKRSNIESLVVVGAS
FT                   SRDEAPAVVERISSIDGLSVTGPVFLAQDDKAALRLQEGQAVLVVLREGASSGRQIENA
FT                   LSQIKIAGTPVLGAVFVSKK"
FT   gene            693377..694444
FT                   /locus_tag="Ccur_05900"
FT   CDS_pept        693377..694444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05900"
FT                   /product="serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase"
FT                   /note="PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94307"
FT                   /db_xref="GOA:C7MN17"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN17"
FT                   /protein_id="ACU94307.1"
FT                   /translation="MLNFTVGPVQMNDQVRKIGSEQVPYFRTDEFSTVMLENERLLKEL
FT                   AGASSSSRAVFITGSGTASMEAAVMNCLTIHDKVLVVDGGSFGHRFCELMDIHSIPYEA
FT                   LVLERGQVFTEADLAPYAQGGFTAFVLNMGETSTGVLYNMELVAQFCRDNNLFLITDAI
FT                   SSFLADEVHMAKWGIDVLIIGSQKGLAVPPGASALVLSEAALDRVQKAYPAIMYFDLTR
FT                   ALANAERGQTPFTPAVGILLQINERLREVTSIGLEAELARVRHQAEDFRQRIEGMPFHP
FT                   FAAHPSCAVTSLEAEGFSARDLFVQMKDVYHMWVCPNGGELADRVFRVGHIGNLTPSDN
FT                   AALIEALKYALDDIN"
FT   gene            694459..695853
FT                   /locus_tag="Ccur_05910"
FT   CDS_pept        694459..695853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05910"
FT                   /product="cytidyltransferase-related enzyme"
FT                   /note="PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold; Cytidylyltransferase; TIGRFAM: glycerol-3-phosphate
FT                   cytidylyltransferase; cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94308"
FT                   /db_xref="GOA:C7MN18"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN18"
FT                   /protein_id="ACU94308.1"
FT                   /translation="MRDGKKVVITYGTYDLLHFGHIALLKRARALGDFLIVGITSDAFD
FT                   KQRGKFNVSQSLVERIEAVRSTGLADMIVVEEYRGQKIADIQKYHVDVFAIGSDWQGKF
FT                   DYLEKYCEVVYLERTKGVSSTELREKDADELTIGCIGCDYLSDRFVRESSFVLGAHITA
FT                   AWDEDEDTRDAFCRHWNLQQVASIDDLLDTVDAVYISLPINERFSTIEQALRAGCHVIA
FT                   EGPQFLSTAELNHARTLAQEGGLILFDAVKTRYFPAFEHLKLLLESGIIGEVKDIDASF
FT                   SHVFDELDKANRYEGSFYDMASYILLPAVDFLGPDFLRKDLICRFEGDFCTWTKCNLTY
FT                   ASSTATLRTGRGMKTEGDMTITGTDGFLYIPSPWWLMNYFELRTEDLRATKRFYFEYAG
FT                   EGQRYELAEFMRIVFDKNRQDSSNEVRAWARMEAVTRLVEAFDCGDIFKLTDSACAFGG
FT                   GETVVD"
FT   gene            695863..696840
FT                   /locus_tag="Ccur_05920"
FT   CDS_pept        695863..696840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05920"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94309"
FT                   /db_xref="GOA:C7MN19"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN19"
FT                   /protein_id="ACU94309.1"
FT                   /translation="MANPLISVIVPVYNVEKYLDRCMQSIVDQTYRNLEIILVDDGSSD
FT                   GSGALCDTWAQQDNRIIVLHKKNGGLSDARNAGVQTSHGDWIGFVDSDDYIDKQMYESL
FT                   YSLIEYTNSDMALCAVADVYADHTDVPAMSAENFTVLTTKEVLSDIFLNKTLMVGVPPR
FT                   LYPAWLVREVPSPAGKTHEDAFIVVDLFSRVEHIVIDRVPRYFYCHNEGTITSTPSLRA
FT                   ASDNIEAWEHNRVLVEKLYPDLMQDVLFRCYWAHFDVLDGMMLSNAEMHEQQKVINYLL
FT                   SHKADILAHPHVSAKRKLALRLLSISKKLYRLLVMLQNRHIRYN"
FT   gene            696855..697991
FT                   /locus_tag="Ccur_05930"
FT   CDS_pept        696855..697991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05930"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94310"
FT                   /db_xref="GOA:C7MN20"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN20"
FT                   /protein_id="ACU94310.1"
FT                   /translation="MRVGIFVSSLQCLGGAIRVAVSMANRLCSDISVTLFELTGHQETP
FT                   YPIDSRVSIVSLGVDDGRIRQKVRSSYQALKNALSTHPVDLMLGIGLDETVEAIAPCRM
FT                   RRVPLVYCDHGALINQLDDRSTTFLRRVCVTLCPKTVTLTQQTLEDYQRIMHVPARKLV
FT                   CIPNWIPDYLFANAQHYNPSLKRILWAGRLDAEKGVDHLVAIAAQVLPSRPDWIWDVYG
FT                   ASVLENTSFNIVDEIEQAGISKQLRLCGTVDDMPDRYPRYSIGTLTSYREGLPLFLLEG
FT                   KASGLPLVSFDVDTGPRDIIKDGQDGFLIKPYDCTSYAQHLAQLMDNEQLRAQFSAASQ
FT                   YGAEAFSESRVSRLWLDLFDEITGKKIKKQQRGRQGTK"
FT   gene            698132..699004
FT                   /locus_tag="Ccur_05940"
FT   CDS_pept        698132..699004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05940"
FT                   /product="LPS biosynthesis protein"
FT                   /note="PFAM: LICD Protein Family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94311"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN21"
FT                   /protein_id="ACU94311.1"
FT                   /translation="MGISLREYQLFELKILKEFSGICDQHNLNWWIGYGTLLGAARHKG
FT                   FIPWDDDIDVWMMPDDYLAFREICRTELNSEYYLNVHSFNPANAITWQCLGVRNTTSIP
FT                   RNQLDVPADWGVCMDIFPLVPCPNPETPRFSGFLKRIRSFQRLSSKYVYANDVSKTSGL
FT                   RKLYNKWRASGSDEQNITKWLAVENALFTDKANLASGWVTDIDCVEPADSYKRSWFDST
FT                   VYLDYEDMKVPAPGEYQKVLAHCYGEDWAQIPDESSDLRWCHSGGGSDDVIVSLDTPYT
FT                   DYWPENRVD"
FT   gene            699180..701441
FT                   /locus_tag="Ccur_05950"
FT   CDS_pept        699180..701441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05950"
FT                   /product="glucan-binding domain-containing protein"
FT                   /note="PFAM: Putative cell wall binding repeat; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94312"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN22"
FT                   /protein_id="ACU94312.1"
FT                   /translation="MKREISRRGFVIGGAYAGMAAATGAFMFSPSAAFAADVTRIHVMA
FT                   FTDMDAIVLESNGRFAMVDSGEDSTYPGGSDARYPWRDGITKGNGHENEVISYLHSLGA
FT                   TESNFEFYLGTHPHSDHIGSASQVINEFRPKRVYTPEYDDSYITDSNALWDNQYCYDRL
FT                   VEAAHNVGATLITSFDTSAPIDPVADASAAQRSASVETDPSAGTDAPAAESLSREDIIE
FT                   RFGVDPTDPHDPNNSSELPDGRVRAVVPASPNERSVASNSQTTGNPVFSLGAMTIEVMN
FT                   YGDDYKLYGRPDCNWFSLGVKVSAYGKTAFLAGDINNYDGDEDRLASLLGHVDFLKTGH
FT                   HGFWGSNTTNYLHALSPRYAVQTGPYDRPETQVLEDFCDMGTKFYTTPDVAAEGYQAVI
FT                   ATFNSSELQINVADDSTHYRMRSLAPAVVRWGGHAGVASTGWEYIEGAWYYFDGHAYAM
FT                   HESWKEIDGNWYFFGEDSKMVTGWVDWDGWYYTGVDGIMQTGWQKIKDDWYCFDETGLM
FT                   LSDAWSGNYWLGHDGVMARNQWVDDGHYYVGADGAWVPSRTRPVWRSDTVGWWLEHPDG
FT                   SYPQNTWEAVDGSWYYFSALGYVASGWQQVGGLWFYLNPDHDGNFGVMQTGWQNIAGSW
FT                   YHFDSSGAMETGWIDDSGLWYYLREDGTMATGWLYCDGSWYYLKEDGSMARGWLSYGGA
FT                   WYLFSSSGAMQVGWRQDDGAWYFFSDSGVMQTGWVDDVAAGKSYHLRSDGTWDGQSRAL
FT                   "
FT   gene            701609..701914
FT                   /locus_tag="Ccur_05960"
FT   CDS_pept        701609..701914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05960"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: Ribosomal prokaryotic L21 protein; TIGRFAM:
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94313"
FT                   /db_xref="GOA:C7MN23"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN23"
FT                   /protein_id="ACU94313.1"
FT                   /translation="MYAIVKTGGKQYKVASGDIIDIEKLDAAEGDKVSLEAIALIDGGK
FT                   VTTEPSKVAKVKVEAVVIDQYKDKKKLVFKFKKRKNYQRLRGHRQNLTRIKIESIA"
FT   gene            701933..702187
FT                   /locus_tag="Ccur_05970"
FT   CDS_pept        701933..702187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05970"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: Ribosomal L27 protein; TIGRFAM: ribosomal
FT                   protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94314"
FT                   /db_xref="GOA:C7MN24"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN24"
FT                   /protein_id="ACU94314.1"
FT                   /translation="MAHKKGLGSTRNGRDSHAQRLGCKKFGGEKVIAGNVIVRQRGTHF
FT                   HPGENVGRGKDDTLFALCEGTVKYTRGVKRKVHVVPTQA"
FT   gene            702368..703762
FT                   /locus_tag="Ccur_05980"
FT   CDS_pept        702368..703762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05980"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="PFAM: Domain of unknown function (DUF1967); GTPase
FT                   of unknown function; GTP1/OBG; TIGRFAM: small GTP-binding
FT                   protein domain; GTP-binding protein Obg/CgtA; GTP-binding
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94315"
FT                   /db_xref="GOA:C7MN25"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN25"
FT                   /protein_id="ACU94315.1"
FT                   /translation="MFIDKVHIHVKGGDGGAGCMSFRREAHVPKGGPDGGDGGHGGNIV
FT                   IQADGSVSSLIDYRFKHHFKAERGVHGKGSRMHGADGADCILRVPVGTVVRAWNEEKSE
FT                   AGETIADLTHDGDAVVVAQGGAGGRGNIHFVTSTRRAPAFAELGEPASEHWIELEMKLM
FT                   ADAALVGMPSAGKSSLIARMSAAKPKIADYPFTTLAPNLGVVRSDDYDYVIADVPGLIE
FT                   GAHEGRGLGHEFLRHVERCALIVHVVDITGGFEGRDPVEDYCIINQELKLYASELANRP
FT                   CIVVANKVDVPGFEDNLARLEAVVREDSLAAVGGNEFAESPINPKLFLTSAVVGKGIES
FT                   LKAVIGAEVARIRAAARTAAAEQPHYDHVWERRRQAADKRFSAVMLSPGVFRVEGPQIE
FT                   RWVVQTDWDNEEAITFLQHRLRRAGVDAALEAAGARDGDEIRIVGYSFAFESARQHEDV
FT                   FSELEL"
FT   gene            703762..704595
FT                   /locus_tag="Ccur_05990"
FT   CDS_pept        703762..704595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_05990"
FT                   /product="nicotinate/nicotinamide nucleotide
FT                   adenylyltransferase"
FT                   /note="PFAM: Cytidylyltransferase; TIGRFAM:
FT                   cytidyltransferase-related domain; nicotinate
FT                   (nicotinamide) nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94316"
FT                   /db_xref="GOA:C7MN26"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN26"
FT                   /protein_id="ACU94316.1"
FT                   /translation="MMDEASIADTVQNRLAAWGIPICNAGGIRDASTDASSADVGSAGV
FT                   PPTDVASTGVPPIDVSSADDVASRARDQKPFHLGVFGGTFDPIHLGHLSLAEQARCACN
FT                   LDAVLFVPAGKPVFKRDRVITDARHRLAMCEIACRANPFFAVSSIEVDRPGSTYTIDTL
FT                   RALRALVPSWVSLSLIVGTDALSSVSHWRSVEEISALADFIEVVRPSSNQHKDEFPVCD
FT                   SAEQPTCHLRVHTVQAPELDISSSAIRAMIFHNRSVRYLVPEAVYDYIIDHQLYR"
FT   gene            704609..705301
FT                   /locus_tag="Ccur_06000"
FT   CDS_pept        704609..705301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06000"
FT                   /product="conserved hypothetical protein TIGR00488"
FT                   /note="PFAM: HD domain; TIGRFAM: uncharacterized domain
FT                   HDIG; conserved hypothetical protein TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94317"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN27"
FT                   /protein_id="ACU94317.1"
FT                   /translation="MLLERVATLISEEHLLLPDTANPWSKENYQYLKHQLKERVSPRRF
FT                   KHSKGVAKTARALARCYGFDADKARIAGILHDWDKGLNNEAVRARVTELGLTIDPMVVR
FT                   DMPWLLHGPTAAAALERACPELGSEVFSAIAHHTSGTADMRLLDCIIYLADIIEPNRTY
FT                   GDADGIEHLRSLVGKVSLEQLYFEAFKYTLAFLVDQERLLYPGTIDIWNALMARFGDLA
FT                   RMKRAGQL"
FT   gene            complement(705403..705816)
FT                   /locus_tag="Ccur_06010"
FT   CDS_pept        complement(705403..705816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06010"
FT                   /product="iojap-related protein"
FT                   /note="PFAM: Domain of unknown function DUF143; TIGRFAM:
FT                   iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94318"
FT                   /db_xref="GOA:C7MN28"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN28"
FT                   /protein_id="ACU94318.1"
FT                   /translation="MTEQPASSRSIALIAAKAADEKKATDIMIQEVSELTSVADYFVVV
FT                   TAMNNRQVDAIVEAIETAVREQTGEKPTGREGLDEGTWALLDFGAVVVHVLQPEARDYY
FT                   RIEELWNDAPIIDLNEAGITDAIYSKRIADLLG"
FT   gene            complement(705952..707286)
FT                   /locus_tag="Ccur_06020"
FT   CDS_pept        complement(705952..707286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06020"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /note="PFAM: TRAM domain; tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94319"
FT                   /db_xref="GOA:C7MN29"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN29"
FT                   /protein_id="ACU94319.1"
FT                   /translation="MEQTLTIEALSYGSAGIAHAGDGKTIFVKQGVPGDVVRVAIDEDK
FT                   PRFARGHILEVLQDGPARIQTPCPYATACGGCPWQHIAYETQLEAKRENITAQLVRIGG
FT                   INSKQADNLVEACRASKQQMSYRNKIEMAVGRDKAGRLALGFRRQDSHELIAVDRCPLA
FT                   TRHLERAPKALRGALRFLAGGNEHTTDDNPLGLYRVGVRSSERTGSTEIALWTKPGVFP
FT                   RAAAARTLSSTLKATSIVRVLAYEGKQRSIKGVEVLAGKGFWQETLARFTYRISAPSFF
FT                   QVNTAQAEQLISLVIEGLDITETSHVADLYSGAGTFTLPLADRAGEVIAVESASSSVRD
FT                   LRRNAETAGVWVDVRGGDSARELAHMGHLDALVVDPPRAGLTEAAIAGIAQAQPARLAY
FT                   VSCEPATWARDVARLADYGYTLTRVTPVDLFPQTYHCELVSIFSR"
FT   gene            707590..707665
FT                   /locus_tag="Ccur_06030"
FT   tRNA            707590..707665
FT                   /locus_tag="Ccur_06030"
FT                   /product="tRNA-Arg"
FT   gene            707726..708259
FT                   /locus_tag="Ccur_06040"
FT   CDS_pept        707726..708259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06040"
FT                   /product="peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94320"
FT                   /db_xref="GOA:C7MN30"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN30"
FT                   /protein_id="ACU94320.1"
FT                   /translation="MALYTPAYKPNGNEVAVIVTSKGTIRVQLAGADAPIHVGNFVELA
FT                   QKGFYNDLKFHRYVPGFVIQGGDPHTRELDSEQVKAAAENPLGGLGTGGPGYCIKEEYT
FT                   TNPHNSHEDGALAMARSQMPDSAGSQFYLCLGAQHFLDPNYTVFGQTIEGLEVIDQLRV
FT                   GDVIESVTIEGAQE"
FT   gene            708356..709726
FT                   /locus_tag="Ccur_06050"
FT   CDS_pept        708356..709726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06050"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="PFAM: Tetratricopeptide repeat; Tetratricopeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94321"
FT                   /db_xref="GOA:C7MN31"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN31"
FT                   /protein_id="ACU94321.1"
FT                   /translation="MNNVLFQQARQAYITKDYVSALEGFTQCLQGAAAGESLAAGELGL
FT                   LYHQIGNCLMKLRDYEEAIHAYTQATSDNAYDGIGAVNCNLGNSYAALHDYENAVKHFE
FT                   IAVSDRKYATPYKAYSGMGKAYLKLGKSAEAGSSFRSAALDEANPNPAQALLNLGICFM
FT                   ALNRPADAQASYESALQFTMPAATKNKLYANLGQAYTSTGQMQKAVNAFEMALADKTYF
FT                   LNDAASVDYQRAVGAVSQGTQVMEPVGGSSAATTGALNDMSGLDVPADGTPVYQETDQA
FT                   AADANPYYYADSYGVEDNYQSGDDRFFNATEEEIEKYSRGVAKQDRKRRNVGLKLLVAF
FT                   IIIIVLALAAGVFAYSRGYGYPTQESVVQKVFTDKSAASSLFASDLSSDKVSSLLDPVI
FT                   EDSSLQVDGIDRSMNSSTVYVTAATQEGGQVQYKVSLVRDGIGWKVSNIELYFPSQN"
FT   gene            709763..710167
FT                   /locus_tag="Ccur_06060"
FT   CDS_pept        709763..710167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06060"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94322"
FT                   /db_xref="GOA:C7MN32"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN32"
FT                   /protein_id="ACU94322.1"
FT                   /translation="MSEQKTYTMIKPDGVRNGHVGEIVNRFERAGLTIERMELGMVTLA
FT                   QAQANYAEHEGKPFYDGLIAYITSGPVVKMVVSGEGAVAKVRTLMGATNPADAAPGTIR
FT                   GDFGLIMDENVIHGSDSPASAEREIGIFFN"
FT   gene            710384..711433
FT                   /locus_tag="Ccur_06070"
FT   CDS_pept        710384..711433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06070"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="PFAM: Cell division protein FtsA; TIGRFAM: cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94323"
FT                   /db_xref="GOA:C7MN33"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN33"
FT                   /protein_id="ACU94323.1"
FT                   /translation="MSFMDWFNSAGSSYDLAIDLGTANTLVAITGEGIVINEPSVVAIE
FT                   KSTHRVLAVGHEAKNMINHTPDAFSAEHPLHDGVIADYDVTEAMLSAFINKAVERKYPW
FT                   QPKPRIVVCIPCGATSVEKRAVFEATIQAGARQAYLIEEPMAAAMGADLPVTEPTGSMV
FT                   VDIGGGTTEVAVISLGGIVTSSSLRLAGNRMDEAIAMYLRDLLGIKIGERTAEVIKIKI
FT                   GSILPFGDGRERDMIISGQDVLTEQPKEVTIQSEDVRAALQSSCDEMVLHIKETFKKTN
FT                   PDLASDIIQNGILLTGGGGLLSGLDQYLAQELEIPVWVSETALTNVVMGCLKVLETPTA
FT                   LKQTLMRSR"
FT   gene            711449..712396
FT                   /locus_tag="Ccur_06080"
FT   CDS_pept        711449..712396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06080"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="PFAM: rod shape-determining protein MreC; TIGRFAM:
FT                   rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94324"
FT                   /db_xref="GOA:C7MN34"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN34"
FT                   /protein_id="ACU94324.1"
FT                   /translation="MAFNFKQGASATRVYVLLVALLVLSLALITIYAREGSSGVLHTAQ
FT                   NALSLAASPLRSASGALSAAEDASAATASDVVADESSLSVLREQNAQLRQNLAELEEYR
FT                   AEAQRLQELLDLKDDNKLDGTAARVLSRSSDAWNNVITIDKGTDAGIHEGLAVMASSGL
FT                   IGQVISTTSLSSQVRLMQDPQFGVAAMVQSSRAEGIVKGALDGLLYLEDIDSDAQVALG
FT                   DTVITSGLGGGFYRGILIGTVVKIDGQQGDANRRIVVEPNASASPLSEVFVVTGMSDTA
FT                   NTTNDTDTGTTARTTNTTNTAQDASSASRSATRN"
FT   gene            712414..712941
FT                   /locus_tag="Ccur_06090"
FT   CDS_pept        712414..712941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06090"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94325"
FT                   /db_xref="GOA:C7MN35"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN35"
FT                   /protein_id="ACU94325.1"
FT                   /translation="MQRETRIAVVGAFVAVILQIVLAPNIAFASIVPNILIVYAIVVAM
FT                   CLPASASLWIAFFMGLASDLFGFGMIGSLSFLLVIATFTASRLYGAIADGRLAAALGTL
FT                   MVFILAVNMLYAAFLIGASSTSILDAFIYRALPCTVYECAIGLVLYPLMSRLLEARTHG
FT                   IGTAAASLKQLR"
FT   gene            712955..715105
FT                   /locus_tag="Ccur_06100"
FT   CDS_pept        712955..715105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06100"
FT                   /product="penicillin-binding protein 2"
FT                   /note="PFAM: Penicillin-binding Protein dimerisation
FT                   domain; Penicillin binding protein transpeptidase domain;
FT                   TIGRFAM: penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94326"
FT                   /db_xref="GOA:C7MN36"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN36"
FT                   /protein_id="ACU94326.1"
FT                   /translation="MLYALIAGLFTIALIVVIVLVVVMRRRRQSSDVVAPTHAWKSVDT
FT                   FGVAPKKEKTGFGVAEHTRLAGQKSASGTAGETLRGRFVAMGIFAGGIFGTLAAKLWSM
FT                   QVLQSESYSEQAARNLYATVYTPAPRGIIYDANGIPLVTNRSSYTVLANADVASNRNTV
FT                   ARLSTLLGIPFQVVRQRILDTSAGVQSSRVVARDASLRNIAFISEHADAFPGVTCEART
FT                   QRAYPYGALAAHVLGYTGTASADDFAQVAAGRSIQSGDIVGKSGVEYSYDEMLSGDHGT
FT                   RTLLTDATGSVRETISSTDPVRGNDVYLTIRGPVQQAADQALREIIAPNGRAGGKTGTA
FT                   GAVVCLDATNGEIIALSNFPTFEPSQFIGGISSDLWDSLNTQESHYPLMDRVVQGTYPA
FT                   ASTFKAFTAMAALTDSVANATSSWTCTGTWTGFGEAYPQKCWLTTGHGTLDLVGGIAHS
FT                   CDTVFYEIAKDFYVRGASIGETAMQDYIKEYGFGSKLGIDLAGEATGRVPTPEWKAEYF
FT                   KDAPEQAQWQGGDMTNMAIGQGYVLVTPLQIAAGYCGIATGQVWRPHVLREVRNSLGET
FT                   VLSYTPEVIFTPDQSEANIALVRRGLREVMTINGYEQSYFSDVNYKVAGKTGTAQVAGK
FT                   QDYSWFACYAPADNPKYVCACLVEEGVKATTSTMPIVARVIKAAMALDAGSIAADSIAS
FT                   VDSSYSASASSSRSTTNSARED"
FT   gene            715114..716328
FT                   /locus_tag="Ccur_06110"
FT   CDS_pept        715114..716328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06110"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="PFAM: Cell cycle protein; TIGRFAM: rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94327"
FT                   /db_xref="GOA:C7MN37"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN37"
FT                   /protein_id="ACU94327.1"
FT                   /translation="MDPLRPMNQISTLRSAGGRLPRSLKPRLFNYLNLPLCAVVFALVA
FT                   YGLLIVYSAVASDTSYSFSRQAAGVAVGAALMLLLFRYDYHHLSHYLVFFLIINVVLIM
FT                   LPHVPIVGQSAKGATSWVAFGPVRFQPGEFAKVTVILLAASVIARFGGKLDNVRDFLKA
FT                   LGIMLVPFVCIMTQPDLGTGLVYLFIAGVALVVGGARPRYIVILVALAVAAVAALFILD
FT                   PIADSLAGHDVLLKDYQRARLMVFLDNSYDPTGDGYNLKQAQIAIGSGGFLGKGYMNAT
FT                   QSALGYLPEAPTDFIFCVLAEQLGFLGAFVLLVLYALLIFICYRIAYRSNDLFGTVLVM
FT                   CVAGMWLFQILENIGMTCGLMPITGIPLPFMSYGSSFMVVNFILLGLIGSVRSHNGREL
FT                   KRGLR"
FT   gene            716325..717740
FT                   /locus_tag="Ccur_06120"
FT   CDS_pept        716325..717740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94328"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN38"
FT                   /protein_id="ACU94328.1"
FT                   /translation="MKLPINIPELLKAAEGINEARALPVRVALFIDPTADEMLVHALRD
FT                   AFVAGDAQAITSVWELSLDEWQNAVGYDLAVLVAGAYESTGEVSCRLRDAGVVTLTVTN
FT                   LPVIAQELAAATASSLLPEDVIGPDPQVDGHNAADSRFNEEPYPMTVDRIRSVIETMGQ
FT                   WIVHTFTDKRLAFARSYPFVRRPFALDCVNTTSIQNAGIGAVVIIPGADMPLMTFNQAK
FT                   MVLRIGAAWGYEMTLARWRELACVVGAGFACRSVARQVAPLVPGAGFALRAGIGAVGTQ
FT                   AIGRAAIAYFEGLSRSADTAEADTTEVNAAKVDTVKTYAIESGAVHVDAVEAGAVHPGA
FT                   VVSNKQSAIQPVLRTFAAYAPVVADGAREVATQALAAGQRAGERAVPFVRNEVAPRARE
FT                   VASYAAPMVKGVAGFAWDAAQPTLRRFAEAATPVVQSTAKRLSPALQEAFPRLSLVVRA
FT                   GLAHERKGKADKE"
FT   gene            717737..719617
FT                   /locus_tag="Ccur_06130"
FT   CDS_pept        717737..719617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06130"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="PFAM: B12 binding domain; Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94329"
FT                   /db_xref="GOA:C7MN39"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN39"
FT                   /protein_id="ACU94329.1"
FT                   /translation="MRDLWPRLSELLPRAQRPVRYINHEFGALHRSPDADPADTSFVIV
FT                   YPDTYELGQANQAIHILVNRVNATPGMFGERAFLPAAEFADEMRSAHLELFSLESCAPL
FT                   RDFDVVGITLPHELAATNVLETLDLAGLPLRAADRAEDDPIVFAGGPCTFNPEPYAPFF
FT                   DAICIGEGEEAVPEMVAAIGAARRAGASRQRILEILADIDGVYIPAFYELLDDEQAARQ
FT                   GARVRPINAHARPVIERRVFEGFASSPAWEPCIVPFADLVHDRLNVEILRGCTRGCRFC
FT                   QAGMMYRPVRERSADNIVSSTLEGLAATGYDEVSLTSLSTTDHSQIREILTRLNSALSG
FT                   TGIRVSIPSQRLDAFGVDMAQMVAGEKRGGLTFAPEAGTQRLRDVINKNVTEDDVISSL
FT                   TAAFKAGWRRCKLYFMLGLPTETDDDVKGIADLVQHAFEAVRAEVPPAERGRIRLSVSC
FT                   ALFVPKAQTPFQWDGQIAPEEALRRVRLLRDSAKYKAIDVHWHDPATSFVEAVMSRGGR
FT                   ECADLIEGAYRRGARFDAWTEHFKPEAWHEAAAEFGLDVDDIAQRSFTLDEILPWQHIS
FT                   SGASLSYLRREYKRALEAQTTPDCSFVGCTGCSLCQSYSIDMDIQGVRCD"
FT   gene            719688..720413
FT                   /locus_tag="Ccur_06140"
FT   CDS_pept        719688..720413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06140"
FT                   /product="uncharacterized conserved protein (DUF2344)"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2344)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94330"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN40"
FT                   /protein_id="ACU94330.1"
FT                   /translation="MGVDTGANTNTCTNAESQLFRLRVRFAQTGRCAMLSHLETARYLE
FT                   RVVRRAALPYAITQGFSPHMRISFGSALPVGVGGTCEIFDVILSQRVDEDIALAKMQQA
FT                   SVPDMAILSCSYIGLREPAASVAYPLSTYRVCASAPIESVAIPDSITVTRKRRERILDP
FT                   ADFLVGSLTISGNTLEFTLESHESGSLRVDMFTNTLAQQASWRPLQIMRIGLAARSQKC
FT                   EQVDDGFTAQPEGDNGDGR"
FT   gene            720403..721323
FT                   /locus_tag="Ccur_06150"
FT   CDS_pept        720403..721323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06150"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="PFAM: UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   C-terminal domain; FAD binding domain; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94331"
FT                   /db_xref="GOA:C7MN41"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN41"
FT                   /protein_id="ACU94331.1"
FT                   /translation="MVDNSLISALCEGLGERAVLLNEPMSKHTTFRIGGPADVLVMPQT
FT                   EEQAAFVVRSCRAASVPLRVIGRGSDLLVADTGLSGVVMKIAGNLADVRVNGSRIEAQA
FT                   GASNARIAEAAAQAALTGYEFAAGIPGTVGGAAIMNAGAYGGEFRDVACRLVCLNAAGE
FT                   VVSLRAYEAQWGYRCSAMDTTNTIVLRVILQLMPGNTQDIRDRMADLSRRRREKQPLEM
FT                   PSAGSTFKRPVGYFAGKLIEDAGLRGFSIGGAQVSQKHTGFVVNADGATASDVRTLIRE
FT                   VQRRVRENSGVDLHPEVRCWGFKDE"
FT   gene            721422..722597
FT                   /locus_tag="Ccur_06160"
FT   CDS_pept        721422..722597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94332"
FT                   /db_xref="GOA:C7MN42"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN42"
FT                   /protein_id="ACU94332.1"
FT                   /translation="MAESIRYAQHSGVVQSTVSAAPAYHQPVVKNSAPHCSFAAGSSAR
FT                   YQSVGGKSASHHQVASGTPTPRRHLLSDISPVQVVATALAALTSMLLSSQIGITGSIIG
FT                   VFVGSVVSTVSAQLYRNMVSISADKMHARTASTAGSQTASQPQASGRVGSGVESNQSTG
FT                   AAARENTFSVQAARASVYRNSPSSAITGQVDRSNISQAYATDARLRARDRRDAKARLSR
FT                   RVIIVSVVSALVAILLSALAVNLVTAGQGLGTKTSIVSSSVQAVDDKPASSASSSTAQT
FT                   ATQNSTVSDSQDDSQATNTTSTDAQDTAQTTTTKTSSVQDTTSTSNTPTTTDSSTSSNK
FT                   SSAANSSSTSNTTGSGSETSSSTGKTAGSSSSSAAADSTSTSASKTTTSES"
FT   gene            complement(722606..723574)
FT                   /locus_tag="Ccur_06170"
FT   CDS_pept        complement(722606..723574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94333"
FT                   /db_xref="GOA:C7MN43"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN43"
FT                   /protein_id="ACU94333.1"
FT                   /translation="MALHAGDQTNHVAGAHTADTADEHTVPSAEQSVDTTDASEIANDT
FT                   DSTPKDDSAIADAPESGRHASCDTGTPVAPTGASIVYPDASGLTRRREIGPDSRIIIGA
FT                   LAASALVIGGIAGYQYYDSIVNLPVHEAQAVKEQLARGTSLQIPTLTSFAGLDVEGITS
FT                   ALDAEGISVIDVNAFTSRSGNTIDLIKLPESMGASDAALAYARGVDSLSASDAVRLLMG
FT                   SWRLTQQNLNTADLRVKYADFTAQTPDAAIDTAIELQGFAADEVSESGVDGKGNTYRSG
FT                   STTVDGQVFGWTISACPLSSAFNITGLPDDAQYVGVRVQKQ"
FT   gene            723706..725418
FT                   /locus_tag="Ccur_06180"
FT   CDS_pept        723706..725418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06180"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /note="PFAM: Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein C-terminal domain; Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM: succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein
FT                   subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94334"
FT                   /db_xref="GOA:C7MN44"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN44"
FT                   /protein_id="ACU94334.1"
FT                   /translation="MNAFDVIIVGAGGAGLYAALSASRQGDLSVAVVSKVFPTRSHTGA
FT                   AQGGMNAALGFQDAVDSPDSHFMDTVKGSDYLGDQDAISFFVEGMPGLVRELESWGVPY
FT                   SRDEKGRIAQRPFGGASHPRCCYAADRTGHAVLHTLFEQCLRAGIQFFTDYCLLDVGAD
FT                   ATHGVHGLVLLNLRTGAIEAFRARTIVMATGGFGCVFWGRTTNATNMTGDGVAACARAG
FT                   AALKDVEMVQFHPTALPSNSTLLSEACRGEGGYLINSTGERFMGHYAPQRLELAPRDMV
FT                   ARAIEMEIRAGRSVDAHGVAAVYLDLRHLGAKRITERLPQVRDLALTFEGVDMINDPVP
FT                   VRPAAHYSMGGIDVINFKTCETAVAGLHAAGECSCISVHGANRLGGNSVSEVCFFGRQA
FT                   GFAAAERAHDRLLGEMDTLKELCETWRGRFYELRQRTDGEDIFSIRRDLAAAMWSGVGI
FT                   FRDEEGLETAAQAVEQCAHRYQRAVLGDKALRFNMALLNYIELGNLIQIAQAQVIAARA
FT                   RKESRGAHARLDYPHRDDERFLKHTILILSDGHWDISWRAVHAERVAPQERTY"
FT   gene            725418..726404
FT                   /locus_tag="Ccur_06190"
FT   CDS_pept        725418..726404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06190"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94335"
FT                   /db_xref="GOA:C7MN45"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN45"
FT                   /protein_id="ACU94335.1"
FT                   /translation="MVYSDRETSLAQENLCIAIARFDGTKSWVQEYSCPRQPMTVLACL
FT                   NFIREHQDQTLVFNEACRHAICGSCAVVVNGSACLACETQVEDLIELYETTRLFLSPLR
FT                   GFPVLRDLAVDFDAKVEQMQTVEPWLHAYTDRTDSCQSREQLDRYEKATECILCGICAS
FT                   SCCEMAFDEGGYLAPFVMNKAFRFERDSRDEHGNGVRLKAVIASDLWKCLHCQQCTTKC
FT                   PKGIPVSEEIATLRRQALSRGFSEGMGPRHARVFYNDAYKWGRLSETELALVTEGPLGV
FT                   LKNRVPFTMRMIARGKMNPLKVHPPCVHGIEGVRTLYRFAQTMDEDT"
FT   gene            726404..727297
FT                   /locus_tag="Ccur_06200"
FT   CDS_pept        726404..727297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06200"
FT                   /product="heterodisulfide reductase, subunit B"
FT                   /note="PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94336"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN46"
FT                   /protein_id="ACU94336.1"
FT                   /translation="MGASSHTTLRYGFFPGCTLESAAGELAIATRKTCARLGIDLVELE
FT                   GWTCCGASQIQDVDANVALMLNARNLALAEAAGFDALLTVCNTCTLMLRQAKQRLDRDA
FT                   ALRAKVNEGLAQIGLTYRGSCRVTHYLWALVQDVGLEYLAHQVKTPLSGLTVAPFYGCH
FT                   ILMPSDAMGMEDARNPHSMEQVVECLGATAVSYPERLSCCGFHAIYPAERQAERSCGAI
FT                   CLGARRAQADCIVTPCPLCHMALDMWQADAQRFYEDNISLPIIHLPQLVGLALGFSARE
FT                   MALNRHIVNATNLFEG"
FT   gene            727608..728444
FT                   /locus_tag="Ccur_06210"
FT   CDS_pept        727608..728444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06210"
FT                   /product="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /note="PFAM: Integral membrane protein TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94337"
FT                   /db_xref="GOA:C7MN47"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN47"
FT                   /protein_id="ACU94337.1"
FT                   /translation="MDLSIFLTPEAWISLAMLVFLEIVLGIDNIAFIAVTTNRLAPDKQ
FT                   HIGRKLGLAGAMFMRCLFLCFASWLIHMAQPLFTIELGPYVHGFSIRDILLAAGGAYLI
FT                   YKGIEEVRSMLALDELRALHGDESEVQAHRIGLGQAVGTIMVMDIVFSIDSVITAVGMA
FT                   EHLIVMIIAVIAAVLLMMVFIDAVSDFINKHPEIKILALVFITAIGVLLFIDGVGFHTG
FT                   IEIAALGLSLEKTLVYFAMIFSLVLELIQMSYNRRADEFLHQRKSSCEAASSQESK"
FT   gene            complement(728577..729497)
FT                   /locus_tag="Ccur_06220"
FT   CDS_pept        complement(728577..729497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06220"
FT                   /product="sphingosine/diacylglycerol kinase-like enzyme"
FT                   /note="PFAM: Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94338"
FT                   /db_xref="GOA:C7MN48"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN48"
FT                   /protein_id="ACU94338.1"
FT                   /translation="MKLLVLNNISSGLPDGGIFDFIRSVATVGDEVVLRSVDASSSFAD
FT                   ALADADTFDVVVASGGDGTVASVCYLTRHTQVAVLPFPSGTANLLAQNVASPIEPHALA
FT                   RLARDGKRLAFDLGELTADEQTFGFSMIAGCGYDAKVMDDARPYKKRLGAVAYFRAAFG
FT                   NPNPQVSHISLTIDNNQVEHDGVGVLLLNFSKIQFDISLGPQNLPNDGALDIIVLTTQN
FT                   AWNLLPAILGAAIDHSGASLTQSDALVYYRGHDIHIVADPPLPVQYDGEAIDVCTPLTA
FT                   RVLPAATTLIISDEGYEEFHRDSDL"
FT   gene            729520..730719
FT                   /locus_tag="Ccur_06230"
FT   CDS_pept        729520..730719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06230"
FT                   /product="ribonuclease D"
FT                   /note="PFAM: HRDC domain; 3'-5' exonuclease; TIGRFAM:
FT                   ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94339"
FT                   /db_xref="GOA:C7MN49"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN49"
FT                   /protein_id="ACU94339.1"
FT                   /translation="MVDTIIKTDLSRLEGFHSVFITDQAELEAFAKRALDSSVLAIDTE
FT                   FLREKTYYARLCLLQMQTDDETIIVDPFAVSDLGVLAPLFQSSSIMKIVHSGRQDLEIL
FT                   NREVGLLPQPLFDTQVAAALLGHTQQIGYGSLVSAVCGVQLAKMDSFTDWSRRPLSASQ
FT                   ISYAADDVIYLPQLYHTMTDELERLGRIHWLDPDFAALIDPALYVDDPRDRYRRLKRVG
FT                   QLSRRQLSAAREVAAWREKRARDRDIPRKWVMTDEQVVEACKREARTIDSLFMVRGLSD
FT                   RLSTGDARTVVRCICRGLDLEPDKWPKSDHVAYGGDVNVDAVLDAMTALVRLRARQNNI
FT                   AFQTLASHSDLVKVAHGHKDAEILRGWRREIVGAELLELLAGRISLSVQEGALKVTKHP
FT                   "
FT   gene            730817..731482
FT                   /locus_tag="Ccur_06240"
FT   CDS_pept        730817..731482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06240"
FT                   /product="predicted Zn-dependent protease"
FT                   /note="PFAM: Putative neutral zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94340"
FT                   /db_xref="GOA:C7MN50"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN50"
FT                   /protein_id="ACU94340.1"
FT                   /translation="MLSYSYLLLIVASTLIGLGAQFYVNNQIKKYSEVPSTTGLSGAEA
FT                   ASRMLASHSISGVPIYQGRESEDHFDPRSNSITLDPHAYGQRSITAIATGCHEAGHACQ
FT                   YAKGYAPMKVRSALVPVVNLASNAWMILLILGFALNLAGLIDLAIILYAFAVLFQLVTL
FT                   PVEFDASRRALDYLKASGLPQGEQAGAFSVLRACALTYVAAALVSAMQLLWLLNQRQN"
FT   gene            731526..732896
FT                   /locus_tag="Ccur_06250"
FT   CDS_pept        731526..732896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06250"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /note="PFAM: OB-fold nucleic acid binding domain;
FT                   Exonuclease VII, large subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94341"
FT                   /db_xref="GOA:C7MN51"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN51"
FT                   /protein_id="ACU94341.1"
FT                   /translation="MSSATESTPLSVSQAMALAKNTLESCTVTLVGEVSEVSVKPGYKA
FT                   AYFTVKDTAASMPCMMWMNRFRSEGIDLRVGQLVQLTGRFTVYAPKGRMNFDVFSLSAA
FT                   GEGDLRQRVADLARRLSAEGLMEASRKRALPGMPRTIGLVTSPHGAAVHDVLRTLRRRW
FT                   PLSNILLAGVMVEGVNAPAEIVEGLRVVVEAGAEVVLLVRGGGSFEDLMPFNDERLART
FT                   IARCPVPVVTGIGHEPDTSIADMVADRRASTPTAAAEACVPDQRELALTLDASADRLQA
FT                   QATVRLADFTRRLDALASRPVLSDPLQAIARFRQPIDLVSGRLTRAIPGALAADSAALA
FT                   AHHMRLRAIGSSLTSMRVENLTSSQSRLSTAGRSLQTRFDEAWQMRAARLGDLSPLSVI
FT                   GRGFALVRDDTGALVHSIDTVSPGTKVSIAVADGTIDAQVTATTHDEKTTVSWEEKK"
FT   gene            732893..733153
FT                   /locus_tag="Ccur_06260"
FT   CDS_pept        732893..733153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06260"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="PFAM: Exonuclease VII small subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94342"
FT                   /db_xref="GOA:C7MN52"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN52"
FT                   /protein_id="ACU94342.1"
FT                   /translation="MTEENRTPVDDLTFRQGMDELDAIVAQLEGNTLELEDSLAAYERG
FT                   VALLRNLRGRLDTAQQKVEVLMGQMEQSATDEEIDTSLHKA"
FT   gene            733220..733606
FT                   /locus_tag="Ccur_06270"
FT   CDS_pept        733220..733606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06270"
FT                   /product="HIT family hydrolase, diadenosine tetraphosphate
FT                   hydrolase"
FT                   /note="PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94343"
FT                   /db_xref="GOA:C7MN53"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN53"
FT                   /protein_id="ACU94343.1"
FT                   /translation="MQKDDCIFCQIAKGEIPAQVVYEDDQVIAFDDLEPLMPVHTLIIP
FT                   KEHYSDVADDVPEDVLGHLFSCVQKVADIKGIHQDGFRCLINTGENASQSVRHLHIHVL
FT                   GGGLMPRPNDQDWGSAASNAETDA"
FT   gene            733722..734966
FT                   /locus_tag="Ccur_06280"
FT   CDS_pept        733722..734966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06280"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="PFAM: Acetokinase family; TIGRFAM: acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94344"
FT                   /db_xref="GOA:C7MN54"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN54"
FT                   /protein_id="ACU94344.1"
FT                   /translation="MNILVVNAGSSSLKYQLINIDTEKVIAKGLCERVGSPDSVHKHGV
FT                   DDNEVVIDRYLPDHDAAVACVMEVLVEGPDAPLSSMSQIDAIGHRIVQGGTYFDKSVLI
FT                   DDEVIDKIRELAELAPLHNFAALQGIEACRHAMPDALQVAVFDTAFFQSLPPKAYMYAL
FT                   PYELYEKYGIRKYGAHGTSHRYVADRAAHLVGERASDLKMITCHLGNGCSISAIDHGVA
FT                   VDTSMGMTPLDGLMMGTRCGSIDPAIVPFLIEHEGISSQAVNDIMNKKSGLLGISGISN
FT                   DLRSVRQAAEHGNKRALLAYDMYSNSVKKFIGQYMAVMAGVDVIALTGGVGENDARMRR
FT                   MIFAGLQPMGIVVDEARNRQMGFERVISSESSRVRIVVVPTNEELMIARDTYAIMHERN
FT                   QIVPYIPAQSVQSNG"
FT   gene            complement(735166..736167)
FT                   /locus_tag="Ccur_06290"
FT   CDS_pept        complement(735166..736167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06290"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: Phosphate acetyl/butaryl transferase; TIGRFAM:
FT                   phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94345"
FT                   /db_xref="GOA:C7MN55"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN55"
FT                   /protein_id="ACU94345.1"
FT                   /translation="MSAFIESMITRAQTSRQTIVLPEGNDQRTLQAAKAVMERGIADVI
FT                   VLGNATEITSTAGDLAGARIVDPATSNAASSYAETFFELRKHKGITLEDAIAQMADPIY
FT                   FGAMMVKQGDADGMVCGACHATADVLRAALQILKTAPGASAVSSFFIMALPDTTYGDDG
FT                   VLMFADCGLTIQPDAAALAQIAVSCSESWHALFESEPRVALLSHSTHTSAVANPDRDKV
FT                   IEATRLAHEMAPNLALDGELQADAALVPAVAATKAADSSVAGSANILVFPDLDSGNIAY
FT                   KLVQRLAHAEAYGPITQGIAAPVNDLSRGASVEDIIGVIAITAVQCQATERV"
FT   gene            736412..737434
FT                   /locus_tag="Ccur_06300"
FT   CDS_pept        736412..737434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06300"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94346"
FT                   /db_xref="GOA:C7MN56"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN56"
FT                   /protein_id="ACU94346.1"
FT                   /translation="MKTISFVVPCYNSAAYMDKCIESLLKCGDDIEVIIVNDGSQKDDT
FT                   SDRAHEWARCYPDIIVAIDQENRGHGGAVNHGLECASGLYFKVVDSDDWLDETAMLRIM
FT                   GYLRRQMELQDPTDLVIGNYVYEKVHEGTSTTINYRNVFPIEREFSWADVGRFKQSQYL
FT                   LMHSVIYRTELLKRIHLKLPEHCFYVDNIFVYIPLPQVKTLYYLDEDMYRYFIGREDQS
FT                   VNESVMLSRIDQQLQITRIMIDGVNISEAPIHPKLARYMENYLSMMMCICSIFLRMEKS
FT                   AANARKLDDIWAYLRNRDEKLYRRVRHSALNWGANLPGEAGRRVGLAGYHIAQRIFKFN
FT                   "
FT   gene            complement(737474..738838)
FT                   /locus_tag="Ccur_06310"
FT   CDS_pept        complement(737474..738838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06310"
FT                   /product="nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /note="PFAM: impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94347"
FT                   /db_xref="GOA:C7MN57"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN57"
FT                   /protein_id="ACU94347.1"
FT                   /translation="MLVRHDTKAQPPTDSAQFNLPDEWVGRAIMLLDLDAFFASVEQLD
FT                   HPAWRGKPVIVGGNPEARGVVSTASYEARTYGVHSAMPSSTAKRLCPNAFWTPGRFSRY
FT                   REISRQVMSIMEDESPALEQVSIDEAFLDITPSRAQTEHPAAIAQRIQQRVCELGITCS
FT                   IGLGRSKAVAKTASEAHKPRGLTIVPPGYEETFLAGLPTKAMSGIGPAAQQALRKFGIT
FT                   TLGQVAQADDVILNHVFGKNASLMRDRCRGCDDSPVMHPAGAKSVSNEMSFAVDLTSRE
FT                   DIEAALSTVAAKVGRRMRMNGLVGSTLSLKLRRGDFSIHSAQCHLDIPCDDEYVITPIL
FT                   FDLLDRVWRPGDSVRLVGCALTHIEEVGAPLQETLFDVADEAKPDDSSTTEPNTQAAQR
FT                   ARMKREDVRAGLKAATDSVRNRFGETALQYGSELRTTRNLTGSSSKNPADYRSTR"
FT   gene            738997..740118
FT                   /locus_tag="Ccur_06320"
FT   CDS_pept        738997..740118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06320"
FT                   /product="PLP-dependent enzyme,
FT                   histidinol-phosphate/aromatic aminotransferase or cobyric
FT                   acid decarboxylase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94348"
FT                   /db_xref="GOA:C7MN58"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN58"
FT                   /protein_id="ACU94348.1"
FT                   /translation="MVGLHRDVDYRQVVTDLPDKPVALPYELRTEMTWIDFSHPVNPLG
FT                   CPRAIVQAMHTALVDGEIAFSPDRDGHALCDAIAGRLGMATDRILTGTSPFELIRAAAQ
FT                   VFMPGMVGIMSPCPPEYALAIENAGHRYVCLSNTRSFATVDAYTARDEAGQLDGAVLAN
FT                   PAYPTSRLLSSATLIHYLETCSWVIVDESNIELSFGGESVLPLVEEYPNLVVIRTPSVT
FT                   YGMPGVPIAYLAAHPRTVRRIRALYDGGSISMFSEVLAKTLVAQGAYIDETHEFLDKEI
FT                   PWMQCMLSLVPGISIYPAEGNFVLCEFSLADGMRLGVSCAEELIIRLQLAGFLVRPLKG
FT                   TPGLASDEFFCVSVKLRNENQRLIDAMRSILNG"
FT   gene            complement(740315..741196)
FT                   /locus_tag="Ccur_06330"
FT   CDS_pept        complement(740315..741196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06330"
FT                   /product="degV family protein"
FT                   /note="PFAM: Uncharacterised protein, DegV family COG1307;
FT                   TIGRFAM: degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94349"
FT                   /db_xref="GOA:C7MN59"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN59"
FT                   /protein_id="ACU94349.1"
FT                   /translation="MSYTILTDSSCNLPESIIDRYEIEVLPLRFESDGEEYASYLKGQV
FT                   TDLSTFYRMMRDGRVFTTSLPALDRAKVIIEGILSAGYDILYIGFSSGLSGTYEAMRQL
FT                   VLDMTAEHPGRQALCCDTRSASLGEGLLVLHAARRKQAGEAMESLHAWLEDARFRLAHW
FT                   FTVDDLMYLYRGGRVSKTSAFAANILSIKPVLHMDDPGHLVPVEKVRSRRRSIEALWRH
FT                   MKKTFDHSLAPQTIAISHGDCLEDAHALIDIIKGDEELAIDDIVLNCIDPVIGAHSGPG
FT                   TLALFYLATTRD"
FT   gene            741421..744267
FT                   /locus_tag="Ccur_06340"
FT   CDS_pept        741421..744267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06340"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="PFAM: Anticodon-binding domain; tRNA synthetases
FT                   class I (I, L, M and V); Zinc finger found in FPG and
FT                   IleRS; TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94350"
FT                   /db_xref="GOA:C7MN60"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN60"
FT                   /protein_id="ACU94350.1"
FT                   /translation="MANTYKQTMNLPQTDFPMRANLAQNEPARLQWWDDIDIYHKVLEK
FT                   NADGEPFVLHDGPPYANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYIPGWDCHGQPIE
FT                   HEVEKKIGTEKMNSLPQDVIRRMCREWADRFVNVQREGFKRLGVNADWDHPYLTFQPDY
FT                   ESANVEVFKRMYLDGAVYRGRKPIHWCSHCHTALAEAEIEYADEVSPSIYVNFKLNNVP
FT                   AIFTRAGVDVERAFVLIWTTTPWTLPANTAVSLGPDIDYCFVEADGIFMLLAHEMVESI
FT                   AEVAGWNNWRVVSAQGEPVLLKGNKFEGITYQTPILHQVEGRIIWGDHVTLEAGTGAVH
FT                   TAPGHGVDDYLVGQQFGVEMIMPVDDDGHLMDYVPHFGGLSTDEANPKIIEWLREKGML
FT                   VASVEITHSYPHCWRCHNPVIFRATDQWFVSMDDTGLRAKALDAIRTKVNWVPTWGANR
FT                   IGSMVEDRPDWCISRQRNWGVPIPVFKCASCGETVATEATFDAVINLFATEGADAWFTK
FT                   DPAEYLPEGTCCPQCGSTELKPEHDILDVWWESGVSNVGVLKHRAAADGLRWPADVYLE
FT                   GSDQHRGWFQSSLLCGIGAFGQAPYKNVICCGFTVDENGEKMSKSKGNGIDPAQVANKY
FT                   GADVLRLWVASTDYSVDVSVGESILARTSDAYRRFRNTFRFLLGSLADFDPETDAVASF
FT                   DSLLPADQWALVRLARLLDDVNAGYDLYQYHRVFRALYDYVVGDLSAVYLDALKDRLYA
FT                   EAPTSPARRSAQTVLMAILDTMVRIMSPILSFTCEEVWQHYPSALREQADRPISVQLAG
FT                   WPSAETFTPALPADAARIDDDFTVILAARETVTKALEDARTQGSIGKSQQAEVVLSVPN
FT                   SALEVLQRYDEELFCELFIVAGVTLEATDSDEMSASIVPTDKEKCPRCWNYRELGVNAS
FT                   HPDVCARCAAVLDDMTSN"
FT   gene            744281..744802
FT                   /locus_tag="Ccur_06350"
FT   CDS_pept        744281..744802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06350"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="PFAM: Signal peptidase (SPase) II; TIGRFAM:
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94351"
FT                   /db_xref="GOA:C7MN61"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN61"
FT                   /protein_id="ACU94351.1"
FT                   /translation="MAAFLKKELPARVTITLFCVLAICWWVFDRVTKAAVDVVSPGMVL
FT                   ARNVLGLFDIQLVHNTGAAWGIFGSSTAALGWFSVVVCLVACVYLLVYARNRSTAFETC
FT                   CIALIVAGGLGNAYDRLTQGYVIDFINCTFIDFPVFNVADIGVTCGVILLFASLLIGRH
FT                   ATPDQREGKC"
FT   gene            744804..745847
FT                   /locus_tag="Ccur_06360"
FT   CDS_pept        744804..745847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccur_06360"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="PFAM: RNA pseudouridylate synthase; S4 domain;
FT                   TIGRFAM: pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccur_06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU94352"
FT                   /db_xref="GOA:C7MN62"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7MN62"
FT                   /protein_id="ACU94352.1"
FT                   /translation="MASQFSLIVTQADAGMRLDSLLAVSGAYPSRSAAVKQIEAGKVLV
FT                   NGLARSKRSIVAPGDTIVYEEIPLATHIPLRGEPIPLDVRFEDRWMMAISKQAGLCVHP
FT                   APGHEGGTLVNALIYAYGRDSLAHVQGDDRPGIVHRLDMDTSGLMMCAKDDTCGMALQD
FT                   LVRDHKVDRRYLTLVHGNI