(data stored in ACNUC7421 zone)

EMBL: CP001683

ID   CP001683; SV 1; circular; genomic DNA; STD; PRO; 4308349 BP.
XX
AC   CP001683; ABUM01000000-ABUM01000045;
XX
PR   Project:PRJNA20835;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Saccharomonospora viridis DSM 43017, complete genome.
XX
KW   .
XX
OS   Saccharomonospora viridis DSM 43017
OC   Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae;
OC   Saccharomonospora.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4308349
RX   PUBMED; 21304650.
RA   Pati A., Sikorski J., Nolan M., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Lucas S., Chen F., Tice H., Pitluck S., Cheng J.F.,
RA   Chertkov O., Brettin T., Han C., Detter J.C., Kuske C., Bruce D.,
RA   Goodwin L., Chain P., D'haeseleer P., Chen A., Palaniappan K., Ivanova N.,
RA   Mavromatis K., Mikhailova N., Rohde M., Tindall B.J., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Saccharomonospora viridis type strain (P101)";
RL   Stand Genomic Sci 1(2):141-149(2009).
XX
RN   [2]
RP   1-4308349
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Saccharomonospora viridis DSM 43017";
RL   Unpublished.
XX
RN   [3]
RP   1-4308349
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; cb683719a64f21568122554d257cc5f3.
DR   BioSample; SAMN02598440.
DR   CABRI; DSM 43017.
DR   EnsemblGenomes-Gn; EBG00001047990.
DR   EnsemblGenomes-Gn; EBG00001047991.
DR   EnsemblGenomes-Gn; EBG00001047992.
DR   EnsemblGenomes-Gn; EBG00001047993.
DR   EnsemblGenomes-Gn; EBG00001047994.
DR   EnsemblGenomes-Gn; EBG00001047995.
DR   EnsemblGenomes-Gn; EBG00001047996.
DR   EnsemblGenomes-Gn; EBG00001047997.
DR   EnsemblGenomes-Gn; EBG00001047998.
DR   EnsemblGenomes-Gn; EBG00001047999.
DR   EnsemblGenomes-Gn; EBG00001048000.
DR   EnsemblGenomes-Gn; EBG00001048001.
DR   EnsemblGenomes-Gn; EBG00001048002.
DR   EnsemblGenomes-Gn; EBG00001048003.
DR   EnsemblGenomes-Gn; EBG00001048004.
DR   EnsemblGenomes-Gn; EBG00001048005.
DR   EnsemblGenomes-Gn; EBG00001048006.
DR   EnsemblGenomes-Gn; EBG00001048007.
DR   EnsemblGenomes-Gn; EBG00001048008.
DR   EnsemblGenomes-Gn; EBG00001048009.
DR   EnsemblGenomes-Gn; EBG00001048010.
DR   EnsemblGenomes-Gn; EBG00001048011.
DR   EnsemblGenomes-Gn; EBG00001048012.
DR   EnsemblGenomes-Gn; EBG00001048013.
DR   EnsemblGenomes-Gn; EBG00001048014.
DR   EnsemblGenomes-Gn; EBG00001048015.
DR   EnsemblGenomes-Gn; EBG00001048016.
DR   EnsemblGenomes-Gn; EBG00001048017.
DR   EnsemblGenomes-Gn; EBG00001048018.
DR   EnsemblGenomes-Gn; EBG00001048019.
DR   EnsemblGenomes-Gn; EBG00001048020.
DR   EnsemblGenomes-Gn; EBG00001048021.
DR   EnsemblGenomes-Gn; EBG00001048022.
DR   EnsemblGenomes-Gn; EBG00001048023.
DR   EnsemblGenomes-Gn; EBG00001048024.
DR   EnsemblGenomes-Gn; EBG00001048025.
DR   EnsemblGenomes-Gn; EBG00001048026.
DR   EnsemblGenomes-Gn; EBG00001048027.
DR   EnsemblGenomes-Gn; EBG00001048028.
DR   EnsemblGenomes-Gn; EBG00001048029.
DR   EnsemblGenomes-Gn; EBG00001048030.
DR   EnsemblGenomes-Gn; EBG00001048031.
DR   EnsemblGenomes-Gn; EBG00001048032.
DR   EnsemblGenomes-Gn; EBG00001048033.
DR   EnsemblGenomes-Gn; EBG00001048034.
DR   EnsemblGenomes-Gn; EBG00001048035.
DR   EnsemblGenomes-Gn; EBG00001048036.
DR   EnsemblGenomes-Gn; EBG00001048037.
DR   EnsemblGenomes-Gn; EBG00001048038.
DR   EnsemblGenomes-Gn; EBG00001048039.
DR   EnsemblGenomes-Gn; EBG00001048040.
DR   EnsemblGenomes-Gn; EBG00001048041.
DR   EnsemblGenomes-Gn; EBG00001048042.
DR   EnsemblGenomes-Gn; EBG00001048043.
DR   EnsemblGenomes-Gn; EBG00001048044.
DR   EnsemblGenomes-Gn; EBG00001048045.
DR   EnsemblGenomes-Gn; EBG00001048046.
DR   EnsemblGenomes-Gn; EBG00001048047.
DR   EnsemblGenomes-Gn; EBG00001048048.
DR   EnsemblGenomes-Gn; EBG00001048049.
DR   EnsemblGenomes-Gn; EBG00001048050.
DR   EnsemblGenomes-Gn; EBG00001048051.
DR   EnsemblGenomes-Gn; EBG00001048052.
DR   EnsemblGenomes-Gn; EBG00001048053.
DR   EnsemblGenomes-Gn; Svir_00090.
DR   EnsemblGenomes-Gn; Svir_00140.
DR   EnsemblGenomes-Gn; Svir_00430.
DR   EnsemblGenomes-Gn; Svir_00820.
DR   EnsemblGenomes-Gn; Svir_01650.
DR   EnsemblGenomes-Gn; Svir_01890.
DR   EnsemblGenomes-Gn; Svir_01900.
DR   EnsemblGenomes-Gn; Svir_03440.
DR   EnsemblGenomes-Gn; Svir_03510.
DR   EnsemblGenomes-Gn; Svir_03520.
DR   EnsemblGenomes-Gn; Svir_03610.
DR   EnsemblGenomes-Gn; Svir_05560.
DR   EnsemblGenomes-Gn; Svir_05570.
DR   EnsemblGenomes-Gn; Svir_05580.
DR   EnsemblGenomes-Gn; Svir_07210.
DR   EnsemblGenomes-Gn; Svir_07440.
DR   EnsemblGenomes-Gn; Svir_07450.
DR   EnsemblGenomes-Gn; Svir_07460.
DR   EnsemblGenomes-Gn; Svir_07670.
DR   EnsemblGenomes-Gn; Svir_07860.
DR   EnsemblGenomes-Gn; Svir_09030.
DR   EnsemblGenomes-Gn; Svir_09040.
DR   EnsemblGenomes-Gn; Svir_10340.
DR   EnsemblGenomes-Gn; Svir_11730.
DR   EnsemblGenomes-Gn; Svir_11940.
DR   EnsemblGenomes-Gn; Svir_11950.
DR   EnsemblGenomes-Gn; Svir_13840.
DR   EnsemblGenomes-Gn; Svir_13990.
DR   EnsemblGenomes-Gn; Svir_14860.
DR   EnsemblGenomes-Gn; Svir_14870.
DR   EnsemblGenomes-Gn; Svir_14880.
DR   EnsemblGenomes-Gn; Svir_14900.
DR   EnsemblGenomes-Gn; Svir_16920.
DR   EnsemblGenomes-Gn; Svir_17070.
DR   EnsemblGenomes-Gn; Svir_23920.
DR   EnsemblGenomes-Gn; Svir_25510.
DR   EnsemblGenomes-Gn; Svir_25520.
DR   EnsemblGenomes-Gn; Svir_25530.
DR   EnsemblGenomes-Gn; Svir_26000.
DR   EnsemblGenomes-Gn; Svir_28660.
DR   EnsemblGenomes-Gn; Svir_28780.
DR   EnsemblGenomes-Gn; Svir_28960.
DR   EnsemblGenomes-Gn; Svir_30020.
DR   EnsemblGenomes-Gn; Svir_32170.
DR   EnsemblGenomes-Gn; Svir_32340.
DR   EnsemblGenomes-Gn; Svir_32630.
DR   EnsemblGenomes-Gn; Svir_32790.
DR   EnsemblGenomes-Gn; Svir_35030.
DR   EnsemblGenomes-Gn; Svir_35760.
DR   EnsemblGenomes-Gn; Svir_36270.
DR   EnsemblGenomes-Gn; Svir_36630.
DR   EnsemblGenomes-Gn; Svir_36730.
DR   EnsemblGenomes-Gn; Svir_36870.
DR   EnsemblGenomes-Gn; Svir_37110.
DR   EnsemblGenomes-Gn; Svir_37120.
DR   EnsemblGenomes-Gn; Svir_37130.
DR   EnsemblGenomes-Gn; Svir_37540.
DR   EnsemblGenomes-Gn; Svir_38700.
DR   EnsemblGenomes-Tr; EBT00001651020.
DR   EnsemblGenomes-Tr; EBT00001651021.
DR   EnsemblGenomes-Tr; EBT00001651022.
DR   EnsemblGenomes-Tr; EBT00001651023.
DR   EnsemblGenomes-Tr; EBT00001651024.
DR   EnsemblGenomes-Tr; EBT00001651025.
DR   EnsemblGenomes-Tr; EBT00001651026.
DR   EnsemblGenomes-Tr; EBT00001651027.
DR   EnsemblGenomes-Tr; EBT00001651028.
DR   EnsemblGenomes-Tr; EBT00001651029.
DR   EnsemblGenomes-Tr; EBT00001651030.
DR   EnsemblGenomes-Tr; EBT00001651031.
DR   EnsemblGenomes-Tr; EBT00001651032.
DR   EnsemblGenomes-Tr; EBT00001651033.
DR   EnsemblGenomes-Tr; EBT00001651034.
DR   EnsemblGenomes-Tr; EBT00001651035.
DR   EnsemblGenomes-Tr; EBT00001651036.
DR   EnsemblGenomes-Tr; EBT00001651037.
DR   EnsemblGenomes-Tr; EBT00001651038.
DR   EnsemblGenomes-Tr; EBT00001651039.
DR   EnsemblGenomes-Tr; EBT00001651040.
DR   EnsemblGenomes-Tr; EBT00001651041.
DR   EnsemblGenomes-Tr; EBT00001651042.
DR   EnsemblGenomes-Tr; EBT00001651043.
DR   EnsemblGenomes-Tr; EBT00001651044.
DR   EnsemblGenomes-Tr; EBT00001651045.
DR   EnsemblGenomes-Tr; EBT00001651046.
DR   EnsemblGenomes-Tr; EBT00001651047.
DR   EnsemblGenomes-Tr; EBT00001651048.
DR   EnsemblGenomes-Tr; EBT00001651049.
DR   EnsemblGenomes-Tr; EBT00001651050.
DR   EnsemblGenomes-Tr; EBT00001651051.
DR   EnsemblGenomes-Tr; EBT00001651052.
DR   EnsemblGenomes-Tr; EBT00001651053.
DR   EnsemblGenomes-Tr; EBT00001651054.
DR   EnsemblGenomes-Tr; EBT00001651055.
DR   EnsemblGenomes-Tr; EBT00001651056.
DR   EnsemblGenomes-Tr; EBT00001651057.
DR   EnsemblGenomes-Tr; EBT00001651058.
DR   EnsemblGenomes-Tr; EBT00001651059.
DR   EnsemblGenomes-Tr; EBT00001651060.
DR   EnsemblGenomes-Tr; EBT00001651061.
DR   EnsemblGenomes-Tr; EBT00001651062.
DR   EnsemblGenomes-Tr; EBT00001651063.
DR   EnsemblGenomes-Tr; EBT00001651064.
DR   EnsemblGenomes-Tr; EBT00001651065.
DR   EnsemblGenomes-Tr; EBT00001651066.
DR   EnsemblGenomes-Tr; EBT00001651067.
DR   EnsemblGenomes-Tr; EBT00001651068.
DR   EnsemblGenomes-Tr; EBT00001651069.
DR   EnsemblGenomes-Tr; EBT00001651070.
DR   EnsemblGenomes-Tr; EBT00001651071.
DR   EnsemblGenomes-Tr; EBT00001651072.
DR   EnsemblGenomes-Tr; EBT00001651073.
DR   EnsemblGenomes-Tr; EBT00001651074.
DR   EnsemblGenomes-Tr; EBT00001651075.
DR   EnsemblGenomes-Tr; EBT00001651076.
DR   EnsemblGenomes-Tr; EBT00001651077.
DR   EnsemblGenomes-Tr; EBT00001651078.
DR   EnsemblGenomes-Tr; EBT00001651079.
DR   EnsemblGenomes-Tr; EBT00001651080.
DR   EnsemblGenomes-Tr; EBT00001651081.
DR   EnsemblGenomes-Tr; EBT00001651082.
DR   EnsemblGenomes-Tr; EBT00001651083.
DR   EnsemblGenomes-Tr; Svir_00090-1.
DR   EnsemblGenomes-Tr; Svir_00140-1.
DR   EnsemblGenomes-Tr; Svir_00430-1.
DR   EnsemblGenomes-Tr; Svir_00820-1.
DR   EnsemblGenomes-Tr; Svir_01650-1.
DR   EnsemblGenomes-Tr; Svir_01890-1.
DR   EnsemblGenomes-Tr; Svir_01900-1.
DR   EnsemblGenomes-Tr; Svir_03440-1.
DR   EnsemblGenomes-Tr; Svir_03510-1.
DR   EnsemblGenomes-Tr; Svir_03520-1.
DR   EnsemblGenomes-Tr; Svir_03610-1.
DR   EnsemblGenomes-Tr; Svir_05560-1.
DR   EnsemblGenomes-Tr; Svir_05570-1.
DR   EnsemblGenomes-Tr; Svir_05580-1.
DR   EnsemblGenomes-Tr; Svir_07210-1.
DR   EnsemblGenomes-Tr; Svir_07440-1.
DR   EnsemblGenomes-Tr; Svir_07450-1.
DR   EnsemblGenomes-Tr; Svir_07460-1.
DR   EnsemblGenomes-Tr; Svir_07670-1.
DR   EnsemblGenomes-Tr; Svir_07860-1.
DR   EnsemblGenomes-Tr; Svir_09030-1.
DR   EnsemblGenomes-Tr; Svir_09040-1.
DR   EnsemblGenomes-Tr; Svir_10340-1.
DR   EnsemblGenomes-Tr; Svir_11730-1.
DR   EnsemblGenomes-Tr; Svir_11940-1.
DR   EnsemblGenomes-Tr; Svir_11950-1.
DR   EnsemblGenomes-Tr; Svir_13840-1.
DR   EnsemblGenomes-Tr; Svir_13990-1.
DR   EnsemblGenomes-Tr; Svir_14860-1.
DR   EnsemblGenomes-Tr; Svir_14870-1.
DR   EnsemblGenomes-Tr; Svir_14880-1.
DR   EnsemblGenomes-Tr; Svir_14900-1.
DR   EnsemblGenomes-Tr; Svir_16920-1.
DR   EnsemblGenomes-Tr; Svir_17070-1.
DR   EnsemblGenomes-Tr; Svir_23920-1.
DR   EnsemblGenomes-Tr; Svir_25510-1.
DR   EnsemblGenomes-Tr; Svir_25520-1.
DR   EnsemblGenomes-Tr; Svir_25530-1.
DR   EnsemblGenomes-Tr; Svir_26000-1.
DR   EnsemblGenomes-Tr; Svir_28660-1.
DR   EnsemblGenomes-Tr; Svir_28780-1.
DR   EnsemblGenomes-Tr; Svir_28960-1.
DR   EnsemblGenomes-Tr; Svir_30020-1.
DR   EnsemblGenomes-Tr; Svir_32170-1.
DR   EnsemblGenomes-Tr; Svir_32340-1.
DR   EnsemblGenomes-Tr; Svir_32630-1.
DR   EnsemblGenomes-Tr; Svir_32790-1.
DR   EnsemblGenomes-Tr; Svir_35030-1.
DR   EnsemblGenomes-Tr; Svir_35760-1.
DR   EnsemblGenomes-Tr; Svir_36270-1.
DR   EnsemblGenomes-Tr; Svir_36630-1.
DR   EnsemblGenomes-Tr; Svir_36730-1.
DR   EnsemblGenomes-Tr; Svir_36870-1.
DR   EnsemblGenomes-Tr; Svir_37110-1.
DR   EnsemblGenomes-Tr; Svir_37120-1.
DR   EnsemblGenomes-Tr; Svir_37130-1.
DR   EnsemblGenomes-Tr; Svir_37540-1.
DR   EnsemblGenomes-Tr; Svir_38700-1.
DR   EuropePMC; PMC5640789; 29062941.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001683.
DR   SILVA-SSU; CP001683.
DR   StrainInfo; 98375; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082765
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Saccharomonospora viridis P101, DSM 43017
CC   Culture Collection ID :: DSM 43017, ATCC 15386, CBS 484.63, JCM
CC                            3036
CC   GOLD Stamp ID         :: Gi02228
CC   Funding Program       :: DOE-GEBA 2007
CC   Sequencing Depth      :: 12.9x Sanger
CC   Gene Calling Method   :: Genemark 4.6b
CC   Isolation Site        :: Irish peat-bog at 250 cm depth
CC   Collection Date       :: before 1963
CC   Depth                 :: 250 cm
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Spore-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 55C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Hypersensitivity pneumonitis
CC   Phenotypes            :: Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4308349
FT                   /organism="Saccharomonospora viridis DSM 43017"
FT                   /strain="DSM 43017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Saccharomonospora viridis DSM 43017"
FT                   /db_xref="taxon:471857"
FT                   /culture_collection="DSM:43017"
FT   gene            99..1892
FT                   /locus_tag="Svir_00010"
FT   CDS_pept        99..1892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="PFAM: Bacterial dnaA protein; Bacterial dnaA protein
FT                   helix-turn-helix domain; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95095"
FT                   /db_xref="GOA:C7MRN3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN3"
FT                   /protein_id="ACU95095.1"
FT                   /translation="MSEHQLNLAVVWEQVVAELSEGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERALREPITSALSRHLGREVSLAVKVDSTESTPPPPPSPLPTGPGS
FT                   PGDAAMPPSATTLHSPPSPSTPPTHARYGPPLGGHPERPPVPSNDDTIIIPAVRPPRAD
FT                   HTEARIPGAHRSPSSAMPSTHPPSRPAGPPQPPSNLPSRPKPSAEGEDGDDEVDEEGEA
FT                   LAAVHEIWPTFSGQPIAGQPYTAPAQPQTSKTRLNEKYTFDTFVIGASNRFAHAAAVAV
FT                   AEAPSRAYNPLFVWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEFTNDFINSLRD
FT                   DRKVAFQRRYRDIDILLVDDIQFLEGKEGTQEEFFHTFNTLHNANKQIVVSSDRPPKRL
FT                   ETLEERLRTRFEWGLITDIQPPELETRIAILRKKAAQDRLAVPGEVLEFIAARVEANIR
FT                   ELEGALIRVTAFASLNQQPVDVGLAEVVLRDLMPTDSQAPEISASMIMNVTAEFFDVTV
FT                   EDLCGPGKTKALATARQIAMYLCRELTDMSLPRIGQTFGGRDHTTVMHADKKIRKEMAE
FT                   RRRIYDQVQELTSRIKQYARQ"
FT   gene            2762..3901
FT                   /locus_tag="Svir_00020"
FT   CDS_pept        2762..3901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="PFAM: DNA polymerase III beta subunit, N-terminal
FT                   domain; DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, central domain; TIGRFAM:
FT                   DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95096"
FT                   /db_xref="GOA:C7MRN4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN4"
FT                   /protein_id="ACU95096.1"
FT                   /translation="MKIRVERDGLAEAVAWVARSLPSRPPVPVLGGVLLDAGGDSGDGA
FT                   DTLTISGFDYEVSATAGVPSTIAEGGRTLVSGRLLADITKALPAQPVDISVEGARVSIT
FT                   CGNAKFSLPTMPVEDYPELPAQPELAGEVAGDAFAQAVAQVAVAAGKDDTLPMLTGMRV
FT                   EITGSTLTLVATDRFRLAMREFSWQPAEGITDSAVLVPARTLADAAKSLGSAGTTVQIG
FT                   LAGGDGLLGLSGGGKFTTTRLIDAEFPPYRQLLPSDYSSRAILHVPALTEAIKRVSLVA
FT                   ERGTQVRLEFEDGSLRLAAGGDDEGSAEEELPVDYEGEPVTIAFNPSYLADGLGALHAE
FT                   RAELTFTTPNRPALIKPADDNGEVVPGYLYLLMPVRLPG"
FT   gene            3934..4827
FT                   /locus_tag="Svir_00030"
FT   CDS_pept        3934..4827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00030"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, C-terminal
FT                   domain; NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95097"
FT                   /db_xref="GOA:C7MRN5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN5"
FT                   /protein_id="ACU95097.1"
FT                   /translation="MAQLGLIGLGKMGFNMRERLREAGHRVVGYDRNAEVSDVASLADL
FT                   VAALEAPRVVWVMVPAGAATRQTITELAELLDEGDLVIEGGNSRYTEDAEHAELLGRRG
FT                   IGYLDVGVSGGVWGKENGYGLMVGGSTADVERAMPFFDALRPEGPREESFVHAGGVGAG
FT                   HYAKMVHNGIEYGLMQAYAEGFELLEASGVVQDVPGVLKAWQRGTVVRSWLLELLVEAL
FT                   ENDPELAELEAYVEDSGEGRWTLEEAIDNAVPAPVISAALFARFASRQENSPAMRAVAA
FT                   LRKQFGGHTVKTKVTD"
FT   gene            4827..5999
FT                   /locus_tag="Svir_00040"
FT   CDS_pept        4827..5999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95098"
FT                   /db_xref="GOA:C7MRN6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN6"
FT                   /protein_id="ACU95098.1"
FT                   /translation="MYLRHLQVTDFRSWEHVDLPLAQGPTVLVGPNGQGKTNLLEAIGY
FT                   ISTLSSHRVATDAPLVRHGCDRALVRAAVVNEGRELTVELEIAPGRANRARINRGAVGK
FT                   PRDVLGILRTVLFSPEDLALVRGDPSERRRFLDDLLVQRAPRYAGVRSEYDRVLRQRNA
FT                   LLKSVGRAGGRRGAREETDPYALSTLQVWDNHLASAGAELLAARLNLVAELGPYVASSY
FT                   ADVAPDSRPARIAYRSSLGGALPEGWGTPDGPEASTEQLGEILLRVLGEVRETELERGV
FT                   SLIGPHRDDLELMLGEAPAKGYASHGESWSFALALRLASYRLLRNESGGEPVLLLDDVF
FT                   AELDSRRRARLAEVATKAEQVLVTAAVDEDVPVEFAGVRYAVSNGEVTRA"
FT   gene            6142..6795
FT                   /locus_tag="Svir_00050"
FT   CDS_pept        6142..6795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00050"
FT                   /product="predicted RNA-binding protein containing Zn
FT                   ribbon"
FT                   /note="PFAM: Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95099"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN7"
FT                   /protein_id="ACU95099.1"
FT                   /translation="MENSPRVGVAAFKIPNSGTERNSATGSKEPGAASTATGASTSRPQ
FT                   GRDLAKAALQAAKERAGTRGTRPGARRPGTPRTGGLEHSGQNPRRRRWSGPGFDERDPQ
FT                   PFGRLLSNMATQLGWSARLANGRVFGQWSTLVGAEIAEHAQPMSLNNGELTVRASSTAW
FT                   ATQLRLLQRQLLARIAAGVGHGVVTRMRIQGPTAPSWRKGPKHIPGRGPRDTYG"
FT   gene            7083..9047
FT                   /locus_tag="Svir_00060"
FT   CDS_pept        7083..9047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00060"
FT                   /product="DNA gyrase subunit B"
FT                   /note="PFAM: DNA gyrase B; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; Toprim domain; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95100"
FT                   /db_xref="GOA:C7MRN8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN8"
FT                   /protein_id="ACU95100.1"
FT                   /translation="MAAKNSEYSASSITVLEGLEAVRKRPGMYIGSTGVRGLHHLIQEV
FT                   VDNSVDEAMAGYASRVEVTLLADGGVRVVDDGRGIPVEPHPVHGKPTVEIVLTQLHAGG
FT                   KFDSDSYAVSGGLHGVGVSVVNALSSALEVEIHRDGRIWAQRYENSVPGELVDKGPTDR
FT                   SGTSVTFWADPEIFETTEYNAETVARRLQEMAFLNKGLTMILRDERVTDEEGEDATGER
FT                   AQLKERTYYYPGGLEDFVKYINASREAIHPSVISFEQKGDGLEVEVAMQWNDGYTPSVY
FT                   TFANTINTHEGGTHEEGFRAALTRVVNAYARDKKLLKEKDANLTGDDVREGLAAIVSIK
FT                   LTEPQFEGQTKTKLGNSEARSFVQTACNEWLADWFERNPTEAKLIINKAVSSAQARLAA
FT                   RKARDLVRRKGAMDIGGLPGKLKDCRSNDPEECELYIVEGDSAGGSAKEGRDSRFQAIL
FT                   PIRGKIINVEKARIDKVLKNQEVQSLITALGTGIHDDFDISKLRYHKIVIMADADVDGQ
FT                   HIRTLLLTLLFRFMRPLVEQGHVYLAQPPLYKIKWPRMEPQYAYSDRERDGLLRAGAEA
FT                   GRKLPKDDGIQRYKGLGEMNAEELWETTMDPSNRVLLQVTLDDAAQADELFSVLMGEDV
FT                   EARRSFITRNAKGVQFLDV"
FT   gene            9100..11625
FT                   /locus_tag="Svir_00070"
FT   CDS_pept        9100..11625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00070"
FT                   /product="DNA gyrase subunit A"
FT                   /note="PFAM: DNA gyrase C-terminal domain, beta-propeller;
FT                   DNA gyrase/topoisomerase IV, subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95101"
FT                   /db_xref="GOA:C7MRN9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRN9"
FT                   /protein_id="ACU95101.1"
FT                   /translation="MTETLPPNSRGRVEPVDIQQEMQNSYINYAMSVIVSRALPDVRDG
FT                   LKPVHRRVLYSMYDSGFRPDRGYNKCSRVVGDVMGNYHPHGDSAIYDALVRLAQRWSMR
FT                   YPLIDGQGNFGSPGNDPAAAMRYTEARLDPLAMEMLRDIEEDTVDFSDNYDGRTQEPDV
FT                   LPSRIPNLLVNGGSGIAVGMATNIPPHNLREVVDGVIWALDNPDADEEETLAALMQRIK
FT                   GPDFPTSGQILGTQGIADAYRTGRGSIRMRAVVEVEEDAKGRTTLVVTELPYQVNPDNL
FT                   VENIASLARDGKIAGIADIADESNSRGGMRIVITLKRDAVAKVVLNNLYKHTQLQYNFG
FT                   VNMLALVDGVPRTLRLDQMVRHYVNHQIDVIVRRTRYRLRKAEERAHVLRGLAKALDHL
FT                   DAVIELIRRSPNADEARTGLMELLDIDEVQATAILDMQLRKLAALERQRILDELAELEA
FT                   KIADLQDVLDKPERQREIVRTELLEITEKYGDDRRTKIIPYEGDVSIEDLIAEEDVVVT
FT                   ITRTGYAKRTKTDLYRSQKRGGKGVQGATLKQDDIVEHFFVCSTHDWVLFFTNKGRVYR
FT                   AKAYDLPEANRNARGQHVANLLAFQPDERIASVIQIPNYEVAPYLILGTKKGLVKKSRL
FT                   ADFDSPRSGGLIGINLREGDELVGAVLASAEDDLLLVSSDGQSIRFHANDEVLRPMGRA
FT                   TSGVLGMRFNEGAELLSINVIKPGTFLLVATEGGYAKRTAVEDYPVQGRGGKGVLTIQH
FT                   DEKRGRLVAALIVDADDELYAITSSGGVIRTPAAEVRRASRQTKGVRLINLGEGNTLLA
FT                   VARNADRPSDVSAEEAESTGEAVPEPEQQ"
FT   gene            11657..12403
FT                   /locus_tag="Svir_00080"
FT   CDS_pept        11657..12403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95102"
FT                   /db_xref="GOA:C7MRP0"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP0"
FT                   /protein_id="ACU95102.1"
FT                   /translation="MTPPDNTEQREPGGTDTTTGEVPPWQRVAKDGSAGTSDGDEGATQ
FT                   WLTSPVSAGASTVPPAPGAGGGGAQPPQQPGGEGSAFGQGAVANRLFGQGEQSATRTAQ
FT                   PQGSDAGKSGSGTQSLSAFRRPGRGPRRANLQVRRVDPWSVLKLSLVLGVALFFIWLVA
FT                   VGVLYTVLDGMGVWDSINGTYDSLVANDAVDGDVLITAGTVFGAAAIVGAVNIVLISAL
FT                   ATVGAFIYNVSAGLSGGLELTLSERE"
FT   gene            12456..12529
FT                   /locus_tag="Svir_00090"
FT   tRNA            12456..12529
FT                   /locus_tag="Svir_00090"
FT                   /product="tRNA-Ile"
FT   gene            complement(12785..13552)
FT                   /locus_tag="Svir_00100"
FT   CDS_pept        complement(12785..13552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00100"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95103"
FT                   /db_xref="GOA:C7MRP1"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP1"
FT                   /protein_id="ACU95103.1"
FT                   /translation="MTDRGFLAYVSSRLAELPGVEAVSLGGSRAVGNHRPDSDWDFAIY
FT                   YRGEFSPDHLRAIGWPGEVSEIGAWSPGVFNGGAWLRIDDRPVDVHYRDLDSVEHELSE
FT                   ARQGRFRYEPLMFHLAGIPTYLVVAELTLNRVLHGTLPKPDYPEALRQNAPDAWWNMAE
FT                   LTFTYAKANHAPYGRLAQCLALTVQGASQAAHAVLAARGEWITNEKTLLSRAGLTEVND
FT                   IVARADNDSLGDTVAAVRDLCARTLDAARTASA"
FT   gene            13643..14086
FT                   /locus_tag="Svir_00110"
FT   CDS_pept        13643..14086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95104"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP2"
FT                   /protein_id="ACU95104.1"
FT                   /translation="MGAARPDFLLQAFVDAANQMEDFSMGVTLSVAGGIISGDLVTAPR
FT                   WMDEVATLVEMEGSEAAYHVANVYREQAGLYKKRAAQNRGEVHGEVTYIHLRDAQWLLD
FT                   GHRLGPTPGMHWRGLLTEVSGWALGRLPLPAMHFHPVTEHAAR"
FT   gene            complement(14146..14379)
FT                   /locus_tag="Svir_00120"
FT   CDS_pept        complement(14146..14379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95105"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP3"
FT                   /protein_id="ACU95105.1"
FT                   /translation="MADGDKDQEGVKGTVEDIKGRVKESTGTLLGNDDMEREGGAQREK
FT                   GRAQQEAAGKQEEAEQARRKAGEAESRERSQQ"
FT   gene            14488..14715
FT                   /locus_tag="Svir_00130"
FT   CDS_pept        14488..14715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95106"
FT                   /db_xref="GOA:C7MRP4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP4"
FT                   /protein_id="ACU95106.1"
FT                   /translation="MHGQQVVEEGFTVKKLLAFAVIAGGVFFLIKRNRDAKAEADLWRE
FT                   ATAPTERPTNGASPNGSAPAKAGSNAASKN"
FT   gene            14750..14825
FT                   /locus_tag="Svir_00140"
FT   tRNA            14750..14825
FT                   /locus_tag="Svir_00140"
FT                   /product="tRNA-Ala"
FT   gene            complement(14833..15338)
FT                   /pseudo
FT                   /locus_tag="Svir_00150"
FT   gene            complement(15338..15769)
FT                   /locus_tag="Svir_00160"
FT   CDS_pept        complement(15338..15769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00160"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95107"
FT                   /db_xref="GOA:C7MRP5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP5"
FT                   /protein_id="ACU95107.1"
FT                   /translation="MSAATTEIIARAVIRRDGQLLLVRQRTKSWSFLPGGHVEPGERVE
FT                   VALVRELAEELGTDAKIAGFVGAVEHGYIEDGVTHHEINLVFEVSIDAAEPVSQEDHLE
FT                   FHWLPLDQLADTDVRPGALKNALVAAGEDRTPFWHGWNG"
FT   gene            complement(15783..16469)
FT                   /pseudo
FT                   /locus_tag="Svir_00170"
FT   gene            complement(16479..16676)
FT                   /locus_tag="Svir_00180"
FT   CDS_pept        complement(16479..16676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95108"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP6"
FT                   /protein_id="ACU95108.1"
FT                   /translation="MTAATESNAQTPRGDRALWLPTGAELDRIAGTNNYGRRILRRWKG
FT                   EGRISGGAALARDERKAIGA"
FT   gene            complement(16673..16897)
FT                   /locus_tag="Svir_00190"
FT   CDS_pept        complement(16673..16897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95109"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP7"
FT                   /protein_id="ACU95109.1"
FT                   /translation="MNREEIITGLTDAQADGLACVTCGLDYLLTRGSVSVPVGRSMTGS
FT                   QVFVCIDRCAELAGVDPTTMGRRAGGGRR"
FT   gene            complement(17237..18430)
FT                   /locus_tag="Svir_00200"
FT   CDS_pept        complement(17237..18430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00200"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF418); Protein
FT                   of unknown function (DUF405)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95110"
FT                   /db_xref="GOA:C7MRP8"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP8"
FT                   /protein_id="ACU95110.1"
FT                   /translation="MNHERPNSSASPGGTRIDALDLARGIAILGTLGTNIWIFTDPAGA
FT                   FGWVSPQGDGPVEGVVETLLLTLSNGKFLALLSILFGVGLELQYRSAARRGRRWPGRYL
FT                   LRALLLFVEGLLHYLLIFEFDVLTGYAIVSVHVAFLVARRDRVRRTWLAIAAAVHLLLI
FT                   GFLTSVLLTGNITLSGEEQTTTDLYTSASWAEQVLTRIELAGMFRAELIIIIPLSTVLF
FT                   LAGIEVLRAGTFEASERGKHVRRRMLVLGLGIGFPLNLVTAFAGVEWFFVDRYVLPPIV
FT                   AFGLLAAIVEAAERTRGGLLRKGLIATGRTAMTCYVFQNLICSVLCYGWGLGLAVTFAD
FT                   AGPWWVVALWAGVVALFMSLAWLWLRRFTRGPLELILHRVYSGRRARESTDRIPVRE"
FT   gene            complement(18624..19289)
FT                   /locus_tag="Svir_00210"
FT   CDS_pept        complement(18624..19289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00210"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95111"
FT                   /db_xref="GOA:C7MRP9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRP9"
FT                   /protein_id="ACU95111.1"
FT                   /translation="MNGEPIRVLVVDDQQLVREGLTALLELTEDVEVVGQAAHGREALD
FT                   ILTRKPCDVVLMDLRMPVLDGVAATREIRNRHPEVAVLVLTTYSDDDSIRDALGAGAQG
FT                   YLTKDAGRAEIHAALRAAVTGQATFTTAVSRRLVTALTEQRPRPSEPTPDPSATTLTAR
FT                   EREILGLIGAGLSNAEIAARLFIAESTVKTHINNAFAKIGVRNRAGAVRYAYQTGLVR"
FT   gene            complement(19286..20461)
FT                   /locus_tag="Svir_00220"
FT   CDS_pept        complement(19286..20461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00220"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95112"
FT                   /db_xref="GOA:C7MRQ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ0"
FT                   /protein_id="ACU95112.1"
FT                   /translation="MIEQPLFIDHYGRTWWLAEGLTIALFAWALGTILAYGPPLWVSVT
FT                   LIASFVCWVLFVVLSPRHPRAAASSLAACSLSPAAALMAGETSMVVVSVLVLGVYASHP
FT                   APRTRTIVMVTLANIAAIAMASVVTDLGIMKALTTTLITVIVLLIGINRRKHQFRARQT
FT                   ELLLEQTRLARSEHARAAALDERTRIAREIHDVLAHSLGALSIQLKVVEAELAAGKDPA
FT                   SALERIQRCSKLASEGLAEARNAVSALRRDVPTLPEAIAELADDHQRDHGATATLRSTG
FT                   TERPIPSAATVSLLGAVREALTNAARHAPGAPITITIDYTDTAVRVVVRNESTDPRPRD
FT                   EGTGFGLTGMAERVALAGGSLTAGPDGDGWSVIATMPLQHVDHPAREVAAT"
FT   gene            21087..21509
FT                   /locus_tag="Svir_00230"
FT   CDS_pept        21087..21509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00230"
FT                   /product="protein of unknown function (DUF2020)"
FT                   /note="PFAM: Domain of unknown function (DUF2020)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95113"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ1"
FT                   /protein_id="ACU95113.1"
FT                   /translation="MSELTLPPEPEPENAGPCPYLDTEFVAEFNGQRVGEVKTSSEEPH
FT                   PTCFFYRPDGDLQLQVRVYVGEEDVARALVDAAAPVETSNPTSQPTGWEGGYESNDDGA
FT                   VYAVFKGGNAVVVTTNQPQSVKARTVATEAIANLRI"
FT   gene            21695..22138
FT                   /locus_tag="Svir_00240"
FT   CDS_pept        21695..22138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95114"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ2"
FT                   /protein_id="ACU95114.1"
FT                   /translation="MADTLKEILLDSSRRPNVVTDLQNLIDEEVANKGGLSGTAIKTGY
FT                   AAVKKMKPGIIGAAVDSLLDEFVAALEPIYADFKASGASDFGSYLPTRSDAADALLSVT
FT                   DARAEKSSRESIKKVYNKLRPKGKENVEEALPRLGKLIDKYAA"
FT   gene            complement(22256..22888)
FT                   /locus_tag="Svir_00250"
FT   CDS_pept        complement(22256..22888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95115"
FT                   /db_xref="GOA:C7MRQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ3"
FT                   /protein_id="ACU95115.1"
FT                   /translation="MAAQAAQAAEQRLNVSTENARKELARKAARTRKDAVRSAQEARAL
FT                   AEQRREELRVPGRKAKKAAIKAAKSAGLSRRKAKREFKKARKEFKAAMAEAKAISKQNA
FT                   PKRTKRWPWLLGFAAFAGAVAYAMKSRQEEPSIAPVPPRSTDIPTPATTATTASGATKA
FT                   GASENPKRQSAGSDVKPAQAKTRSDAKTTQPKTESGTQAAQTKSRPS"
FT   gene            23096..23644
FT                   /locus_tag="Svir_00260"
FT   CDS_pept        23096..23644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00260"
FT                   /product="peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95116"
FT                   /db_xref="GOA:C7MRQ4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ4"
FT                   /protein_id="ACU95116.1"
FT                   /translation="MTDSNATPSGGKITATLHTNRGDIRLVLFPDHAPKTVANFVGLAE
FT                   GTKEYTQPNAKGERSGPFYDGSIFHRVIDGFMIQGGDPTGTGRGGPGYKFGDEFHPELQ
FT                   FDRPYLLAMANAGPGTNGSQFFITVARTPHLNFKHTIFGEVADQESREVVDAIARTATG
FT                   PGDKPLEDVVIERVTIERA"
FT   gene            23723..24733
FT                   /locus_tag="Svir_00270"
FT   CDS_pept        23723..24733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00270"
FT                   /product="uncharacterized membrane protein"
FT                   /note="PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95117"
FT                   /db_xref="GOA:C7MRQ5"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ5"
FT                   /protein_id="ACU95117.1"
FT                   /translation="MVSNHEVTDVGRECRSVDNTVTEPPNPPPYGQSQQQEALPGCWWH
FT                   PGRQTGLRCVRCDRPACPDCLREASVGHQCIDCVTSARQQQRAQAEAYRRAGYGARTVV
FT                   GARVPQRVVVVPLLIAINVVIYALTAFQAGSVMDNHLSPVFEDGVLWPVAVVLFDEWWR
FT                   LLASGFLHYGLLHLAMNMLALWVLGRDLELLLGRIRFLAVYFLSMFAGAVAVFVFGAAD
FT                   TATAGASGAIYGLMGAVLVAVLRLRLNATAAIGIIVLNIVISVSLPGISLLGHLGGLVA
FT                   GALAMIAMVFAPERNRAAYQAGAVAIMAAALAGLVVYRDAELFDQLCFHPVLCGF"
FT   gene            complement(24709..25143)
FT                   /locus_tag="Svir_00280"
FT   CDS_pept        complement(24709..25143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95118"
FT                   /db_xref="GOA:C7MRQ6"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ6"
FT                   /protein_id="ACU95118.1"
FT                   /translation="MDNSPRAWAPKPGLVGVGWVLTAVSAIALGWNITSGDRPGTLLLA
FT                   VVSAAFLAASLHGTVVRPRLLADSEGVRVRTLGGTHFHPWSRLGLRLTTTRRYGRDVEA
FT                   LELDPTDGRLTVFGWVELGTDPHDVHEELLRLRQNPHNTG"
FT   gene            complement(25206..25469)
FT                   /locus_tag="Svir_00290"
FT   CDS_pept        complement(25206..25469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00290"
FT                   /product="Uncharacterised protein family (UPF0233)"
FT                   /note="PFAM: Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95119"
FT                   /db_xref="GOA:C7MRQ7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ7"
FT                   /protein_id="ACU95119.1"
FT                   /translation="MPKSKVRKKTAYTPPPNRQPVKVKAAGPSHPVYKIVMFGLMLLGL
FT                   LWLVVNYLAGHKLDFMAELGSWNFAIGFALMITGLLMTMRWR"
FT   gene            25957..26853
FT                   /locus_tag="Svir_00300"
FT   CDS_pept        25957..26853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00300"
FT                   /product="sortase (surface protein transpeptidase)"
FT                   /note="PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95120"
FT                   /db_xref="GOA:C7MRQ8"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ8"
FT                   /protein_id="ACU95120.1"
FT                   /translation="MDEVEDEPIAEDSPVDPPQDTEPPTSAPKPAKGGSGGGIRTAVRT
FT                   FGEILITLGIVVLLFVVYELYVTNLMSQRLQDQASAELEERWSQQREIHAEPMDGEAFA
FT                   RIYIPSFGVDWNFTIQRGVDSATLEVGPGHYKQTAMPGEQGNFAVAGHRVGKGAPFNDL
FT                   DLLSSCDAVVIETIDSFYVYRVLPMSDEVQGWAQGKGADPRCAGVRPLAEYDPVYSETV
FT                   GRRIVLPDRGDAVAPVPYRPDADLPEANRVELLTLTTCHPRFSDRERMIIHGVLTAVYE
FT                   KEAGATYEQLLKEIGEA"
FT   gene            26853..27014
FT                   /locus_tag="Svir_00310"
FT   CDS_pept        26853..27014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95121"
FT                   /db_xref="GOA:C7MRQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRQ9"
FT                   /protein_id="ACU95121.1"
FT                   /translation="MYGWIWRHLPGPLPVRIGIAAGLVLGAVALLMFVVFPWVEPLLPF
FT                   NDVAVEGG"
FT   gene            complement(27034..27804)
FT                   /locus_tag="Svir_00320"
FT   CDS_pept        complement(27034..27804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00320"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family;
FT                   Tetracyclin repressor, C-terminal all-alpha domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95122"
FT                   /db_xref="GOA:C7MRR0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR0"
FT                   /protein_id="ACU95122.1"
FT                   /translation="MTDSQRPGARPDARPELPGVLARMWGREPTPRRGPKPSLDLARIT
FT                   EAAITIADADGLAAVSMSSVASRLGVAPMSLYRYVDSKDELLLAMLDAASGDPPPVGGL
FT                   SRRDYLFRWTKAHVETFLARPWLLSIARGGPPLGPRGLLWLEQLLTALDDTPLDGEEKI
FT                   LIATTLSGYALNEASLIIALERSPKQGSQPSSSAAYGELIAELVDRRTYPRLAEIARGH
FT                   TFAAAEGAWIDEKDFRFGLDLLLDGIDALIARRS"
FT   gene            27936..28871
FT                   /locus_tag="Svir_00330"
FT   CDS_pept        27936..28871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00330"
FT                   /product="daunorubicin resistance ABC transporter
FT                   ATP-binding subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95123"
FT                   /db_xref="GOA:C7MRR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR1"
FT                   /protein_id="ACU95123.1"
FT                   /translation="MVMSPPAIEARGIHKTFGKRPVLTGLDLDVPAGTLLALLGPNGSG
FT                   KTTTVRILTTLLRPDSGTVRVGGHDAFTEPAAVRRAIGLTAQQASVDELLTGRENLELF
FT                   AGLNHLGRRESRRRAAELLERFRLTDAADRRAGDYSGGMRRRLDLAVSMVAEPRILFLD
FT                   EPTTGLDPRSRADLWGVIRQLVDTGTTVLLTTQYLEEADRLADRVAIIGGGRVVEEDTP
FT                   EGLKHRIGTERLRVTFARPLETSTAVALHPGAHPDPENSGVVVPLRGPDHLRQVLNDFH
FT                   RADLSVTSVSLSAPTLDDVFFHLTDEEVAV"
FT   gene            28868..29647
FT                   /locus_tag="Svir_00340"
FT   CDS_pept        28868..29647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00340"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="PFAM: ABC-2 type transporter; TIGRFAM: ABC
FT                   transporter efflux protein, DrrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95124"
FT                   /db_xref="GOA:C7MRR2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR2"
FT                   /protein_id="ACU95124.1"
FT                   /translation="MTVRSGASRANRVDELVLLTHRALRREFRQVDGLLVGVALPIMLM
FT                   CAMVGVFGRAVDTGTTLTYVDYVTPAVMLLCAGYGAAMAGVGITEDRSLGLTQRFKVLP
FT                   IAGWGIPASHVVAAVLRNVLATGLAVVVALVLGFRPDADLVDWLLVLAVVVGYVVTIAW
FT                   WSVVWGLLVHSVQAAGALSFIVLFLPYVSSAFVPVESLPGFLQGFAEHQPITPLVESLR
FT                   GLLLDAPVAEGTGWTVVAWLVGGCVVAVPLATVLFRQ"
FT   gene            29684..30325
FT                   /locus_tag="Svir_00350"
FT   CDS_pept        29684..30325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00350"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Glutamine amidotransferase class-I; TIGRFAM:
FT                   glutamine amidotransferase of anthranilate synthase or
FT                   aminodeoxychorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95125"
FT                   /db_xref="GOA:C7MRR3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR3"
FT                   /protein_id="ACU95125.1"
FT                   /translation="MRVLVVDNYDSFVYNLVQYLAQLGAECVVRRNDVVDADEVPEFDG
FT                   VLISPGPGTPERAGRSVEVVRRCAAESVPTLGVCLGHQAIGVAWGATIDRAPELFHGKT
FT                   SRVEHDGTGVLAGLPNPFTATRYHSLTVVPETVPEEFEVTGRTASGVIMAMRHRDLPVE
FT                   GVQFHPESVLTQGGHRMLANWMASAGHPVPGALVDELEQATLELRQTAVA"
FT   gene            complement(30395..32401)
FT                   /locus_tag="Svir_00360"
FT   CDS_pept        complement(30395..32401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00360"
FT                   /product="protein kinase family protein with PASTA domain
FT                   protein"
FT                   /note="PFAM: Protein kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95126"
FT                   /db_xref="GOA:C7MRR4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR4"
FT                   /protein_id="ACU95126.1"
FT                   /translation="MSAPRLLSNRYELGDTLGYGGMSEVHHGHDTRLGREVAVKILRAD
FT                   LARDPMFQERFRREAQNAAALNHPAIVAVYDTGEAETEYGPLPYIVMEYVEGRTLRDIV
FT                   KTEGPMPQKRAMEVMADVCAALDFSHRHGIVHRDVKPANVMITRTGAVKVMDFGIARAV
FT                   HDGQAAMTQTAAVIGTAQYLSPEQARGETVDARSDVYSAGCVLYELVTGEPPFTGDSPV
FT                   AVAYQHVREAPRAPSETNPSVSPELDAVVLKALAKSTSERYQSAAEMRSDLVRTLSGQR
FT                   PSAPLAGAAPVEDERTQVLESSSRAPEPEDDYDPQAYDDEEEARKRRRRRGITAAVLTV
FT                   LILGVVAFISWIMGAFKQEAEVMAVPDVVGMQVEQAKQKLHEAGFQKYQTQPVVCLDNP
FT                   PSGESQCTSDQIDSVIASDPEPHSQVPLTTEIVLQVGTAPEKVEVPDLTNLTREEAEAA
FT                   LAEVNLVLDPNVDMVEVENEEQYGKVVGQDPPAGEEVEQGHSVTIQIGKTPEMVEVPDM
FT                   TGESFEKAKATLEGLGLVVKREDVDAEEPQGTVVGQHPNGGHVREGSEVVLKVSNGSQA
FT                   KIDMPDIVGMTEEEAVSALRNAGWNGTHSLQFQSTSDSDQVGKVLNSSPAPGSSITKNQ
FT                   QIVLYIGADESGSTEPPPDDDDPGFPFGRNGNS"
FT   gene            complement(32490..33749)
FT                   /locus_tag="Svir_00370"
FT   CDS_pept        complement(32490..33749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00370"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95127"
FT                   /db_xref="GOA:C7MRR5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR5"
FT                   /protein_id="ACU95127.1"
FT                   /translation="MLSSGQLLAQRYRLEGRIAVGGMGEVWEASDTRLDRTVAVKILKA
FT                   ELSGDAEFLHRFRTEARTTASLNHHGIAAVHDYGETEAGDGSDTSIAYLVMELVEGEPL
FT                   AAILARERRLSPERTLDILEQAGRALQAAHERGLVHRDVKPGNILVTPSGVVKLTDFGI
FT                   AKAADAAPVTRSGMVMGTAHYIAPEQALGHDAEPASDVYSLAVCGYECLAGHRPFLSDH
FT                   AVSVAMMHIRDMVPPLPPDVPPNVRAVVEATLVKDPRQRYANGGEFADAIAAVRAGRPL
FT                   PPPSGLAAAGYLTHPINPNTHPAQAAPIALSSPQTPVPGPVGPGSHPAISPVPPPGDMR
FT                   QVPRPPRRSPVGTLLAVALVLLATVVIVVLALTVWNDDGSGSTTERVPVGDNWPNTGMH
FT                   SPGGGGEQGMMSTLLLENHR"
FT   gene            complement(33753..35222)
FT                   /locus_tag="Svir_00380"
FT   CDS_pept        complement(33753..35222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00380"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95128"
FT                   /db_xref="GOA:C7MRR6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR6"
FT                   /protein_id="ACU95128.1"
FT                   /translation="MNTPLRKVGVTMLVMVTLLLVNTTYIQVVKADDYRTDGRNTRVLF
FT                   DEYSRERGKITSADAGQVLASIEPTDNTLKYRRTYLNGPMYAPVTGYYSVNYGASGLEQ
FT                   VHNDFLNGSDSRLLVRRLSDLITGRDTRGGNVRLTIKPAVQETAYKMMAERNYRGAVVA
FT                   LDPKTGDILAMVSTPSYDPNKLASHSSDEQQKAWKAYTEDDANPMLNRAIRETYPPGST
FT                   FKIVTTAAALENGATADTRITPKARVTLPNTKTTLENFNGATCPGNTLKDALAYSCNTA
FT                   FSVLADELGADKLWETAANFGIGMNDLTIPMSVVRSDLGPLESSAALYQSGIGQRDVRL
FT                   TPLQDALLAATVANDGVAMRPRLVKELLAADLSTVEEFSPEELTGDPALSAANAQVLTD
FT                   MMIASEANTQGGGKDPSLKIASKTGTAEHGTDPKATPPHAWYTAFAPHDDPQVAVAVIV
FT                   ESGGNRGLAATGATVAAEIGRATIAAALGGG"
FT   gene            complement(35219..36850)
FT                   /locus_tag="Svir_00390"
FT   CDS_pept        complement(35219..36850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00390"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95129"
FT                   /db_xref="GOA:C7MRR7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR7"
FT                   /protein_id="ACU95129.1"
FT                   /translation="MAQPAANPGAAAQYTTNPPRELPKRRGTELALLAFSALIVTLAFV
FT                   LVQANQEQELSWSVVWYGLAYLAIFGVAHLAVRRWAPYADPLILPCVALLNGLGLVMIH
FT                   RIDLAEAQRALANGGDAAAYAPRQVLFTVIALAFFLGVLILVADHRKLTRYAYTCGLTG
FT                   LVALALPAVLPSSLSEVNGAKVWLKLPGFSIQPGEFAKILLMIFFAGFLVSKRDLFMTA
FT                   GKRVLGVELPRARDLGPIIIAALACLGILVFEKDLGTALLFFGIVLMMLYVATERVIWV
FT                   VLGLSMFSVGGIIAYSLFTHVQQRVANWFDPLETYYDLGGGYQIAQGLFGLGTGGMLGT
FT                   GLGLGRPDTVPESHTDFISAALGEELGLVGLSAILIVYLLLSMRGMRSALAVRDTFGKL
FT                   LGGGLSFAVIMQVFVIVGGVTKLIPMTGVTTPFLSAGGSSLLANYALIALLLRISDAAR
FT                   RPQQPAKPKPAPQAPLAEAHTVMVQRSMAGPVIPASPAGPANPAQPGHPMNPGNSGHPM
FT                   NPGHPNVPGMPGAPGTTHPPEGGRQP"
FT   gene            complement(36850..38286)
FT                   /locus_tag="Svir_00400"
FT   CDS_pept        complement(36850..38286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00400"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95130"
FT                   /db_xref="GOA:C7MRR8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR8"
FT                   /protein_id="ACU95130.1"
FT                   /translation="MTLVLRYAARSDRGLVRSNNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIASLAHLDDDEPGDDLVTQLREAVNQGNQAISELVAGDPELDGMGTTLTAVLFS
FT                   GSRLGLVHVGDSRAYLLRNGQFSQITRDDSFVNELLEQGRITEEEAATHPQRSLLLKAL
FT                   TGHEVEPSVTVREARAGDRYLLCSDGLSGMVSDETLAEALRIPDPQECADRMIELALKG
FT                   GGTDNVTVIVADVVDVDFGEDAPIVGGAAGDGTDEGPPVDSPAARARALTAPPPPPPVP
FT                   QQTEQLETQPDPKAKRRKRLRLLLAFGLALVLLAAAAFATRYFVLRQYYVGVDEETSEV
FT                   VVYQGVPGSILGFKLQQKAEGSCPPEASLCDPLMLEDLQQDARAAVSNGVKRDGLVESR
FT                   EYINTLRHNNMLEICDDESDQAQGGGLGGIEQGGETQDAAEGATPGAPNEPTNTTAAGR
FT                   NEGGQRPGVDCRPAPSSGGN"
FT   gene            complement(38283..38753)
FT                   /locus_tag="Svir_00410"
FT   CDS_pept        complement(38283..38753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00410"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95131"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRR9"
FT                   /protein_id="ACU95131.1"
FT                   /translation="MPELVVQLTRVGFLVLLWLFVFAALRVVRSDLYAASGLRVNLPSL
FT                   RRGDKERKPLRGRNKLPRQLVVTHGALAGTRIALDGRPILIGRADDSTLVLDDDYASTR
FT                   HARLSLRGDEWFVEDLGSTNGTYLDRAKVTAPMKVPLGVPIRIGKTVIELRP"
FT   gene            complement(38899..40119)
FT                   /locus_tag="Svir_00420"
FT   CDS_pept        complement(38899..40119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00420"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95132"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS0"
FT                   /protein_id="ACU95132.1"
FT                   /translation="MGRVQRFDRRLENLVGSAFARIFGGNVVTQEVALELERECEDNVR
FT                   DLAGGRKLAPNHYIVSLGAEDYDRMAADGPRVTRMLAEAVSEHLAEHGWDTYGDVVVSL
FT                   ERDEALHTGKFKTRSTVDPDVKASDAGTFARSASKSDAGDRPMSQPGGYGQYDQGDPYG
FT                   QQGQYGYGQGQPGYDQGYGQPGGYDQGYGQPGGYDQGYGQPGYDQGYGQPGGYDQGYGQ
FT                   PGYDQGYGQPGGYDQGYGQPGYDQGYGQPGGYDQGYGQPGYDQGYAAPPSPPGGYPAQT
FT                   PPPPPGGGDPYAQQQGGYPGGGMPPAGNRQLTAILQLDDGSNRTYSLKQGGNVIGRGQD
FT                   ADFRLPDTGVSRRHLEITWDGQSATLADIGSTNGTTVNGTPVQTWQLADGDVIRVGHSS
FT                   LVFRTQG"
FT   gene            40246..40328
FT                   /locus_tag="Svir_00430"
FT   tRNA            40246..40328
FT                   /locus_tag="Svir_00430"
FT                   /product="tRNA-Leu"
FT   gene            40522..40722
FT                   /locus_tag="Svir_00440"
FT   CDS_pept        40522..40722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95133"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS1"
FT                   /protein_id="ACU95133.1"
FT                   /translation="MRKGLSRLADAARGGEQNPGCAEGGIGRTRPEVTVDVGSPWFEPA
FT                   PAVVRFLGLIPLVDDPEPAGG"
FT   gene            41751..42932
FT                   /locus_tag="Svir_00450"
FT   CDS_pept        41751..42932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00450"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95134"
FT                   /db_xref="GOA:C7MRS2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS2"
FT                   /protein_id="ACU95134.1"
FT                   /translation="MNSRKTFARVGALVAGTAAALSLGSTPVSADSAKARIDGSTNGYV
FT                   VNLDSESQTTTLFNLSLEGGNSLRAYCVEISVRVDPSRPLYESPWDEFPNPDSPFHGNR
FT                   DHINWVLHHGYPAQSLSDLEQTLTEQGVELHNGLSQREAITATQAAVWHYSDGKNIDRQ
FT                   DPVRAGQDVDADVLALYDYLTGESNVGMAEPNAALELDPNSATGVAGERIGPFTVSTTG
FT                   EITELISELPEGVTVTDAEGNELTAEDIGDGTELYIDVPAEAAEGAGEFSLTATAHLAI
FT                   GRLFVAEDYDRKPAQSLIVASSDDTTMKAKASAEWKAAPKTTPPEETTEVPTPTPTSQQ
FT                   PPVETPQPSETPQTETEDLAQTGVSAMTPLLIGLGLVAAGTAAILLQRRRKNA"
FT   gene            43136..45901
FT                   /locus_tag="Svir_00460"
FT   CDS_pept        43136..45901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00460"
FT                   /product="DNA-binding transcriptional activator of the SARP
FT                   family"
FT                   /note="PFAM: Bacterial transcriptional activator domain;
FT                   NB-ARC domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95135"
FT                   /db_xref="GOA:C7MRS3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS3"
FT                   /protein_id="ACU95135.1"
FT                   /translation="MEFRILGPLQVVDGDREVVVPAGRLRVLLAALVCNANRVVSVSEL
FT                   ISYLWDDPSASARNTVRSYVRRLRARLREIDSQRVFIRQRTPGYVLDVDDTEVDLLRFR
FT                   SIVSEAYGTADPRKAAELFRSALKLWRGKPLADIESEALRRDVAAPLSEEHTRTVEARI
FT                   DRELASGAHTELVSELTALVERHPLRERFWGQLMSALAHGGRQADALAAYQRLRTTLAE
FT                   ELGIEPGPELRRIHEMVLNGKIPDPRRDHEEDGAPPGPVGGGTLGGIPAAPPSPRQLIA
FT                   DTTSFVGRERLIDDLTRWLANPSARRLLVVSGQPGVGKTALAVRLAHRVAEHFPDGQLF
FT                   VDLHGFSSTPAIAPADVLLRFLRALGHPAELIPEDLDERTALLRSVLAERRVLLVLDNA
FT                   ATADQVRPLLPGTTECAVIVTSRNVLSGLVAVDGARGVRVGALTTDESTSLLSTLLEGR
FT                   GDVRDEDLRRLADACGGIPLALRIAAAHLVTRNEVTVSDLLEDLSRYRLDVLTVPHDGH
FT                   ACVRTAIDVSYAALSEPVARLLLSLSLLPTPEFSVPVAAAVGDCDLPEAMRLVAALAEA
FT                   NLVEERGAGRHRLHDLVWVYLAHRAGQELSAEERFAAARRMADFYLHTVISAGWFVRRE
FT                   PLPIELPTRPDTIRTVPFDNLQQAVAWYEAERANLVAVIRECERRGWHRHAYVLPIVLC
FT                   SFYLLRKHWSDWEETHTVALRAARRGNDRRAESAVLHRLGALFDNQGRSRKALDTYRAA
FT                   IDIARELDDPRLEAAALTGAGAAYFSVGRFFDAHSCYQRAVELHLKAGNPYGQVGPLVN
FT                   VTRLHVARRDFAAAFASAREAIKTAMAYGSVNHPGIAWLNLGEAYLEAGYVDEAVEAIE
FT                   QAGRVATMSSDRDTKARSLNLLAAAEERRGDMLAARRFRQRATLYAAEIG"
FT   gene            complement(46116..47111)
FT                   /locus_tag="Svir_00470"
FT   CDS_pept        complement(46116..47111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00470"
FT                   /product="flavin-dependent oxidoreductase, F420-dependent
FT                   methylene-tetrahydromethanopterin reductase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95136"
FT                   /db_xref="GOA:C7MRS4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS4"
FT                   /protein_id="ACU95136.1"
FT                   /translation="MSTRSLSVPLSVLDRSSIRRGQAPADAVRDTVRFARRMEALGYHR
FT                   FWVAEHHSVPGVAGSAPTVLAAAVAANTSCIRVGTGGVMLPNHQPLVVAEQFGTLEALH
FT                   PGRIDMGLGRSVGFTGGVRAALGRGKEHASHFDEQIRELLGYFAGSPVHRGVRGIPAEG
FT                   LRVPAFVLATGSGADVAADTGLALVIAPVSGVDKMSEHIARYRATFRPSSLWPRPYVIV
FT                   ATAVAVADTPRRARELLLPEAWSLVHSRTRGVFPPLLPPADIPTPTEREAALLADVLRN
FT                   QIHGTPASVHDELVALVERTAADELLITMSTYDRADMLDSYTALAELAGG"
FT   gene            complement(47150..48010)
FT                   /locus_tag="Svir_00480"
FT   CDS_pept        complement(47150..48010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00480"
FT                   /product="citrate lyase beta subunit"
FT                   /note="PFAM: HpcH/HpaI aldolase/citrate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95137"
FT                   /db_xref="GOA:C7MRS5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS5"
FT                   /protein_id="ACU95137.1"
FT                   /translation="MRPRRSVLYLPGANERALEKAKGLPADALVLDLEDAVAPDAKVTA
FT                   RQRVCAAVSSGAYGEREVAVRVNGIGTEWHDDDLRAVAQAGPHAVVIPKVSSATDVHAV
FT                   EDALTAAGAPQHTAIWAMIETPAAVLRAEEIANASTRLTVLVLGTNDLAKELHAEFVPG
FT                   RAPLLTSLSLCLLAARAAGKSILDGVYNDVRDAEGFETECVQARQFGFDGKTVIHPNQL
FT                   EPCNRVFAPSEAEIDHARRVIDAFEQAMAEGRGVVTVDGRMVENLHVEQARRVLGLAEA
FT                   IERLH"
FT   gene            48346..49005
FT                   /locus_tag="Svir_00490"
FT   CDS_pept        48346..49005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95138"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS6"
FT                   /protein_id="ACU95138.1"
FT                   /translation="MAVPPGQTATTSGSSGVRSIPGRTAPRLELPSHPADLAERAVPLL
FT                   GWQGTVLPQLTLFGRRVFVVARLRPDAHAERIAMGLRPVTDRTTVATWLWPELERSAPP
FT                   PAVHIAGVLAVARHWRTGMAATVPFARYGEAALVLPTAAAMSHDYVDNFLPRARMYGLG
FT                   VVTADEVANLDLDLACGDDRLTLGEDAVWRWVHEVAYEQLLACEAAGFAAQGMRND"
FT   gene            49016..49678
FT                   /locus_tag="Svir_00500"
FT   CDS_pept        49016..49678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00500"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95139"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS7"
FT                   /protein_id="ACU95139.1"
FT                   /translation="MRVVIAGGHGKIALRLERLLVSNGDTAVGIIRKPEQAEKLREIGA
FT                   EPVVLDLEQASVDEVADVLSGADAAVFSAGAGPGSGVARKDTVDRAAAVLFAEAAERAG
FT                   VRRFVQVSAMGAGDPIDADVEARVGEVFAAYLRAKAAAEEDLRGRDLDWTILRPGRLTD
FT                   EPGTGLVRLADDVPRADVPRDDVAEVLRRLVADTTTYGRTLELVSGDTPIAEAIERL"
FT   gene            complement(49691..51049)
FT                   /locus_tag="Svir_00510"
FT   CDS_pept        complement(49691..51049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00510"
FT                   /product="FAD-linked oxidoreductase"
FT                   /note="PFAM: D-arabinono-1,4-lactone oxidase; FAD binding
FT                   domain; TIGRFAM: FAD-linked oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95140"
FT                   /db_xref="GOA:C7MRS8"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS8"
FT                   /protein_id="ACU95140.1"
FT                   /translation="MSQWTNWAGTASARPRRVHRPTDTAELCAIVAETAERGGRIRPLG
FT                   SGHSFSPIAAADDDTDVIDLSAFTGIVSADAGNGLVTVRSGTTLRELNTLLAALDLALT
FT                   NLGDIDAQTIAGAISTGTHGTGARFGGLATQVEALELVTADGSVLTCSPTERPELFDAA
FT                   RVGLGALGVISTVTLRCEPAFLLEAHESPQPLDRVLTDFHALADGTDHFEFYWFPYGRN
FT                   ALVKRNTRLPVGTPARPLSPVRRFLDYTLMENAAFGGLCRLSRAVPRLAPTLGALASSA
FT                   LSTRRYSDASYRVFTTQRLVRFVETEYAVPRESVLDVLAELRALVPRLRHPVAFPVEVR
FT                   VAAADDIWLSTAYGRDTAYVAVHQYVGMPYEEYFTEFARIAASVGGRPHWGKMHPLDAD
FT                   ELRHLYPRFDDFRRMRAALDPGGVFSNAHLDRILGKPSEQNDSAGLVGPTFRS"
FT   gene            51127..52308
FT                   /locus_tag="Svir_00520"
FT   CDS_pept        51127..52308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00520"
FT                   /product="predicted amino acid aldolase or racemase"
FT                   /note="PFAM: Alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95141"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRS9"
FT                   /protein_id="ACU95141.1"
FT                   /translation="MSSAASYDLATQDLDPPLAIVDLDAFDANAGDLVRRAAGKPIRVA
FT                   SKSVRCRALLERVLARPGFAGLLCYTLAEALWLFEQGTSDDLVVAYPTVDRAALRVLAE
FT                   DDAARQAITLMVDSTEQLDFIDATLGSAHPRIRVCLEFDASWRPIPGVHIGARRSPVFT
FT                   PRQAVKLATAIERRRGFRLVGVMGYEGQIAGVPDGDPGVAGAAVRWMQRRSAAELARRR
FT                   AAVVAAVRTVAELEFVNGGGTGSLESTRTDSSVTEVAAGSGLLAPALFSRYQRFQPRPA
FT                   ALFALPVVRKPARRTATLAAGGYVASGQAGQSRLPSPHLPHGLRLSAVEGAGEVQTPVI
FT                   GRAARRLRVGDRVWFRHAKAGELAEHFPHYHLVLGDRVVRTVPTYRGEGRFFG"
FT   gene            complement(52380..53018)
FT                   /locus_tag="Svir_00530"
FT   CDS_pept        complement(52380..53018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00530"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95142"
FT                   /db_xref="GOA:C7MRT0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT0"
FT                   /protein_id="ACU95142.1"
FT                   /translation="MSDKHIATQAESTPLRRQPVQQRSAKRVERMLDASAELLEEVGYE
FT                   GLTTTLIAKRAGVAVGSLYQFFPDKRAVVQALAQRNLEHFIAEVHKRLGTVDTRHWWDV
FT                   VDSLLDIYLTMHREVPGFSTVHFGDPVEPRLLDDRRTNNRVIVDALTRLVTDHVNLPPE
FT                   QVTLPITIAVEAADGLLNYAFQVDPQGDPEVIAETKTLIKDYLAGKFGD"
FT   gene            complement(53446..53850)
FT                   /locus_tag="Svir_00540"
FT   CDS_pept        complement(53446..53850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95143"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT1"
FT                   /protein_id="ACU95143.1"
FT                   /translation="MDQILGQVLRNAVWERLDRLTDVANDADAPALISVARSELPRLAE
FT                   GWRAILRVHEPDERGDCPTCSTRWHKCKAPCSVWQVAHDHLVAGGLAHFQHSRRYRRRR
FT                   AESTPDETNTSTTPATRPTGRHALIGRPHR"
FT   gene            complement(53864..54199)
FT                   /locus_tag="Svir_00550"
FT   CDS_pept        complement(53864..54199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95144"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT2"
FT                   /protein_id="ACU95144.1"
FT                   /translation="MDVHSITAGTAGTDTVSGRFRDSDEPTRRSVAHMTRPTQPHPDSG
FT                   RRYEGGQVVWRVQCGDLISRERSVTVFVENGEVVLVGPPGETARLSASQLGQLRAALNE
FT                   AAELARK"
FT   gene            54492..55862
FT                   /locus_tag="Svir_00560"
FT   CDS_pept        54492..55862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00560"
FT                   /product="Helix-turn-helix protein"
FT                   /note="PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95145"
FT                   /db_xref="GOA:C7MRT3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT3"
FT                   /protein_id="ACU95145.1"
FT                   /translation="MKANENTTQSRINPAIWEAREMRDALANRNISEVYRQLRMHGISQ
FT                   RQIAAMTGQSQSEVSEILKGRQVMAYDVLSRIAKGLRIPRGYMGLAYDETTRNQVVGDA
FT                   DEQQAEEDESVKRRKFLAHAAQVTMGAAVFGPASTAWASSPTQTPAPGRIGMTDVRQVE
FT                   AATRALRALDYQYGGGFCRDAVVAQLSWGQQMLQASGSEQVKSRLYVALADLHSLAGWT
FT                   SFDIDLVDSARNHFAQALELAKQGDNHPLVANILYRMGRVYLHQDAPNEALKLFQLGQL
FT                   AAQDSGSELAVAVLCANEAWAYAMMGNAEQAMKLLGRTRDEFARADLANAESWVKFFDE
FT                   TDVYAMIGTVHTELAQNVDVSHTRYAIPALRRATEAYGGDMARSKTFSLGMLATNHMLE
FT                   GDIDYGAKVGGKALDCAEGLKSARVKKRMEPLRQEALRRSNNSDARELAERMNEFFS"
FT   gene            55892..56779
FT                   /locus_tag="Svir_00570"
FT   CDS_pept        55892..56779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00570"
FT                   /product="predicted aminoglycoside phosphotransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95146"
FT                   /db_xref="GOA:C7MRT4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT4"
FT                   /protein_id="ACU95146.1"
FT                   /translation="MDGRYTKKKLDEVLRRACARLGVDHRGATLLRFTNNAVYSLAHDP
FT                   VVVRIVGSQALRHRAGKVVRVARYLAEHGVPAVRLFDGVDQPLSVDGYAVTVWHHVHPV
FT                   RRTATPAELARLLRLVHSLPPPDDVPAWAPLDDVRARVSEAEELAAEDRSFLLDRCAEV
FT                   EAGLRELDFVLPPSLVHGDAHPGNVIAGADGPVLCDFDSSCVGPPEWDLVPLAVGRTRF
FT                   RDPPERYGELVRHYGFDVMEWEGFAVLRAARELKLTTSVLPIARSQPTVRRELARRLAD
FT                   LRAGRTDGWWVRYR"
FT   gene            complement(56905..57936)
FT                   /locus_tag="Svir_00580"
FT   CDS_pept        complement(56905..57936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00580"
FT                   /product="putative copper export protein"
FT                   /note="PFAM: Copper resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95147"
FT                   /db_xref="GOA:C7MRT5"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT5"
FT                   /protein_id="ACU95147.1"
FT                   /translation="MSRTAIATSWLPRFGPLIAIVTAALSGVLIALALTVSAPVSGITQ
FT                   ASTAIRVGLPIARAAIDLAAVAAVGFALLPLLAGERTPASARPVFARARTVVIASALVW
FT                   AVAALASLVLQTAELYRPDGTAVSFTDLRSYVDTVAGGKALLIVAGFALVQALLAGAAT
FT                   RLGRKVPPELIVGCGLFALLPLPVTGHATMSHFAEHTMVLLELHIVSVVAWTGGLAAIV
FT                   VLAARHRALLATVLPRFSQLATVCLAVAVATGVLNGLAQFIENPLVRLWPDLFTTPYGQ
FT                   LLVAKTVALAVIAGLGGYTRWKLLPNVIRHRRTALVSFAVVELALMGLAFGFAAVLGRT
FT                   PLT"
FT   gene            58128..59906
FT                   /locus_tag="Svir_00590"
FT   CDS_pept        58128..59906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00590"
FT                   /product="choline/carnitine/betaine transport"
FT                   /note="PFAM: BCCT family transporter; TIGRFAM:
FT                   choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95148"
FT                   /db_xref="GOA:C7MRT6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT6"
FT                   /protein_id="ACU95148.1"
FT                   /translation="MAGHSDEEGERSRTELEDSDSERIVDQPGDTDSRSTAEAKHDPEL
FT                   TPAHEKHRPRTDHVVFGVSAIIALAIVAWGIASPGSLAVVADTLLNDVVIPYGGWAFVL
FT                   TASGFVLFAIGVAISRYGRIPLGRDDEQPEFRTVSWIAMMFSAGMGIGLMFFGVYEPVA
FT                   HFVEPPPGTVPGNSDQAVHTAMATTLFHWTVHPWSIYAVVGLAIAYSAFRKGRSQLISA
FT                   VFAPLIGTRRSEGPLGKAIDIMAIFATLFGSAASLGLGALQVGGGLAAVGWAEKPGTGL
FT                   LVGIIAVLTVAFVASAVSGIARGIQWLSNINMVLAALLAVFLLVVGPTVLILNMVPGAL
FT                   GDYLHDLSAMAGRTGATGGEEMREWLGSWTVFYWAWWISWAPFVGMFIARISRGRTIRE
FT                   FVIGVIAVPSIVGLVWFSIFGGAAIQYQRSGVDIAGAGGEEAATFTLLESLPLFLPIAI
FT                   IVMVLVSIFFVSGADAASVVMGTLSQRGSSGPHRRVVIFWGAVMGAVAAVMLLVGGDDA
FT                   LNGLQNLTILVSVPFVFVMIALCVSLYRDLRRDPLVVSEDEVMRSLRKLHAERKAERKA
FT                   ERRAELARVRRHLRKR"
FT   gene            complement(60005..60598)
FT                   /locus_tag="Svir_00600"
FT   CDS_pept        complement(60005..60598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00600"
FT                   /product="uncharacterized protein, copper resistance
FT                   protein CopC-like protein"
FT                   /note="PFAM: Copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95149"
FT                   /db_xref="GOA:C7MRT7"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT7"
FT                   /protein_id="ACU95149.1"
FT                   /translation="MRRLVAFVTALAVALLTVITAALPASAHNVLISSSPAEGEELDTP
FT                   PTEVVLTFDQPVQDADVNEIAVTGPNGDQWAEGTVEVDGATVTAPLRPLGPAGEYVIGY
FT                   RVLSADGHPVSAEIRFTLTSPGPGQASGTPDSGPNTDRGDSPQGENAQDDATTDTAAEQ
FT                   GDSEGIPVWVWIVGAAVLLIAGLVVALRMGKSQD"
FT   gene            complement(60595..61287)
FT                   /locus_tag="Svir_00610"
FT   CDS_pept        complement(60595..61287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00610"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unkown function (DUF1775)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95150"
FT                   /db_xref="GOA:C7MRT8"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT8"
FT                   /protein_id="ACU95150.1"
FT                   /translation="MVTAVAAGTTMLLAGGIASAHVTANVYGDTPEKGGYGAIVLRVPN
FT                   EEERVGTTKLEMTLDPEYGITSARTKPVPGWTAEVTKTDDVVTKITWTAEDGHEIAAGS
FT                   HSYEEFEFVIGALPDDVDTLVLPTAQTYSNGKTVNWEQPPTDDDAERPAPVVELAESSG
FT                   SGHSHGSGPTHGDSNHHPSENAEDAAGSTDATDDTARLLGGAGLVLGALGLGLGVGATM
FT                   RARKAGKS"
FT   gene            complement(61342..61908)
FT                   /locus_tag="Svir_00620"
FT   CDS_pept        complement(61342..61908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95151"
FT                   /db_xref="GOA:C7MRT9"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRT9"
FT                   /protein_id="ACU95151.1"
FT                   /translation="MSPRSASDRMMRGIRGVLLAGCSATLSVAAHALGGGPLPHLLPTL
FT                   ALTVLIGWVSTALAEQTRGLGGVLIVLGSAQLVSHLLLGELSGHTVNSPAMLTCHGVAT
FT                   FATAFVLARAEAMLAMAAAVLSLLRGLFVVCVASPGRMEQRGGHPVVRTAEGLSAVAVL
FT                   LRRAHPRRGPPSTLLTSSERHPASV"
FT   gene            62031..62678
FT                   /locus_tag="Svir_00630"
FT   CDS_pept        62031..62678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00630"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95152"
FT                   /db_xref="GOA:C7MRU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU0"
FT                   /protein_id="ACU95152.1"
FT                   /translation="MNLFEYVADRWERLSLQAFLHVSEVVQSTIIAAVLGVGIGIAVYR
FT                   SPVGSAVATALASTVLTIPSFALLGLLIPVVGLGATPTVIALVLYALLPITRNTIVGLA
FT                   SVDPAVTDAAKGIGMSRLGVLTRVELRLAWPAILAGMRVATQMLMGIAVIAAYAKGPGL
FT                   GSEVFSGLTRAGSANATNQALAGTLGVVILALLLEGVYFLIARLTVSRGIRG"
FT   gene            62671..63831
FT                   /locus_tag="Svir_00640"
FT   CDS_pept        62671..63831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00640"
FT                   /product="glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: glycine
FT                   betaine/L-proline transport ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95153"
FT                   /db_xref="GOA:C7MRU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU1"
FT                   /protein_id="ACU95153.1"
FT                   /translation="MADKPSGVEIQLENVTKRYPGSSEPAVADVSMTIPAGKIVILVGP
FT                   SGCGKTTTMRMINRLIEPSSGRITIGGEDVQAFNADELRRNIGYAIQQAGLFPHFTVEQ
FT                   NIGVVPGLLKWSRKRIRERVEELMDLVGLDPAEFRDRYPRQLSGGQQQRVGVARALAAD
FT                   PPVLLMDEPFGAVDPITRGHLQDELLRLQESLRKTIVFVTHDFDEAVKLGDRIAVLGDK
FT                   SSIQQYDTPEAILAHPANDMVAGFVGAGASLKQLTLLRVRDVSYSDTTLTATIGTSPAE
FT                   LHKRLTEQGRTYALVLDDRRRPKRWVHVRDLPAASSLTTVGRPVGDSVSTQSTLQDALE
FT                   AILAEGGNAVVTGSRGEYVGTVDITTVTDTIQQLRTGHVDSESGQS"
FT   gene            63828..64604
FT                   /locus_tag="Svir_00650"
FT   CDS_pept        63828..64604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00650"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95154"
FT                   /db_xref="GOA:C7MRU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU2"
FT                   /protein_id="ACU95154.1"
FT                   /translation="MTSTELSGFTTKSGSKRAERVRMLAQPTVVLLLVAAVVIWALARD
FT                   NDIIEAESLNASTLLSKTWEHLVITAVVTVLVIGVAVPLGVILTRPWARPAAPVFLGIA
FT                   NIGQAAPSLGVLVLFFLWTEMEGLWAAALPIAFYSLLPVLRNTITGIDSVDPALVDAGR
FT                   GIGMSALGVLFRIELPLAVPMILAGLRTSLVLAVGTATLAFFVNGGGLGELIDAGYKLN
FT                   RTSVLVVGAVLAVGVALLVDWLGALLERYLGPRGLS"
FT   gene            64649..65608
FT                   /locus_tag="Svir_00660"
FT   CDS_pept        64649..65608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00660"
FT                   /product="periplasmic glycine betaine/choline-binding
FT                   (lipo)protein of an ABC-type transport system
FT                   (osmoprotectant binding protein)"
FT                   /note="PFAM: Substrate binding domain of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95155"
FT                   /db_xref="GOA:C7MRU3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU3"
FT                   /protein_id="ACU95155.1"
FT                   /translation="MRGACALLAALSLLVSACGLNVNAALPFDVESGSIRKVPQLEGVE
FT                   ITVGSKDFTENVLLAYIAQIALKAAGAEPIDFTNISGSNSARYALEKGQIDLMWEYTGT
FT                   GWLSHLGNDQPIPSEEEQYEAVRKADLEQNGIVWLPYSEVNNTYGFATTEAFAEKHDLH
FT                   TLSDLTDFLKENPQEAVFCVDTEFANRPDGMPGVQETYGFPTTTTKTFGLGAIYAAVAN
FT                   NTCNVGEVFITDGRIAGLNLRVMEDDKRFFPQYNAAITMRQDFYERYPLIAEVLVPVAE
FT                   ALTIDTMIELNKQVDVDGRDAARVARDWMAEQGFIKAD"
FT   gene            complement(65702..66199)
FT                   /locus_tag="Svir_00670"
FT   CDS_pept        complement(65702..66199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95156"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU4"
FT                   /protein_id="ACU95156.1"
FT                   /translation="MGRRAERTHSETDNDTGWTPKRAKNAVRVAKVIVPAAAGALAPLV
FT                   IRAAGAIREVYDRQQARRMGVDVAQLPEYQGRGGALLARIAGAAEGLSRLADSPRATED
FT                   DLGFVTRSRSTLEQLSASVRAAERMPTPRRKAAHRAVSGELDAIETELLRRLGVHAPGA
FT                   TA"
FT   gene            66366..68003
FT                   /locus_tag="Svir_00680"
FT   CDS_pept        66366..68003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00680"
FT                   /product="predicted nuclease (RecB family)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95157"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU5"
FT                   /protein_id="ACU95157.1"
FT                   /translation="MAGEVLLDAGVVTRCRRRVHLDHDPTMRGAQLAPPDPAAEQRIAD
FT                   AREHRARIAEWLRAETPGSWAVIPGELPAAERERLTRAALDDGVAYIWNGLLPVDVDGG
FT                   RRGGVQLLVRASDGYVPVLVVRHRITDPGEGAWTTVLPQVDPDRAAVDTRRKVRSHPRD
FT                   QLRLAHARRLLEAAGYAESDRTIGGVVGLDADVVVWHDLSASTWPGGRNALQEYDERFA
FT                   DRLAVARAAARRGEALAKPSRILECKRCPWWPVCESELVRDRDVSLVVRGEDAVELRNV
FT                   GMSTVDKLAALDPEGESPIQWTGTTFADAVALARAWLADLTVVRRVETVRVPRADVEVD
FT                   IDMESFGDLGAYLWGCLLSGADIGIEPGYRAFVTWDPLPTDDEARSFARFWTWLSEVRA
FT                   KTEAAGLTFRAYCYNALAENRWLYASAERFAGMDGIPTRQQVRRFVESDEWVDLFRSVS
FT                   DQFLCSRGKGLKVVAPVAGFSWRDPEASGEASMRWYRDAVGMDGGAPDLAQRERLLRYN
FT                   EDDVRATYALRAWMSDEAMHAVPFMGEL"
FT   gene            complement(68013..68771)
FT                   /locus_tag="Svir_00690"
FT   CDS_pept        complement(68013..68771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00690"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95158"
FT                   /db_xref="GOA:C7MRU6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU6"
FT                   /protein_id="ACU95158.1"
FT                   /translation="MQIQGTAAIVTGGASGLGAATAKALAAKGARVFAVDLEASIAKAE
FT                   PSDGVTFVTADVTDADQVQRAVDTATDSGSPLRIVVNCAGIAPPSRILSKKGPHDLDLF
FT                   RKVIEVNLVGTFNVMTLAAQAIAATEPLDDDQRGVIINTASVAAFEGQIGQIAYSASKS
FT                   GVAGMTIPAARDLASHGIRVMTIAPGIVETPMMAGITEEFRQGLAASVPFPKRLGRPDE
FT                   YARLALNIVEHDYLNGEVIRLDGALRMAPR"
FT   gene            68912..70696
FT                   /locus_tag="Svir_00700"
FT   CDS_pept        68912..70696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00700"
FT                   /product="gamma-glutamyltransferase 2"
FT                   /note="PFAM: Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95159"
FT                   /db_xref="GOA:C7MRU7"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU7"
FT                   /protein_id="ACU95159.1"
FT                   /translation="MVENVFTSRPELAGTHGMVATTHWLASATGMAVLEDGGNAFDAAV
FT                   AAGFVLQVAEPHLNGPAGQVPAIFATAQERKPRVLCGQGVSPAAATPAHFRDLGLDLIP
FT                   GSGLLAATVPGAWDAWLLLLRDYGTKSLRDVLKYAISYAWQGVPVVRRITETIDAVAEL
FT                   FTNHWPSSAELWLPGGEAPTPGSLHRNRTLARTWQRLLGQAEVHASREAQIDAARRAWS
FT                   HGFVAEAIDEFSRKAFRDDSGRDHAGLLTGDDLASWEATYEDAVITDFGEWSLVKCGAW
FT                   TQGPVLAQQLRLLEGFRDQLRYVDGRPDARTVHLATECAKLAFADREAWYGDTDVDLGM
FT                   LLSWEYAEQRRALVGEEASAELRPGGPNPRLPAVLERTLGGQGGTGALGEPTVDAVGRT
FT                   RGDTVHIDVVDAEGNMISATPSGGWLQSSPTIPELGFCLDSRAQMFWLEEGLPNSLAPR
FT                   KRPRITLSPSMALRDGEPTLAFGTPGGDQQDQWQLCFWLAHTVGGLNLQEAIDAPAWHT
FT                   TAFPSSFYPRAWQPKELVVESRLGEDTIRELSERGHDVVDAGPWALGRLSAVSRDHATG
FT                   ILKAAANPRGMQGYAVGR"
FT   gene            complement(70706..71365)
FT                   /locus_tag="Svir_00710"
FT   CDS_pept        complement(70706..71365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00710"
FT                   /product="SnoaL-like polyketide cyclase"
FT                   /note="PFAM: SnoaL-like polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95160"
FT                   /db_xref="GOA:C7MRU8"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU8"
FT                   /protein_id="ACU95160.1"
FT                   /translation="MPNSKPTRVLSEHRESQRDTVTDTATDTATDGVSRPVSRHCQSTL
FT                   SIDAGATLVDAVTAAVTTVPGESCSQAGRRPARKARPPARPRVPHEDGTMDERTATTLY
FT                   RRWLDELWNGEDDRLDEVAATLVTADFVGHWPKHPGLARGPAQLADIVRQGRRLVDDCV
FT                   FELVLGPVPHDDLVAARWRGRGRHQGDPVTFHGHDLLRVDGDRFAEYWVIAEDPTD"
FT   gene            71407..72402
FT                   /locus_tag="Svir_00720"
FT   CDS_pept        71407..72402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00720"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family;
FT                   TIGRFAM: GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95161"
FT                   /db_xref="GOA:C7MRU9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRU9"
FT                   /protein_id="ACU95161.1"
FT                   /translation="MRRALITGITGQDGQYLAELLHSKNYKVFGLIKGQNNPKLEALQT
FT                   ELPFVELVSGDLQDLSSLVAALEQVQPDEVYNLGAISFVGLSFKQAELTANVTGLGVLR
FT                   LLEAIRMVGGSQNNPIRFYQASSSEMFGKVRESPQVETTPFYPRSPYGCAKVFGHDITV
FT                   NYRDSYGLFACSGILFNHESPRRGLEFVTRKVTNAVARIKLGLQDTLVLGDLEPRRDWG
FT                   FAGDYVKAMWLMLQQDEPSDYVVATGRTHSVREFVEAAFRHAGIDDWERYVTQDERFFR
FT                   PAEVDLLVGDATKARTELGWKPEVDFESLVAMMVDHDLKLEARKAGIQLP"
FT   gene            72399..73343
FT                   /locus_tag="Svir_00730"
FT   CDS_pept        72399..73343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00730"
FT                   /product="methyltransferase, FkbM family"
FT                   /note="TIGRFAM: methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95162"
FT                   /db_xref="GOA:C7MRV0"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV0"
FT                   /protein_id="ACU95162.1"
FT                   /translation="MISYAQNAEDVVLARLFRQRSTGRYVDVGAGDPVEDSVTKHFYDL
FT                   GWSGINVEPVPEFAERLRKARPRDVTLPIALGAAEGKATLHVVPEAWGRATLDDRLARR
FT                   YRDEQRWQVDEVGVEVATLAAVLDEHPGDVDFLKIDVEGAERDVLAGADWDRHRPRVVV
FT                   VEATAPGSPDPAYEQWEPILLEAGYRCALFDGLNRFYAQADDDEALTCLAVPANVFDEF
FT                   ERHDVARMRAETEDLPAIRAGETGYIRRLEQRLREEQQAREQNAAYIATLEQAVAEERR
FT                   RAEKATRYAATLEARIFELEAVREHTASTSRRE"
FT   gene            complement(73413..75776)
FT                   /locus_tag="Svir_00740"
FT   CDS_pept        complement(73413..75776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00740"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95163"
FT                   /db_xref="GOA:C7MRV1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV1"
FT                   /protein_id="ACU95163.1"
FT                   /translation="MAVSGKPMRHRMWTPLPPERSGISDYSYELLEALSDIADVTAVSR
FT                   YAEQAQTPPGVPVVGPDDEAPSDVLNTYHMGNHAGVHSWLYRKALATPGVVVLHDTSLL
FT                   DFNLGYFGGLDSPEFREEVRFAHGPIWGDPNDPALFRGWPAVEVDGVKHLDGQTLTMER
FT                   RLVSASKGVIVHDPFSARLLRQRYPGLPVHTVPSGAPLRDDTGRRRTRARLGWQDDHVV
FT                   FGVFGGFNRIKRTTVAVLAFANVRRRWPQARLVIAGHADFPDVVDDVRKLIGELGVSDS
FT                   VHLALSPDKTEFEQLITATDAVLNLRWPTAGETSAVMMRAFGAGKVVITSDLPQHRHLD
FT                   PTFCWLVPTDPAHEAEALSELLERVVCWPDEARQAGRQAREYVREHASWPVVAQAYRKA
FT                   LEAIGAERQAAPVVTPTRPGVNVFADARATTGLAESARRHALALVDTGVDMTFTEFNTR
FT                   APNRSLAVPRKLADLRRGKDHPIDLWFINVNEFQLIPEHALDRYTIAMWAWELPEVPDY
FT                   ALKQLPRMDELWVLSSFVADAFRTATDMPITVIPSVVPQRPGIQGDRAKFGLPDDGLVV
FT                   LFNFSASSSDARKNPWAVIEAFRQAFRPSERGTDAHLVIKAVDLHRFPELSAQLAQSVA
FT                   SVNGTLIGRDLTRADMDCLLATCDVYVSLHRSEGFGLGMAEAMAMGKPVIATGYGGNID
FT                   FMPPGSAAVVGYDIRPINDRDHRFGAEFGDWYRPGQLWAEPDVEQAARWLRRLAESESL
FT                   RRTMGARGAQAVKEVCSPEAVGAAMVKRLNEIGL"
FT   gene            complement(75767..76918)
FT                   /locus_tag="Svir_00750"
FT   CDS_pept        complement(75767..76918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95164"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV2"
FT                   /protein_id="ACU95164.1"
FT                   /translation="MSETRIAHALARLTKYQELNLPLRRTDLLGRLVLRFLWRRQVKWQ
FT                   IEANLAVRDALEALAESERELRSRLSGNGELATTEQLQHEVTLLRQSDQNLMAGLNQRL
FT                   YSSVGRVQSQLSELRLQLAGSAERDDDVEQRLKALEERVAELNTAAQDVRLRNARFDVL
FT                   LDELRAARPQRPGPELAQRVPERESFLELAISELLDGPVDRVRSARKPYLSLVTSARDD
FT                   GATGPVFDMAPARGEWLELVRDAGLPYRSASNNSVIRRHGEGLGLAIEEGDALDLLSDT
FT                   ARRSLGAVTAFRYAERQQPTVLARFVESAANALQPGGVLIVETSAGDDADAADFHLDPF
FT                   AVRPVHADFLRFLAESAGFSRVETREVDPVAAQPGRYSMIAWR"
FT   gene            complement(76963..78252)
FT                   /locus_tag="Svir_00760"
FT   CDS_pept        complement(76963..78252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95165"
FT                   /db_xref="GOA:C7MRV3"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV3"
FT                   /protein_id="ACU95165.1"
FT                   /translation="MRADNQLKSDGRPTALPAVHEAWLPREHSLYRPRHGRRQTVALVC
FT                   AAVFFLSPLVSFALGARPSEFENRALTPFPSLADGWSFFTQLAPWATDHLVLREEAIHA
FT                   ADAVSRGVFGEPPPLGDGPKQGGPLQPAPTESEPRQAHYPSVVEGKNDWLYLGDEVASH
FT                   CEPTRPLEETVAQLRKLRDGVEATGRRFITVIAPDKATLLPENLPDEYIGKECHQRNVD
FT                   KFWRLLGTEDYVLDLRAGLLAWGDQLGEPVYGPQDAHWSDEGGVLMARGLAERLRPGIS
FT                   AEWKVTPTSSWRVPADIPPLIGREGETVGRHYALAPNGEQDLTQDVEPDYRTPLTLDTA
FT                   SGPGTYGLGVGLLGDSFTIRALPYLSAAFANMTVLHHDSVSEDHGATAANMLAGKDVVV
FT                   LEIAERSLARGGPAVLSEPALSTVLDALSR"
FT   gene            complement(78249..80999)
FT                   /locus_tag="Svir_00770"
FT   CDS_pept        complement(78249..80999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00770"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95166"
FT                   /db_xref="GOA:C7MRV4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV4"
FT                   /protein_id="ACU95166.1"
FT                   /translation="MSDARTRSPQASACTVVTERQLPAARVLARSYLDHHPDHDFVVLV
FT                   VDRAEFPERPADHRVIGYRELDLDPDEFLRLATCFPAPELIEAVVPSLLRSLLDEYDVV
FT                   VYLASETEVRAPFPEITRLGAEHGVVLVPRLLSPLPRDGKEPDTESPVFNSGFLAVGAS
FT                   ARPFLDFWADRSKRDASGSAERTLELVLGLFPHTVVRDPGLGVGYWNLHERPLHRRADG
FT                   TIEVAGTPLRFLHFTGYRPDKPWQLTTHCRRPRIRLSRNRTLRELCDEYGDRLRQAGYR
FT                   EPPEGSLEDDDYGFARLPDGSPLTEHMRRAFHTAWLEATDPGLDDDPIERTPEEVPPHP
FT                   FGDDGGSQFRRWLTSPSSPPERTAGLNRLVMRLWLSRVDLQAVFPHPYREDNTGFRQWC
FT                   RVHGVAEGLLPEWALPHEPATPSPPIDEFGVNVAGYLTAELGLGEMGRVIHRAVRESGV
FT                   PVVSVVEEHSVARTVRTALDAPETAGWPKFPVSILAVNADYTGLLLDSHPDVGYRRYRI
FT                   GLWAWELEDFPPHLHKGFDLVDEVWTVSEFCARAIAPHSPVPVKVIPVPVLDPGEKPRP
FT                   PRAPGDPVRFLFAFDFNSTGQRKNPWGVVEAFRRAFGDRTDVRLTIKATNGHLHPEAEE
FT                   RLRHVIGADERIELLDRYLSVAELDALYADSDAYVSLHRSEGFGLTVAEAMVRGMPVIA
FT                   TDYGGTTEFFDPAVGWAIPYERAEVGPGWAPYQEDGVWADPDLDAAANAMRAVADDPAE
FT                   ARRRGKAAREHILRTRSMDAATEWIRTQLRAAYDTWRARSGDGDPTHEVPEALVPLDQA
FT                   RAALHSTPDPEAPHRLPFAPTLRKLVNRALVHYDDHQRKVLGRITDGTLDALSTLIRRI
FT                   DQNSEQHRRRIDILERQWNRRLTELTARLDRLERERNTDLDGPNG"
FT   gene            complement(80992..82305)
FT                   /locus_tag="Svir_00780"
FT   CDS_pept        complement(80992..82305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00780"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /note="PFAM: Flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95167"
FT                   /db_xref="GOA:C7MRV5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV5"
FT                   /protein_id="ACU95167.1"
FT                   /translation="MVLTGHVSLSGFEIGGLTVSWQEELRKLDEELASGRLSADDYRVR
FT                   RDQVLSSAVTSGENPAEGQQAQPQQAQPQQAQPQQPPAQPDQSADSSANSTQIISPASL
FT                   PQGNPQQHAEGNQLANAERTQVVSPWQGQPQQQPPQYPQQPGPVSPAAGFQQPGPASPA
FT                   AGFQQPGPASPAAGFQQPAQPWNAPQADQSPPWGGSEFPPLTPPTQTEETGQGPESFET
FT                   SSGKGKKIAGIIAAVVLLAGLGVGAWFLFSGGSDDDNVADDKPTQTATNPAPTSSAPPK
FT                   DDLEIAQLPGATSERTDITSFEDVVAHQVLTEDENKIYEDAGAGEARMVVSELSSDVKV
FT                   VVLTVQTASASAASTAVDDLVALQKKNGMDPYEGETPQGVEATQVDKNDKFPAAARAHY
FT                   AHGNTVVRIQVTAPELSGVGDPFEEIIATQLQALPADV"
FT   gene            complement(82409..82987)
FT                   /locus_tag="Svir_00790"
FT   CDS_pept        complement(82409..82987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95168"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV6"
FT                   /protein_id="ACU95168.1"
FT                   /translation="MLVALGAVIGGAWWLGQDSSDPAPVSTTPSGEVTPTDSEVALADK
FT                   LPTLPGEQSPNNSTMSVDRGAELGLYPEQTANFFTEHGVTEVIVRGSLDGSTGYLLLVL
FT                   RTGEPAQAQHVAEHLYQVTLPEKSTESEGPPRIASGFFEQKWVHGAWYASNEYAVALVV
FT                   TEPSNGEPGTLSEKLQRIVEPLQEVLPAH"
FT   gene            83133..83711
FT                   /locus_tag="Svir_00800"
FT   CDS_pept        83133..83711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95169"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV7"
FT                   /protein_id="ACU95169.1"
FT                   /translation="MVGLAPESSAAAFGAVARRASRSSKGLVGFLDPDGVKKSDGVGGV
FT                   VPAGSEVVRAGLVLRQPESSPCGSDVVPPGVSCGFSESFEAAEGSDGSFEAEDSGLSGV
FT                   DDEDVDVDDVDEDADEDADEDEEGVVDEAAAGAGDTSGAPDTSARMSSRRRRCSLLLMV
FT                   PAASSVSRRRNSSCQDIANSPERCIARTP"
FT   gene            83756..84421
FT                   /locus_tag="Svir_00810"
FT   CDS_pept        83756..84421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00810"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /note="PFAM: Peptide methionine sulfoxide reductase;
FT                   TIGRFAM: methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95170"
FT                   /db_xref="GOA:C7MRV8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV8"
FT                   /protein_id="ACU95170.1"
FT                   /translation="MVLFGRSKTQLVSADEALPGRAEALATPDLHAVFPDRRIKPPFPE
FT                   GMRTAVFGLGCFWGAERLFWQTPGVYSTAVGYSGGYTPNPTYEEVCTSLTGHAEVVLVV
FT                   FDPQQVSYESLLKVFWEGHDPTQGMRQGNDIGTQYRSAIYYANDEQLKAAESSREAFQK
FT                   ALSAAGYGEITTEIAPLREFYYAEDYHQQYLYKVPHGYCGIGGTGVSCPVGTGVSGSE"
FT   gene            complement(84759..84831)
FT                   /locus_tag="Svir_00820"
FT   tRNA            complement(84759..84831)
FT                   /locus_tag="Svir_00820"
FT                   /product="tRNA-Gly"
FT   gene            85004..86416
FT                   /locus_tag="Svir_00830"
FT   CDS_pept        85004..86416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00830"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95171"
FT                   /db_xref="GOA:C7MRV9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRV9"
FT                   /protein_id="ACU95171.1"
FT                   /translation="MLTDSDSTSDQPGLIERIRLGDDAAFSELFRDHETAVRRLARGLV
FT                   ADASEAEDVTAETFFRVFQAIRRGNGPKENIRAYLLTVARRVTWEWQAARRDVPVTDEE
FT                   LIARLGANTDWLDWQSRTAEAALIVRAFASLPERWRTVLWRTEVEGEQPAVAAPHFGLS
FT                   ANATAALARRARIGLRAAYLQAHLAVDRSRGSCRGVVRKLGSYAAGGVTNSEAHRISGH
FT                   LSGCSSCRSVYDELRRVCSSLRTHASVIVVLVPLSGLALTASSAGLGAAVAASAGGSAT
FT                   AGGVAAGGGAGAVGAVALGGGGKVGLSFVSAAAVAGLVGTPVLDAVESGRVDPPLDVDT
FT                   FVESSSGTDNDDGPSSGTGSDVVRTWELRRSAAVEELAVSESDPLESTSVPLEVAEYTL
FT                   PAESVGVESPVVAIPPSSVVADTGRSEPSDPVPPESPRSSEPGEARDDRCDTRCAEPGV
FT                   EPDAGGPTNVDA"
FT   gene            86615..87055
FT                   /locus_tag="Svir_00840"
FT   CDS_pept        86615..87055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95172"
FT                   /db_xref="GOA:C7MRW0"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRW0"
FT                   /protein_id="ACU95172.1"
FT                   /translation="MNRFAQGSDGRDWVIRAHMEWRRPATAEDFEHDVAANRAPGIAMM
FT                   CVAIGLALVLLVWMPEDVVIPTWVPLALLLVALFFPLRWVLRRPWTVVAETEGDESGER
FT                   PSERWVGTVVGMFNVRGEVQRIAKSIQKHDLPDFDGPLRPVE"
FT   gene            87417..88703
FT                   /locus_tag="Svir_00850"
FT   CDS_pept        87417..88703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00850"
FT                   /product="putative regulator of cell autolysis"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95173"
FT                   /db_xref="GOA:C7MRW1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRW1"
FT                   /protein_id="ACU95173.1"
FT                   /translation="MDAVASVLTTQTVVAFCLGACLVGLVTVFVVAIRRRNPGGAVDEA
FT                   VLDAVRLMADSPLELRRGLNQDAADKITSRLLKLLRCVAVGVTARDGTLLSWDGEANDH
FT                   YVDLVDPISMAIRKKRHEVVSHNKLPCNHRGTCRMRTAVIVPLIIEDETEAVLIVVGRT
FT                   RGRHIVTMAEAVSKFVRTQLVAARLEEARHELQQAEIKALRAQISPHFVYNALNTVSSL
FT                   IRTDPEEARELLQDFADFTRYCFRAEGTYTTLSDELRNIDRYLTIEGARYGSRLNVRLK
FT                   IAPEVQSVVVPFLLIQPLVENAVKHGISKKPGGGTVTVVAQDLGSEAEISVEDDGVGMD
FT                   PALLENMRDSRSSAHIGLTGINRRMHQVYRDQYSLMVETAPGAGMKVTMRVPKFLRAVR
FT                   PDMPGYPFEESTPPRRGSAQSRSSAALGS"
FT   gene            88782..89684
FT                   /locus_tag="Svir_00860"
FT   CDS_pept        88782..89684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00860"
FT                   /product="ClpP class periplasmic serine protease"
FT                   /note="PFAM: Peptidase family S49; TIGRFAM: signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95174"
FT                   /db_xref="GOA:C7MRW2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7MRW2"
FT                   /protein_id="ACU95174.1"
FT                   /translation="MSQAGLAVGFERDHRKYAGSMSRKDTLVSRLPVLGDRAERKDVVS
FT                   VVKLHGVITPQASPLAARGVINLASVESALKRAFGHERLKAVALQINSPGGAPTQSGLV
FT                   AERIRQLADDKGVPVIAFAEDVAASGGYWLACAADEIYAHRTSLVGSIGVVTNSFGFAR
FT                   LLERFGIERRLYTSGEAKSRLDPFSPEKPEDVEWLNKLHTQLHDLFVEWVKQRRGSRLA
FT                   ESEELFNGDVWLGPKALELGLVDGLGNLRDIVKQRYPEAEIVVAEPKKPLLAKLGVGSP
FT                   AAAVLDAVHHRSLWSRFGL"
FT   gene            89780..90598
FT                   /locus_tag="Svir_00870"
FT   CDS_pept        89780..90598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00870"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="PFAM: LytTr DNA-binding domain; Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95175"
FT                   /db_xref="GOA:C7MS62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS62"
FT                   /protein_id="ACU95175.1"
FT                   /translation="MSAPYDTPKLLVLAVDDEPPGLAQLRHCLEANPNIGEVLPAVDAS
FT                   EALRLLGSNDERIRVRKQRGLPPVDAVFADINMPGLSGMEMSRVIASFNPAPVLVFVTG
FT                   HATEAVEAFDLGAVDYVLKPARQERIDKAVSRVLEKIEAVSGRRRPAEPARGRDDDEVI
FT                   PVELAGTTKLIPRSSVRWVEAQGDYARLFTTEGSHLVRIPLAQLEERWAKAGFVRIHRS
FT                   YLVSLPLVTELRMGQGGYQVVIGNEEKVLPVSRRHTRELKDKLVGSSRMG"
FT   gene            90605..91105
FT                   /locus_tag="Svir_00880"
FT   CDS_pept        90605..91105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95176"
FT                   /db_xref="GOA:C7MS63"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS63"
FT                   /protein_id="ACU95176.1"
FT                   /translation="MTDDDYGSVRGIRQPDPTLGKRLRSVDPERPTVALSTGTTSQADG
FT                   PAKPQRKRVVLAEPRRRSSASMRARIELAEQTSWGKLLVKDLVKVQLRAGLLLFGLVVA
FT                   VLGALPLLFHHVPEVTTWRVIGLPLPWILLGIVPFPLLFGIGLWYNRLAERHERDFVAM
FT                   IEN"
FT   gene            91139..92878
FT                   /locus_tag="Svir_00890"
FT   CDS_pept        91139..92878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00890"
FT                   /product="predicted symporter"
FT                   /note="PFAM: Sodium:solute symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95177"
FT                   /db_xref="GOA:C7MS64"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS64"
FT                   /protein_id="ACU95177.1"
FT                   /translation="MQLNPWALAGIALVAAATLYLGYRTSQSARSTDDFLVARRMVRSR
FT                   RNASAISGEYICAASFLGVSGLVLKDGADALWFPVGFTAGFLALMIFVAAPLRRSGAYA
FT                   IPDFLEARLGSTVVRSTSTCFVAVLGLIYLVPQLQGVALTLESIVPGIEGWWGSVVVVT
FT                   FIAADVMRRRMRSATLVQAFQHWIKLFALAIPTFLLCAVFLGSGGQGSAGGLGAEAPPE
FT                   FTEETTVTVGTDVVLRVDEPTAVHELDKESLEPTVWLPGVDYPVREGQRLLFPAGSLVP
FT                   MVNDAELDNAGWLRPTEDTDELWWTYSLMTAMFLGTMGLPHVLARFYTNPDGRAARRTT
FT                   VQVLLLLGVFYLFPVLLGALSRLYVPELLVTGDTDAAVLEVPTAMLPGVAGQMVVAVLA
FT                   AGAFAAFVSASSGLLVSVAGTIATDLLWNKTRDFRIAVFGVAGLAATAAVVLPYDDLGH
FT                   TVGLAFALAASTFCPVLLLGIWWRKLTWVGALLGMLVGGLGVLTAVGCYVVYRVNGETA
FT                   PWFVLQPALFTVPAALFTTMIVSLATARRVPEDAGVVMLQLHAPDRLGFMRDRRGGGPV
FT                   AKR"
FT   gene            92952..93308
FT                   /locus_tag="Svir_00900"
FT   CDS_pept        92952..93308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00900"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95178"
FT                   /db_xref="GOA:C7MS65"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS65"
FT                   /protein_id="ACU95178.1"
FT                   /translation="MNHSADVPTVSVDDLPSGEEYVLLDVREQDEWAAGHAPSAVHIPL
FT                   GDLPSRAAELTELADDRPVYVVCRTGGRSARATAWLNAAGVVDAVNVAGGMKSWVTSGR
FT                   PLVGENDGVAAEVL"
FT   gene            93369..94313
FT                   /locus_tag="Svir_00910"
FT   CDS_pept        93369..94313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95179"
FT                   /db_xref="GOA:C7MS66"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS66"
FT                   /protein_id="ACU95179.1"
FT                   /translation="MAPGWSPGPGQRDGDFRTAVRWVATVPDSARPRRSRERVRSRGTY
FT                   QGPPAYDVPPRWGFPQVVWRWPTAVPGTSTATPVASQRLLLIARNAVAVLWALAGLAAV
FT                   AGGAEVWRYVLLVLSRDTALDPAVVGASDALVLSFSLLTFVMSVFAFAVSLWWLFVART
FT                   AAADEAGQRPPRRSWEVLLGVLVPGLNLAMAGSILAELEHAATRQPANRRPKPSRLVLG
FT                   WWAAWIGNGVLLALTVLWRLRSGVQAQVDAVFLAALTDLSAVALALLTAEVIRRFTQLL
FT                   APMEERLVRPLRVVEVKGAPELPRRARPKTAAR"
FT   gene            94392..94718
FT                   /locus_tag="Svir_00920"
FT   CDS_pept        94392..94718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00920"
FT                   /product="uncharacterized protein involved in tolerance to
FT                   divalent cations"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95180"
FT                   /db_xref="GOA:C7MS67"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS67"
FT                   /protein_id="ACU95180.1"
FT                   /translation="MVSKHLLVSTTTDSEAAARELAAKAVEARLGACAQIVGPITSVYR
FT                   WEGSVHTDPEWRVEIKTAADRVDALVEHIKQHHTYDVPEIITTPIVGGSADYLSWVEEE
FT                   TRPA"
FT   gene            94812..95690
FT                   /locus_tag="Svir_00930"
FT   CDS_pept        94812..95690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95181"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS68"
FT                   /protein_id="ACU95181.1"
FT                   /translation="MGKGARKKGSGKGGKRKIRDVFVTRPFEGLAAEPELIALREFVPS
FT                   ATAPLSVKDAGDRTVTLASVLPVAAAAMVRADSGEILIGMQVQTRSSDISRDLGRALRW
FT                   ALDAEPGQVLSVPDTTSEPQPGERLQDLLDPDAELNVELHSDFSWWLGEGVEPTGEVAM
FT                   SLERANAAILPTEKVRPGAYWTLTGEKAHLRWVWPTEEDTLLKGLARLSAAGELSLGEG
FT                   SRYAGSFRAHGLLVPVWDLDPEAHAREWNDPAEQFAERLGKALESLENEPLDAEERRAR
FT                   DGLVGRQLTLR"
FT   gene            95709..96062
FT                   /locus_tag="Svir_00940"
FT   CDS_pept        95709..96062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00940"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF952)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95182"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS69"
FT                   /protein_id="ACU95182.1"
FT                   /translation="MILHFCPAADWEAAADSGTYRAASLDDVGFIHCSDPGTVHLPANA
FT                   LCAGRTDLVLLWIDPRLLDVPVRWEPGDASAPEGPWFPHVYGPVPTSAVVAVHPFPPDV
FT                   DGRFRPVTSRPIR"
FT   gene            96185..96778
FT                   /locus_tag="Svir_00950"
FT   CDS_pept        96185..96778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00950"
FT                   /product="RNA polymerase sigma factor, sigma-70 family/RNA
FT                   polymerase sigma-70 factor, sigma-E family"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family; RNA
FT                   polymerase sigma-70 factor, sigma-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95183"
FT                   /db_xref="GOA:C7MS70"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS70"
FT                   /protein_id="ACU95183.1"
FT                   /translation="MTAFVPTVCTAPHDDAWAGATGHRKEAVVPGDLTDFAEFVQSSLP
FT                   GLLRYGHALTGNPHDAADLVQSVLEKVGSRWASIQRKTADPLPYVRRSMANAHISRWRR
FT                   FRRENLVADIPEPGSVEPTDPFEHEPLWQALRELPPKQRAVIVLRYYEGLSEAEIAASL
FT                   GISPGTVKSQASKALTSLRGKLRRDASSEGRETV"
FT   gene            96775..97611
FT                   /locus_tag="Svir_00960"
FT   CDS_pept        96775..97611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95184"
FT                   /db_xref="GOA:C7MS71"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS71"
FT                   /protein_id="ACU95184.1"
FT                   /translation="MSASGRDVDDDELDARLRALFADPRLDVASLPRTEEIVAGARRLR
FT                   RRRAMLTGGGGALVAVAVAMVGLMVLGPRLTGGGDGEPVAVSPAEQEAESEAMLTAPPR
FT                   SLHTNPQSLPELPDPKVTDPNSTMSSLETSPEASTPPESGSVTMTQAVLDATGYKRLEL
FT                   GMPFQEAVKTELLMVADGPPPPEKCVDYPLVEGDAVVKNVTVSAEHGVVAFTAVNAVTP
FT                   DGVGVGSPVADVEERYPSGEGDERAFNVDVGTGRYEFTISNGTVSELRLVAHTYDC"
FT   gene            complement(97714..98262)
FT                   /locus_tag="Svir_00970"
FT   CDS_pept        complement(97714..98262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00970"
FT                   /product="ferritin-like protein"
FT                   /note="PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95185"
FT                   /db_xref="GOA:C7MS72"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS72"
FT                   /protein_id="ACU95185.1"
FT                   /translation="MSDPEKKPLSKFYELLQAQIRKEFHASQQYVALAVWFDGKDLPQL
FT                   AKYFYRQSLEERNHAMALVQYLLDTDHPVEIPDVPPVRNDFTEVREPVALALEQEKEVE
FT                   ADFRQLAKAAREEDDYTGEQFVQWFLAEQVEEISSMKRLLNVVDMAQGNVFEVEQFLYR
FT                   ESAGEEDDSTMPPVAGGKL"
FT   gene            complement(98394..99650)
FT                   /locus_tag="Svir_00980"
FT   CDS_pept        complement(98394..99650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00980"
FT                   /product="arginine deiminase"
FT                   /note="PFAM: Amidinotransferase; TIGRFAM: arginine
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95186"
FT                   /db_xref="GOA:C7MS73"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS73"
FT                   /protein_id="ACU95186.1"
FT                   /translation="MTESTSTSSSRFSERLIPHVDNEVGPLRTVLLHRPGNELRRLTPR
FT                   NNDQLLFDSIPWPDRAQEEHDAFAEVLRQRGVEVLLLADTLRATLEDPRAHAAGVHTAV
FT                   DSRRLGNDLADVLRSHLSSVDPATLSDVLMAGMTFEELPASEGGSLVRRMHHPHDFAVD
FT                   PLPNLLFTRDSSVWIRDRVAISSLAMPARRRETALVDLVYAYHPRFQGAVRAYGAHSAP
FT                   VEGGDVLLLAPGVLAVGVGERTTPAGAESLARSVFADDLVHTVLAVPIAQDRATMHLDT
FT                   VCTMVGPDAVVMYPLARDSLIAYTLTPDDEKGVRVDGPAPFLDAAAAAMGIDRLRVIDT
FT                   GLDPVTAEREQWDDGNNTLALAPGVVIAYERNTETNARLEDAGIEVIRIAGSEVGSGRG
FT                   GPRCMSCPIIRETVSPTEG"
FT   gene            complement(99794..100036)
FT                   /locus_tag="Svir_00990"
FT   CDS_pept        complement(99794..100036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95187"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS74"
FT                   /protein_id="ACU95187.1"
FT                   /translation="MACTIINRLNDQRIRFSSRDAAERYAEIMGGGVHNWVFTTEPSTE
FT                   EDERGTESPKASHTHAPENTYRKPLTVPLHPLHRR"
FT   gene            complement(100112..100837)
FT                   /locus_tag="Svir_01000"
FT   CDS_pept        complement(100112..100837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01000"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95188"
FT                   /db_xref="GOA:C7MS75"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS75"
FT                   /protein_id="ACU95188.1"
FT                   /translation="MVEVVLVFSITLGLSAARSALSLLDALLRPEPLAQQRVSVNVPQA
FT                   ALSVIDLLKQLLGVVQLVGWGALGLYLLWRTGVRLSRIGLDTRRPGRDTAWAIALAAGI
FT                   GVPGLVFYFTAWHLGFNLAVQPSTLDESWWRPIALVLSAFGNAFAEEVLVVGYLLTRLR
FT                   QLGLPENTSLLISSLIRGSYHLYQGLGAFIGNAVMGLVYGRVWQRTNRLWPLVVAHLLL
FT                   DVVAFVGYAALRDHVTWLP"
FT   gene            101074..102795
FT                   /locus_tag="Svir_01010"
FT   CDS_pept        101074..102795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01010"
FT                   /product="choline/carnitine/betaine transport"
FT                   /note="PFAM: BCCT family transporter; TIGRFAM:
FT                   choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95189"
FT                   /db_xref="GOA:C7MS76"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS76"
FT                   /protein_id="ACU95189.1"
FT                   /translation="MTATSDTEAVKPPSAASRRPWYSTIAPRVFFPAAVIILVFVAAAV
FT                   IAPDAMSNVIGTIQEQVVSSFSWYYMLIVSGFVLFSLWIGLSHYGDIKLGPDEEEPEFG
FT                   LKVWFSMLFAAGMGIGLVFWGVAEPLNHYAGIPNRATGITQDESGAQDALVQTFLHWGL
FT                   HPWAIYVVVGVAIAYAVHRKKRPVSIRYALESLIGKRVNGWLGDAIDIAAVVGTLFGVA
FT                   TSLGLGVLQIGAGLDFLDIVSDPGNLTYVVLIGVISLLAIISVVTGVKRGIKWLSNINM
FT                   GLAGLMMLIVLAFGPTLFIFKDLVQSIGAYLQNLVAMSFNTTAYEGEDGNAWQGFWTAF
FT                   YWGWWISWAPFVGVFIARISRGRTVREFVAGVLLVPTAVTMLWFTVFGGTALYRELFGE
FT                   GGLVGTDADGNPTVDTEASLFAVLEALPGGAVLCVGAVILIVLFFVTSSDSGSLVVTML
FT                   SSGGDPEPPKWHRVFWGVLEGAVAVALLFAGGLSALQTVAILIALPFSVVMLGMCASII
FT                   RDFRAERAAMLRAQRKLQREQLTEHVTNSLIDEGLVDPNGANGSGDVERGGATVSP"
FT   gene            complement(102857..103654)
FT                   /locus_tag="Svir_01020"
FT   CDS_pept        complement(102857..103654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95190"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS77"
FT                   /protein_id="ACU95190.1"
FT                   /translation="MSEPVPRRPPTPRPAERAKSIAVRGGPASLLPALGHRTQSDRTTP
FT                   VLWHLHAGDDLSVVLPTDDPLAAGVQGNATAELAVTLEIIDEAPVPLRQPVRGLLWLTG
FT                   WLRGLDDRTARARALTIADSVTEPDPRLLDLGHGLSMLRFTPASVVLSDSEGTHSLSPV
FT                   TFDAAVADPLCEYEGRWLQHLEHKHTDVVEQLSRHLPEELCGGRIRPLGVDRCGIRLRV
FT                   ETADDDHDVRLAFSRPVENPPQLAVELRKLVGCPFLNRFDERS"
FT   gene            103796..104650
FT                   /locus_tag="Svir_01030"
FT   CDS_pept        103796..104650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95191"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS78"
FT                   /protein_id="ACU95191.1"
FT                   /translation="MELPPPGPRGIPTLLARLVDDSALFPPGEAAMPDALASYLEHRSG
FT                   EYAGVQGVFLCPASRLAEMITELIKIRPKEPLPLSLIIDTGLGGVPKAISIVESREELL
FT                   SLRMVEMPAPSDVDEVWLERVSEFVPEDVIRVVEPRRGVGWLDGVRKVIEHGSWPKIRC
FT                   GGVSSENFPSVDEVADFFAVVSSTPGASFKATNSLHRAVRHTDPETGFEHHGFLNMLVA
FT                   AGRSLSGGDVREALASTDGEQLAEEVKQLSEEAAKAVRSLFACYASGTFHESISDLQGL
FT                   GLL"
FT   gene            104647..105279
FT                   /locus_tag="Svir_01040"
FT   CDS_pept        104647..105279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01040"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: IclR helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95192"
FT                   /db_xref="GOA:C7MS79"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS79"
FT                   /protein_id="ACU95192.1"
FT                   /translation="MTRESSLTLDRGLALLQAVADAGEASATVTDLAAAIGTSRAAVYR
FT                   LLVPLAERGLVWRDGSRVRLGSGVLRLAEQMLPQLRAAARPVLRDLADTVGATAHLSVV
FT                   EGDQVHVVAVAEPLRTTFHVAYRLGSRHPVSRGAVGKALALRPRGKGWAAVTGDPQPGI
FT                   YGVAAPVRGVVGVRAALGVVSFTALDNSVVGPRLVEAANTLVETLRA"
FT   gene            complement(105316..105915)
FT                   /locus_tag="Svir_01050"
FT   CDS_pept        complement(105316..105915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01050"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Uncharacterized protein family UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95193"
FT                   /db_xref="GOA:C7MS80"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS80"
FT                   /protein_id="ACU95193.1"
FT                   /translation="MSAALLAFVTTFALVTAVELPDKTFVATLVLTTRFRHDAVLVGAV
FT                   AAFVGQALIAVGFGSALTFLPDQLVSVIVGALFGLGAAMLLREGFRTGEDSAHDAARGG
FT                   APATFRRASLTSFGVLFAAEWGDASQLATAGLVARSAQPFAVGLGALTALITVATVAVL
FT                   LGRKIRSRLRPRLLQRVAGFVFAGLSALAFGNALLG"
FT   gene            106161..107651
FT                   /locus_tag="Svir_01060"
FT   CDS_pept        106161..107651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01060"
FT                   /product="cytochrome bd-type quinol oxidase, subunit 1"
FT                   /note="PFAM: Bacterial Cytochrome Ubiquinol Oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95194"
FT                   /db_xref="GOA:C7MS81"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS81"
FT                   /protein_id="ACU95194.1"
FT                   /translation="MEVLDLARWQFGITTVYHFLMVPLTIGLSVLVAGMQTAWVRTGDV
FT                   RYYRMTRFWGKLLLVNFAMGVVTGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEGLVAFF
FT                   VESTFLGLWIFGWDRLPKRVHLACAWAFSLATVASAYFILAANSWMQHPVGAEFVDGRP
FT                   TMTSIWAVLTNSTALAAIPHTVAGSFAVAAAFLVGIAAWHLWRKRHTEDEHRPVWRSSV
FT                   KLGAWVGAVSFAVLLVTGDIQGKLMFEQQPMKMAAAEALCHTEQPGSFSIIAVGDVADA
FT                   DCESVKTFNVPALLSFLAHGDFETEVKGVDDLVVEYQERYGTHYPDDPALGELAGKPID
FT                   YVPSLPVTYWGFRIMIGFGALGAAIGMVTLWLTRRGRIPDSKWFPRMALAGIALPFIAN
FT                   SAGWIFTEMGRQPFVVVPNPSGVDGVWMFTATAVSDLTAGEVWTSLIALTLVYAVLAAV
FT                   EVFLIARYVRGGVEGVLPDGAEPGGDDDSDDDALAFAY"
FT   gene            107801..108811
FT                   /locus_tag="Svir_01070"
FT   CDS_pept        107801..108811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01070"
FT                   /product="cytochrome d oxidase cyd, subunit II"
FT                   /note="PFAM: Cytochrome oxidase subunit II; TIGRFAM:
FT                   cytochrome d oxidase, subunit II (cydB)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95195"
FT                   /db_xref="GOA:C7MS82"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS82"
FT                   /protein_id="ACU95195.1"
FT                   /translation="MDLPTLWFCIVALFWLGYLFLEGFDFGVGMLLPVLGRDDTERRVM
FT                   INTIGPVWDGNEVWLIVAAGATFAAFPAWYAGLFSAAYLPLLILLLALIGRGVAFEYRG
FT                   KVDSARWRATWDRVIILGSWIPPLAVGLILATTVFGLPLDEGGNRVGSVLEAVRWETVL
FT                   GGVAVAAFSLVHGAAFLALKTEGELRYRARAFALRFAPVALLPLLGLLLLVQWRDGLTW
FT                   TLLPLLIVPLAGLVAIGRLAAGREGQAFTALGVVIAMAVVTLFGALYPEVLPSTLDSAN
FT                   SLTVENASSSSYTLQVMSWLALFGAPAVLVYQGWTYWVFRKRIGTRHIPKVHTPR"
FT   gene            108808..112146
FT                   /locus_tag="Svir_01080"
FT   CDS_pept        108808..112146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01080"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter; TIGRFAM: ABC transporter, CydDC cysteine
FT                   exporter (CydDC-E) family, permease/ATP-binding protein
FT                   CydC; ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95196"
FT                   /db_xref="GOA:C7MS83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS83"
FT                   /protein_id="ACU95196.1"
FT                   /translation="MNVPTHTPLSANKVSSDRQSEPDTSSWVGRGPLGALPSLSSAARR
FT                   ALALTAVLSVANAGALVAQAFLLAHVLADIVAGETTGHAPVVAALVGAVLARGVLGWAM
FT                   RAVAARAAAGAKEELRAKTVDHALRLGPEWIDERGAGELTALTTRGLDALDAYFTEYLP
FT                   ALVTAAVVPVAAGAAVLFVDWPSAVLIAITLPLLPLFAILIGKNTADRVARATDAVHRL
FT                   SGHLLELLRALPVLTAFRRAEAQAEAVRRVSDRHRTTTLSTLRLAFASAFALELAATLS
FT                   VALVAVVIGVRLVSGDLSLAVGLGVLILAPECYQPLRTVGSAFHASEDGVEAVRRVTDI
FT                   LAVPPPREGTRVPTRGEVRVRDLRVRRRNGFAPDGETFTVAPGRRVWLSGRSGTGKTTT
FT                   LSVLLGFVTPHSGSVTVAGVPLDEIDMSRWREAVAWVPQSPAFTGGTVRAELGLTGASA
FT                   AEVDAVLRRLDLDGLAERPVHRLSVGQRQRVAVARALLRVRQGAWLLLLDEPTAHLDAA
FT                   NAERVWQAVQEAQDAGAAVVVAAHPRREATPSEGNARSEAASEVGSGRTDRHVRPVPLR
FT                   ELGERRLIRGVVLGAAALLAGVALTATSAWLIAKASQQPPILTLTVAVVGVRTFGLARA
FT                   GLRYVERLVTHDGAFRVAARLRERLWRAMVRLGPARVLGASRDEGLRRLVDDVDTVRDL
FT                   LPRAVTPPFVAAAVVFGGCVVQTVVLPRAGWVLVGASVVAALVAPTLAVLLDRHATATL
FT                   AEGRRDVAARVLSLFDGAAELLAFGAHARHRARLADSDARLAAVARRQAWGEGAAEAVV
FT                   IVATGLAAVTGVVFAADAVGAGTLDPVLAPVPALVPLALAEALSLLPPAAQHWDALRRA
FT                   RTRLAATLDVESVPDRPEGAVELTPGGGVRLRAVDVRWPGGARPTLRDVDLDIPEGAYV
FT                   AVVGPSGSGKSSLLATLLGFLRPERGCAVVPERVAWAPQEPQLVSTTVAENLRLADPHA
FT                   DLARLEWALRTAGIAELDVDTVLGDAGSGLSGGQAHRVALARAVLAAQDADLVLLDEPT
FT                   AHLDESTARTVLANLREALAGRTVVHVTHRPEEAADADLIVQVRDGRVRVLGDMREPTR
FT                   AGERA"
FT   gene            112152..113309
FT                   /locus_tag="Svir_01090"
FT   CDS_pept        112152..113309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01090"
FT                   /product="histidine kinase with GAF domain protein"
FT                   /note="PFAM: Histidine kinase; GAF domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95197"
FT                   /db_xref="GOA:C7MS84"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS84"
FT                   /protein_id="ACU95197.1"
FT                   /translation="MLLMEPTLAARALAAATEITASALSDTEPDDVLGTVVRHAAELAD
FT                   ADLGLVMVRTDDGDVTVEAAHGAADRDVLGLVLPPESAAGQVAAGGETVVTDDVTDDPR
FT                   TSRFVPEVLRSYGPFAAAAFGQGGRLLGALTVYRDKGAEPFSPETVEMLTAFAGQAGVV
FT                   LALAEGANARHRITLYEERERIARELHDVIVQRLYAAGMQLDRVRRRMRWRFAKADSER
FT                   LGEAIDQLDATIQEIRGTVRELRSTEVEPRQLSATRTDLAESARGEVRTAGELLGYPPT
FT                   LELSGELADIPAERADHIRAALREALSNVVRHSGASEVRVTLRRDDGGLRLRVRDNGCG
FT                   VPRDVEKRGLRHLAERAKGAGGTFTINSSPSMGTMVAFDLPLDEE"
FT   gene            complement(113331..113975)
FT                   /locus_tag="Svir_01100"
FT   CDS_pept        complement(113331..113975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01100"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95198"
FT                   /db_xref="GOA:C7MS85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS85"
FT                   /protein_id="ACU95198.1"
FT                   /translation="MAIEVLLVDDHEVVRRGLRELLSDEPDIEVVAEASSADEALAVAM
FT                   HVEPDVAVVDVRLGENETDGIELCRELRSQPAAPRCLVLTAFDDEEAMVGAIMAGASGY
FT                   LLKQVRGQDVVHAVREVAAGRSLLDPLTTARLLEKVRSPERPDPLDKLSERERSVLELI
FT                   GQGLSNREIAERLFLAEKTVKNYVTSLLSKLGMRRRTQAAAWVARHLEQHE"
FT   gene            complement(114296..115195)
FT                   /locus_tag="Svir_01110"
FT   CDS_pept        complement(114296..115195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01110"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, periplasmic component"
FT                   /note="PFAM: Substrate binding domain of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95199"
FT                   /db_xref="GOA:C7MS86"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS86"
FT                   /protein_id="ACU95199.1"
FT                   /translation="MKRKRFRGLSFIAGLMTAAMALTACGGDSGGGDDGGDKDLTIGYI
FT                   SWDENIALANLFKVQLEQRGYSVELKQLDAGPTFQALSQGDIDLFQDAWLPITHEDYWE
FT                   QHKDKVEDLGTWYTGATLNIAVPAYVDEVDSIADLAEHADMFDGTITGIEPGAGLTRIT
FT                   QDEVIPGYGLDGKLSLQTSSTTAMLTELDSAIKAEEPIVVTLWHPHWAYSRYDLKDLED
FT                   PEGLMGEGEEIHNVGRKGFSEDFPELAEMLKSFTMSDEMLASLEDAIQQAGTGNELQAV
FT                   EEWSEENKEALDEIFGDL"
FT   gene            complement(115232..116128)
FT                   /locus_tag="Svir_01120"
FT   CDS_pept        complement(115232..116128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01120"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95200"
FT                   /db_xref="GOA:C7MS87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS87"
FT                   /protein_id="ACU95200.1"
FT                   /translation="MRDGFLAALNDWHMPRIPVGEWFSDGVDWLKDKLGAVFDAISEGT
FT                   DSIVSGLADVLQWPPSWVMFLVFALLALWLRGWKFALTTLLGFALIDALGAFDSAMQTL
FT                   ALVLLAAVISVILAVPLGVLAARSDTASRIIKPIMDFLQTVPQFVYLIPAVIFFGIGVG
FT                   PGVVATVMFALAPGVRLTELGIRQVDREMVEAGEAFGSPPMKILREIQLPLAMPSIMAG
FT                   VNQIIMLSLSMVVIAGMVGAPGLGAQVFEATTRLQLGVGFEYGLSVVILAIYLDRLTAS
FT                   LSDRSAVSRARRLAGKA"
FT   gene            complement(116121..117338)
FT                   /locus_tag="Svir_01130"
FT   CDS_pept        complement(116121..117338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01130"
FT                   /product="glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /EC_number="3.6.3.32"
FT                   /note="PFAM: ABC transporter; CBS domain pair; TIGRFAM:
FT                   glycine betaine/L-proline transport ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95201"
FT                   /db_xref="GOA:C7MS88"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS88"
FT                   /protein_id="ACU95201.1"
FT                   /translation="MPVVRTENLYKVFGRRARDAVNMLKNGADPSDLDIPGVTAAVIDA
FT                   SFEVGEGEIFVVMGLSGSGKSTLIRMLNGILPATSGQVYVNGEDITTMSPKQIRDMRQR
FT                   TMSMVFQHFALFPHRTVLDNAAYGLRVKGVEKAERLNKAREALELVGLAGWEDHLPEQL
FT                   SGGMRQRVGLARALAADTDILLMDEAFSALDPLIRREMQDQLLSLQSQLGKTIIFITHD
FT                   LNEAMRLGDRIAVMRHGRIAQIGTAEEILTNPADEYVAQFVQDVDRTRVLTAKSVMDRP
FT                   VTTIGVGSGPRAALRTMREHQHSALFVVARDGRLAGVVTDSAAAEAAKRGVNTVQEIVS
FT                   DEFSFVAPETPVSELFTPSAESPVPLAVVDSDQRLLGVIPRATLLAALGEVTSSTDVKP
FT                   GVASDA"
FT   gene            118129..120393
FT                   /locus_tag="Svir_01140"
FT   CDS_pept        118129..120393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95202"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS89"
FT                   /protein_id="ACU95202.1"
FT                   /translation="MTEWRQQAASAVEAELEHARQPEEWSLLGPLRRTDDGDYVVDLRG
FT                   RRIRPLNDVRVAGADGPRQSAAVPVSTVFQRGLLWLRDVGPLPPECDQVWAREITHGEV
FT                   LERLARGLRELGDAPLAERFAQGKLDPAGEDAYSTCFVPGVHLVWGPPGSGKTHVAARA
FT                   AAELARQGKRVLFITADATSADASLTAVDDPERIELQQDLAELSEVEAQLDRLDAELRD
FT                   YDHEEFLAAERRIENGQRATVLEAEFSKVRERHWELARDLSIARERRRLAGRKHDRVAS
FT                   EHARRTEVRVLTQRLTKVEDRLTEIRDRMSGHGLLYRGRKSDRRELRAVEEERRLLVSR
FT                   IEDCRQRVHMVSDDVRKLRAELDEARRRADELERAESDVRTQLELLRDELVRLHASGIA
FT                   DEADHRYYADCVHRNLPQLHAEREALRQRSKHRAALRGRFEERLWWIGEHGHELRCEDE
FT                   AWWWKTEPVVVSTMDTLGPTGRGFDTVLIDDAGSARLCDVLFAVAQARETAVVFGDLAQ
FT                   PWPQVRPKRLEQLPEVQKWILATPFSHCGILTPSDAYAHPGCAVLPHQYRVGPAVQAIA
FT                   DNIGYLALVAAEGRHTDVILLDTAGEPVERAALARLLAEVAEDGGAVLVPTDGQVDEWR
FT                   SVLQDTLTVDVGTVDTVIDHEFGTVVLDLTTDDWCDRVRSFLSGIARARDRLYLLADLE
FT                   AVASAPTGTPLGAVNALRRQGGLQIQRIGEVLIPRQRQQSATDWTVTVINRATSDGTIA
FT                   G"
FT   gene            120390..121562
FT                   /locus_tag="Svir_01150"
FT   CDS_pept        120390..121562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95203"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS90"
FT                   /protein_id="ACU95203.1"
FT                   /translation="MSCRADLRAFLRTLDTETLADLVCEQADRDPDLRRRLVERAVTAG
FT                   FDIGSSDADTSVDGADTADSAQTDTVQLDSVLDTVQRLLDAGTSADVAPLAKRTVERIV
FT                   AAVGRNDGLPAGLADQLDRAVSLYARACAAHPPPPRELAEWLTRLAFECPGWPEPCLAD
FT                   FADALGTEGCAHVRTIVEAALADTGVDGDRRTRVARALRLELAEITGDVDTVVSLLSEQ
FT                   LPRLDVSLRIVRVLRAAGRHAEAIAHAAKALGNATGTVGNQGDGRGPVVEALERVRTQQ
FT                   PPVDISDVERLLRQDRCDEAWKATARHEPSDVIPLYREHVERLIDSRNTRLYECAAGQL
FT                   RRLRMLYRRAGASQEFTAYLTELLGRHRRKTRLLDEIRKARIALPRTVDG"
FT   gene            complement(121798..124476)
FT                   /locus_tag="Svir_01160"
FT   CDS_pept        complement(121798..124476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01160"
FT                   /product="predicted ATPase"
FT                   /note="PFAM: Bacterial transcriptional activator domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95204"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS91"
FT                   /protein_id="ACU95204.1"
FT                   /translation="MLVANAGRSVDVETLIDVAWEPHELPSNPFDSLNTRITRLRTLLA
FT                   PQADVSWCAGGCVLTVDAERADAVLFERMVEEAHWCSDREAITVLDRALRLWRGDPLPD
FT                   LRRNGLEHPEGVRLRQLRARAVEDLAVRELRIGAVEDAASRLLALLSAEPLRERACGYA
FT                   MWALHRLGMTADAVTCYDQLVERLEDELGEGPSTELRQTYRAVTGREPTPSDRPTDRIP
FT                   LVGRGHELARLSTMLDRERMVTVTGPAGCGKTRLVSAALSTTDVPVTLIPLSTCDDFGL
FT                   YEKVAAAVGLHSRGPDEGTDDLPMVLTEYLRGRRHILVFDGCEHLLTSVRALVRRIRAR
FT                   CPDVTVVATNRVRLGLAGERVLPLGSLARDGVRDPLLSRAGKLFLDRAHRVRPEFPSTD
FT                   DEAHLARDLLRRADGLPLTVELLAARATGNDPALPRPWPSDLVEWSYERLSGSRRELLG
FT                   AFTVFDGDVDPSAIESVVDTDGDASDALTELVRTGLLTTVDTETGTRYRTPDLVRRIVT
FT                   RRFAGTDSERKIRQRHALWCADLITDAVASNDDPSAFDLLCRMEDEVCSALRWAMSEEP
FT                   GLAADLSGQIGLLTAYRPRARLLPWQLRVARDPDPRLAQHAPATASGADAALRCGLSEE
FT                   GLRLAARAAELATTAQHRCSAVRALICGYHDLGDDDRTAEMCHELLDSVDVPDSGNADA
FT                   HAFLALLAARGGRPREALRHAETAARYARASGSDPRIALATYAEGRARALTDLEEGAAV
FT                   LARARSQAKSAHATWIAASAGTALADTLLTLGRVPEAAKLLQYAVDEWHRMRAPRQLRA
FT                   SVELGTRCLASTGDRATAEALTHELIGRSAPKELVVARAARTLVAALADVFGTERIHHP
FT                   RHTPTHTAGRSVERPIPVGLL"
FT   gene            complement(124651..125583)
FT                   /locus_tag="Svir_01170"
FT   CDS_pept        complement(124651..125583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01170"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: pantothenate kinase, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95205"
FT                   /db_xref="GOA:C7MS92"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS92"
FT                   /protein_id="ACU95205.1"
FT                   /translation="MPRVRERSPYVELQRDQWRQLRRSTPLPLTAEELNRLRGLGEQID
FT                   LNEVAEVYLPLSRLINLQVAARQRLYEATTTFLGEDTRGTKVPFIIGIAGSVAVGKSTT
FT                   ARILRTLLARWPDHPKVDLVTTDGFLYPREELVRRGLMHRKGFPESYDRRALLRFVTEV
FT                   KSGAEEVRAPVYSHLAYDILPGEEQVVRRPDILILEGLNVLQPGPRLTVSDLFDFSIYV
FT                   DAHTADIERWYIERFLKLRHTAFSDPASHFHHYANLPDDEARAEARHLWKTINEPNLVE
FT                   NIRPTRPRATLVLRKDSDHSINWVRLRKL"
FT   gene            complement(125701..126267)
FT                   /locus_tag="Svir_01180"
FT   CDS_pept        complement(125701..126267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01180"
FT                   /product="predicted phosphatase, C-terminal domain of
FT                   histone macro H2A1 like protein"
FT                   /note="PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95206"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS93"
FT                   /protein_id="ACU95206.1"
FT                   /translation="MLCALDESLAQAWHTVADAVGDPVRVHRGSVLDIAAQAVVSPANS
FT                   YGWMRGGIDAVYAQAFPGIEQQVRSIILAYHGGELPIGEAVVVPTGEAVPEWLISAPTM
FT                   REPGERLPDDTVHPYLAAKAVFLLWRDGQFEHGTRFRDIVKTIAMPGLGTGVGGVSPAT
FT                   CARQVAAAWEEVFPKDRQDRRPAES"
FT   gene            126467..127372
FT                   /locus_tag="Svir_01190"
FT   CDS_pept        126467..127372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01190"
FT                   /product="prephenate dehydratase"
FT                   /note="PFAM: Prephenate dehydratase; ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95207"
FT                   /db_xref="GOA:C7MS94"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS94"
FT                   /protein_id="ACU95207.1"
FT                   /translation="MSRIAYFGPVGTFSEQAARMFAQGENLVPVETIPAALSAVREGEA
FT                   ESACVPVENSVEGPVTATLDGLAEGSPLVAVAEVLLPVHFTVLVRPDVDTIRTVASHPH
FT                   ALAQVRHWLERNLPDAETVVASSTAAAAVGVCDGEYDAAVTAPAAAETYPLKVFAEGVA
FT                   DVPDARTRFLLLSPPGSLPEPTGADRTSIVAAAANRTGSLAELLTELALRDINLTRLDA
FT                   RPVKGNFGVYRFFLDFEGHIAEERVGDALAALRRRCEVRFLGSYPRADGARPVERDTAA
FT                   EERFVSAARWVQAVRNGELA"
FT   gene            complement(127350..128585)
FT                   /locus_tag="Svir_01200"
FT   CDS_pept        complement(127350..128585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01200"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95208"
FT                   /db_xref="GOA:C7MS95"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS95"
FT                   /protein_id="ACU95208.1"
FT                   /translation="MSAEPDRRLNWLLGSNAFANLGDGIAKTAFPLLAATVTRDPLLIA
FT                   GLSAAQFLPWLLFGLLAGAMLDRVDRRKAVVLANTARAVAVGVTGVLVYFDAANIWLVY
FT                   ATALAVGIAEVVADSAANVLIPSVVERSGLSSANSKLQATEIVGQTFLGGPVGSLTFAL
FT                   FAAFPFLLDSVAFALGAALLAAMSGNYRPRRKEAPGDTASVAATVRTDIAEGLRWLRHN
FT                   PLLLRLVVIAGLVSLVSELAQAQLVLYALQDLDLSNAAYGAFAFAGGIGGLVGAAVAAR
FT                   LIDRFGGRLTLVSGTVGCGVTFLAMGLVSQPVVSGVLFGLFAAAIVVVNVILATARHTL
FT                   VPEELLGRVLGVWRTVVWGALPVGALLGGVTTRLLGTPSATFALSGVLLLGVAGVAWFA
FT                   VRHHEVTPAHRS"
FT   gene            complement(128697..129047)
FT                   /locus_tag="Svir_01210"
FT   CDS_pept        complement(128697..129047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01210"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF1025)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95209"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS96"
FT                   /protein_id="ACU95209.1"
FT                   /translation="MPVNMTRQRFEELVADALDQLPPEFAAAMDNVVIFVEDRNEEEPD
FT                   LLGLYHGVALTERGHDYGGVLPDRISIYREPILEICDSEDEVVDEVLITVVHEVAHHFG
FT                   IDDARLHELGWG"
FT   gene            complement(129053..130195)
FT                   /locus_tag="Svir_01220"
FT   CDS_pept        complement(129053..130195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95210"
FT                   /db_xref="GOA:C7MS97"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS97"
FT                   /protein_id="ACU95210.1"
FT                   /translation="MSDQPDRSPINSALRTRVLMGGAFFGALAAMALSWTFSWVPETPE
FT                   MVLQRQAEEKAEQIAKAREEAFRAPPGSCLNWTDPEASDVHRVSCDEEHFFEVVGLADL
FT                   PPEYGPDAPLPDDETWHELTEQHCVELAEDYLDKPLDPEGKLTIGILRPDERQWSQGER
FT                   TLHCGLQWVGPGGGLQVLTEPAKEIDQSNVWEPGTCLGLVDKSVGDPVPCDEQHSYEIV
FT                   AVVDLSDEFDSYPSREEQSEWLDPTCAELVEEYTGGKKVEDLSEEGLILGWDTRSKESW
FT                   KAGSTLVNCKVGAVLEDDTGLAPVQGSVKDSEDDKDDEDGKGDEDGQDKDDSTKDGKDG
FT                   AEGGGDGSENDSGGGRDGQEDAAGPSGQAPAPSGAPGSGD"
FT   gene            130282..130869
FT                   /locus_tag="Svir_01230"
FT   CDS_pept        130282..130869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01230"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95211"
FT                   /db_xref="GOA:C7MS98"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS98"
FT                   /protein_id="ACU95211.1"
FT                   /translation="MTENNENDEDRPVRGSMRFQDPATATPREPTLAEKRARLKAMEEQ
FT                   RQREEEARRAQLEAEAKAETRRKVLAGGGVTVGLVGLVAAWYVVAAPEDVTAVCTTADG
FT                   TIVDDDYCDDDYVRSHGGYHGSGGWVFLPSPGGGYDQYRYNYGGSGTVGQRVAGGTYVR
FT                   PSNAEIKTNSGKTIQRGGFGISGGSFGKGGGS"
FT   gene            130870..132036
FT                   /locus_tag="Svir_01240"
FT   CDS_pept        130870..132036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01240"
FT                   /product="glutathionylspermidine synthase"
FT                   /note="PFAM: Glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95212"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7MS99"
FT                   /protein_id="ACU95212.1"
FT                   /translation="MHRETGTPRADWERIVAEQGLVFGTPARYASGEPRPYWDESVHYV
FT                   LQMDEVLSVEADVELLHSMCLEAVDHVVTTERYAEFGLPEWVWPHIAESWRRGDPHLYG
FT                   RFDLRYDGRRPAKLLEYNADTPTSLLEAAILQWYWKTDVHPDDDQWNSLHEQLVDRWRE
FT                   IGKKLPSNEVYFTWSTADSTGEDHLTVTYLQETAAEAGLDTVALAIEEIGWDPLLKRFV
FT                   DLEEAPMGTVMKLYPWEWMIDEEFGRYALESLPQTLWIEPLWKMLLSNKAILGILWENY
FT                   PGHPNLLPAFNDQPGLLTEYVRKPKLGREGANVRIVAPGYETETGGVYGAEGYVYQAFD
FT                   PLPEFDGNRPVLGAWIVGDNAAGLGIRESSGLVTDDGAAFVPHRIPES"
FT   gene            132108..132554
FT                   /locus_tag="Svir_01250"
FT   CDS_pept        132108..132554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01250"
FT                   /product="protein of unknown function (DUF350)"
FT                   /note="PFAM: Domain of Unknown Function (DUF350)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95213"
FT                   /db_xref="GOA:C7MSA0"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA0"
FT                   /protein_id="ACU95213.1"
FT                   /translation="MLVALSDTFGTDLARGIGAIMLYAIVGLVLMLLGFYAIDFTTPGK
FT                   LSELVRRGMPNAVVITASGMVSMAFIVVVAIWASASDLVEGLITSLVYGLIGIVAQVLA
FT                   VRLLEWATRIDVRSTIESERYTPATLIVAAAHVALGLVVAVAIS"
FT   gene            132748..133659
FT                   /locus_tag="Svir_01260"
FT   CDS_pept        132748..133659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01260"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95214"
FT                   /db_xref="GOA:C7MSA1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA1"
FT                   /protein_id="ACU95214.1"
FT                   /translation="MRLLRTPEDRFSDLPDFDYPPLYADIEHPLAGIIRVGYVEAGPPD
FT                   GPTVLLLHGEPSWSFLYRKVLPVLAEAGIRAIAPDLVGFGRSDKPADMADHTYARHVEW
FT                   MRAFAFDVLDLRDVVLVGQDWGGLIGLRLVAENLDRFVGVVAANTGLPTGDQAMPEEWW
FT                   AFRDATQKAPVFDTARFIQSGCRRTLTAAERAAYDAPFPNEMYKAGPRALPTLVPTSPD
FT                   DEASEANRAAWRTLTTSNVPFLCAFSDGDPITGAMGPILQRAMPGAAGREHPTIANAGH
FT                   FLQEDAGQELGRVVARFVRGLD"
FT   gene            133732..134997
FT                   /locus_tag="Svir_01270"
FT   CDS_pept        133732..134997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01270"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: Seryl-tRNA synthetase N-terminal domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95215"
FT                   /db_xref="GOA:C7MSA2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA2"
FT                   /protein_id="ACU95215.1"
FT                   /translation="MIDLRTLREEPDVVRASQRARGEDVGVVDRLLSLDAERRSAIAKA
FT                   DNLRAEQKQLGKRIGKASGEEREALLARGKELAAQVKEAEAEQNRASEEFEKLYNVVPN
FT                   IVHPDVPEGGEDDYVVLKRVGTPREFDFTPKDHLELGEALGAIDTERGAKVSGARFYFL
FT                   TGVGAQLQLALLNMAAAQAVEKGFQLMIPPVLVRPEIMAGTGFLGAHSSEVYRLADDDL
FT                   YLVGTSEVSLAGYHADEILDLSNGPLRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFIFCRPSEAEAEHEKLLAWEEEMLAKIEVPYRVIDTAAGDLGTSAARKYDCEAWIPTQ
FT                   QAYRELTSTSNCTTYQARKLSVRYRDEDGRPQHAATLNGTLATTRWIVAILENHQQPDG
FT                   SVRVPEAMQPFLGGRTVLTPID"
FT   gene            135295..137025
FT                   /locus_tag="Svir_01280"
FT   CDS_pept        135295..137025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95216"
FT                   /db_xref="GOA:C7MSA3"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA3"
FT                   /protein_id="ACU95216.1"
FT                   /translation="MVLTAVTVGLWLVLAVVVFTCWSRINRERSWRYTALGLALLLSLS
FT                   HQLLYPPVTGDVYVTLRYARNLVEGYGPVYNPGEYVEGYVNFLWLSLVTVPGMVFDDPD
FT                   VSVAAAVVLGVACVLGCVLLAYRLTNRIVRLARPEGADLPGLGVVAAILTAGVSSLAAY
FT                   GVSGVETPLFVLLVLTAGLAFTVNRAVVSGVAVAMAIMTRPEGVVLALVGLVWFAVGAV
FT                   RGRNTVSAVLAYLLGGGVLLVPWTVWRLTVYEHLLPNALLPRLSGPWQQRFAGGWDYLA
FT                   EFVLAYQGFVALAVAALALLSTRRGVPERVARARSMVWLLFGLAVSHAAGVVAMGGGWL
FT                   PAWRLLAPVPVLLAVAGTAAYGLFAATSPVKDPPEPLGLARREPLVRRRTVPVVALALC
FT                   GLSLGVTLGHPRASSAMHELRESADQLAEIGGWLDETLPAGTVISSHNMGTLAYAAGPS
FT                   LVVVDVFGRTDEHIGREGEPLRMGSSGVYVTRDFDYVVNERSPVVAVEGPGYTTGQRCE
FT                   INPVYAGLYEVASFRREGTPYWVSVYVRRVFATHLVELLDAHPDYSYVSCERSEHVPVG
FT                   "
FT   gene            complement(137038..137874)
FT                   /locus_tag="Svir_01290"
FT   CDS_pept        complement(137038..137874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01290"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IIB; Cof subfamily of
FT                   IIB subfamily of haloacid dehalogenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95217"
FT                   /db_xref="GOA:C7MSA4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA4"
FT                   /protein_id="ACU95217.1"
FT                   /translation="MIWKTGLVEKPNLIASDIDGTLLTPLGEVAPRTVDVVRRASDEGV
FT                   PVILVTGRPPRWIPPVAEATGLTGYAVCANGAVLYDIGADRVVDVQSQLDPMQLHDVAQ
FT                   ALDHAIPGCQLAAERIGTRAVEPGLQNFVIESEYYNPWGDGEGSVVPRAEVLGHPAVKL
FT                   LASHRKMTSDEMAAAAYDVLGDSVDITFSSGSGLIEIGAPGVTKASGLAEIAELFGVAD
FT                   TDVIAFGDMPNDLPMLEWAGHGVAVANAHPTVLEAADEVTASNAEHGVAQVLERWF"
FT   gene            137933..138823
FT                   /locus_tag="Svir_01300"
FT   CDS_pept        137933..138823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01300"
FT                   /product="flavin-dependent oxidoreductase, F420-dependent
FT                   methylene-tetrahydromethanopterin reductase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95218"
FT                   /db_xref="GOA:C7MSA5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA5"
FT                   /protein_id="ACU95218.1"
FT                   /translation="MILPEDRWWAAEPKWRAAEEYGFDHAWTYDHLGWRSLVEGPWFNA
FT                   VPTLAAAAMVTSTIGLGTFVASPNFRHPVPFAREAITLDDLSDGRLILGVGAGGLGYDA
FT                   EVLGAPALSAAQRAERYVEFVEALDGLLRTDGFDYSGTYYSAVGARNLPGCVRRPRSPL
FT                   FLAANGPRMIEFAARTGDGWITTGAPREGRTQDEWWRGVAEVAARFDEAAAEAGRERVT
FT                   RCLNLDAAPVYSLSSRETFSDAVGRAAELGFTDVVVHWPRSGDPYQGKETVLEDIAADL
FT                   LPSVQGRNGGGTSAD"
FT   gene            139024..140271
FT                   /locus_tag="Svir_01310"
FT   CDS_pept        139024..140271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01310"
FT                   /product="UDP-galactopyranose mutase"
FT                   /note="PFAM: FAD dependent oxidoreductase;
FT                   UDP-galactopyranose mutase; TIGRFAM: UDP-galactopyranose
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95219"
FT                   /db_xref="GOA:C7MSA6"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA6"
FT                   /protein_id="ACU95219.1"
FT                   /translation="MRVGSLSAVSADTNTTDITNDTYTGFDLIVVGSGFFGLTVAERVA
FT                   SQLDKRVLVLERRNHIGGNAYSEPEPETGIEVHRYGAHLFHTSNKRVWDYVNQFTEFTN
FT                   YQHRVFAKYQGQVYTFPMNLHLINQFFGKSHSPDEARELIAQQASEIDTKDAKNLEEKA
FT                   ISLIGRPLYEAFVKGYTAKQWQTDPKELSPSIITRLPVRYNFNNRYFNDTYEGLPVDGY
FT                   TAWLERMADHPNIEVRLNTDYFEVRDQIPEGTPTVYTGPLDRYFGYSEGRLGWRTLDFE
FT                   QEVVPTGDYQGTAVMNYNDIDVPYTRIHEFRHFHPERDYPTDKTVIVREYSRFAEDDDE
FT                   PYYPINTPENREKLERYRELAKKEARERNVLFGGRLGTYKYLDMHMAIGSALSMFDNKV
FT                   APHLTDGAPLDGSIDA"
FT   gene            140264..140842
FT                   /locus_tag="Svir_01320"
FT   CDS_pept        140264..140842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01320"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95220"
FT                   /db_xref="GOA:C7MSA7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA7"
FT                   /protein_id="ACU95220.1"
FT                   /translation="MLERRSGAERVSDEERVLDHSPASGEVALLIGVQRALARPVVVKA
FT                   ARGLSHFGEHSAGWFALGLVGAAFDSARRKEWLTAAMGAVGAHAASIAVKRVVRRRRPE
FT                   HPDITIGVGTPSRLSFPSSHATSTTAAAVLYSGLIGRNLVPALVPPMLVSRLVLGVHYP
FT                   TDVLAGAALGGAVGGILRRRLTSRKRTRR"
FT   gene            140839..141765
FT                   /locus_tag="Svir_01330"
FT   CDS_pept        140839..141765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01330"
FT                   /product="4-hydroxybenzoate polyprenyltransferase-like
FT                   prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95221"
FT                   /db_xref="GOA:C7MSA8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA8"
FT                   /protein_id="ACU95221.1"
FT                   /translation="MSETTERADVQSSASGKGLLPTLLSVLKTARPRQWVKNVLVFAAP
FT                   FTAAQITNIGVLVDAAIAFVAFSFVASSVYLINDAVDVEADRAHPTKRNRPIAAGIVSI
FT                   PLAYASAVVFFLAGLGVSLLADWRLLIVLVVYEAVQLGYCFGLKHQPVIDLTIVGSGFL
FT                   MRLIAGGVATGISLSQWFLLVTAFGSLFMVAGKRFAEVMLYERTGAKIRSSLKKYSASY
FT                   LRFVWATSAAILIMSYCLWAFEQQQRVPGTVWSVISIVPFVIAVLRYAVDVDCGNAGEP
FT                   EEIALRDRVLQVLGATWVVTLACSYYL"
FT   gene            complement(141790..144609)
FT                   /locus_tag="Svir_01340"
FT   CDS_pept        complement(141790..144609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01340"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: Mycobacterial cell wall arabinan synthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95222"
FT                   /db_xref="GOA:C7MSA9"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSA9"
FT                   /protein_id="ACU95222.1"
FT                   /translation="MTVRFWLITLCGLLSTALAGLFVLTPVETRTSVYSWPDTQVRNSS
FT                   LPLFPYKPHRLDVTFSCADVHGIGEGVLLSTTAPRDVSRKDAVHDGLTIDIAENTINVA
FT                   VGNHQIVTFSDEKNCEWSVFADETETTVAVDGDTVARIEDTPVVTGMFTEAPNNSELRV
FT                   TVVPDTRYESSPGTFRIIWAVATVAALTAMFVLILRARNDGIRRTRLLPRRWWRPRALD
FT                   VVVGGALACWLVVGAPTVDDGYIATMLKAAGDGDFVGNYFRWFNAPEAPFSWFYELYRP
FT                   FIEVSGATWWLRLPSVLLGFVLWLLIDRLLLPRIARRPTPSARFAAAAAFLLWYVQFGV
FT                   GLRPEPWVMLGTVTVFLLLERALATRNLAALGASVTAAGLTVAVTPSGIVALTPFLAAA
FT                   FGLVRLIRHHGAVVVPVVLGAGSVALLPMFADQSLAAVLHSVEVRSAIGPNFGVLDESR
FT                   RYADLFDPIRGGLNLRMPLLLLWLSIVVLAVLSLLRRTPGLAARPTHRMLVLTALCFAA
FT                   LVFTPTKYTHHFGAVGGLATVLFAAMVHTIGKGALRRAWQRSLFILALAAVTAYALAAP
FT                   MRWWFLANLGVPWSLEQPNLGGLPLSTIVLAGGALLAVVGLLARRRPPWPAWLPPLVAV
FT                   GTVLLEMSSLLYPAVTSRSGTYNVVNATVAGFSHSCGIEDWLEVEPDRRTGVLTPAPGT
FT                   AGVIAHGFEPNAGYPDDVPPPVPYGTDTAPVWGSGGSAGSLTTPWYTLPEDAGSPESPP
FT                   LVVPIAGAGAVSATVQFADREGTVHKELRLRLGDGTWREARLEPGDAERVRVTAVDRRD
FT                   DDGWIAIGAPRIPRVVPLTDYLPVSEPVGLEWVNAFFLPCRQPASVAHGVTQPVSHLLT
FT                   VGSDSSWLTRMSYSPAAGGPYAPLLEVAERVPVPTYLRGDKLREPIRVFRLDYVAPPLA
FT                   EVSRQRIHR"
FT   gene            144663..146159
FT                   /locus_tag="Svir_01350"
FT   CDS_pept        144663..146159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95223"
FT                   /db_xref="GOA:C7MSB0"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB0"
FT                   /protein_id="ACU95223.1"
FT                   /translation="MVGVSALLAAAVFVVVKDALIDDAYITLAYAKNLAVHGQWGLVPG
FT                   MEANSATSPLNVLLLGALTALTRVSGDPHPVVALGVLTVLTTAVLGWAWTRLCRVYRLP
FT                   WPVALLGVLVVLANPFVLSAIGLEVLLIPAMLMLLTVFAAQGRPEWFGVAAGLAVLTRL
FT                   DLVVFVLVIALCAGGIRRHIGKAALVGVAVSAPWFLFSWIALGSAVPDTLVIKQNQDDL
FT                   FGSWSYATGPVMYYLGQELAVSMAFAPAVVGLIALCALVGLWFARRWDRFPSVSALVGL
FT                   GAGAVAYYLTYMVLGVGPYHWYYVAPTTALGMFAVAILGVWLVWARREATLRVHAPAAA
FT                   LGVVAVFVFGAVAVDTGRDMPWRSPVIFGNWANAPDYAHVGLELGERAGDGTTVLSPGE
FT                   IGALAYYCECRIVDVFSDRGRVADLVNQRIAEAGPVGSALLRLNYLFFDDVEPAKVDKR
FT                   IRYTRGPGSGPDTWQVYSDALGVGHFTLVDEPSEDSRPVE"
FT   gene            complement(146164..146778)
FT                   /locus_tag="Svir_01360"
FT   CDS_pept        complement(146164..146778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95224"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB1"
FT                   /protein_id="ACU95224.1"
FT                   /translation="MEENPRAAAQIDEVVETELTRFWLDRDERLLLACPPIRAHVGAFI
FT                   GGRRLVPYVPTRELPSRCDRPRRWPLPVEDLPVEDWVDDPTLGHWVHADHDGQDAVLCA
FT                   DHLAASQGMARVVVTDRRIAVLCPTKYLTDEPVTDENVFTTLEEMEPHRLAGLDTPFLG
FT                   RSVPPRRVIEFTFADGSRLYSYDIHATLKVRRAMERAHAWR"
FT   gene            complement(146778..147494)
FT                   /locus_tag="Svir_01370"
FT   CDS_pept        complement(146778..147494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95225"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB2"
FT                   /protein_id="ACU95225.1"
FT                   /translation="MGFADPVGPATHARQVIEPDEQLLWAAFGPEFAYDIEGLDALGEP
FT                   QHIPLTQGLETMGRSGPATPPELTGPADESGPPSRGPDVVVFGDGPGCHAHNGVRHLDP
FT                   RGGTRSRTWALTSTRLLVLDTRPTRRQHAGDSPTSFLRRTLGLGKELVDIVTDRTKRYG
FT                   EHVEGVPVAAKPMAVYGTFAKSTITEIAVARRRTQWRTRPCLRVSFVDGSGLDLLLGVD
FT                   DESVFEWMVALSRGDR"
FT   gene            148180..150348
FT                   /locus_tag="Svir_01380"
FT   CDS_pept        148180..150348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95226"
FT                   /db_xref="GOA:C7MSB3"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB3"
FT                   /protein_id="ACU95226.1"
FT                   /translation="MAAEIDRKPDELQVEDVRADSGGRTETRPSSVRRDRAAWLVGALA
FT                   LVLGGVFVVVDLAYNEGKLIAPIDDAYIHLQYAAQLGSGHPFEYNTGDPVSTGASSLLY
FT                   AFVLAAAHAVGFTGTALLAFAVAFGVVCCAVTAGLACRLGTTLFGRAAGAWAGVLIAVS
FT                   GPFLWGAVSGMEVGLTALLVTGAVSAFVRECGCARFRWTPVVAALLALVRPEGLLFAVM
FT                   LCGAMAWTVVVARRAGTVTTRRAVGRVAVGLAPLLVGVAQYAFYLLATGTPRANGVQSK
FT                   SHLYDRPIFYLGEFVDRTVANVRGVVDHFNGLNNTDFAFPFALVFFLVGLGYLFANRPE
FT                   WRTLVVAVAAGFAAVVASASTLSTALLHELRYFQPFLPLFFVFAVGGGYALTRLLPREG
FT                   PRRFALHAVFLVMVLFTVVATPTWAVRLGRQAATIRDTDISVGAWISGNLPEDAIVGVK
FT                   DVGAVAYFGERRVVDTIGLTTNGMAEASNNGPGSLYEALRTLPEGQRPTHFAMYEPWPG
FT                   VPMQPFVDAGVFVSPPLRVFPVRTPPDLNDRRIVPFNDVRVYEADWTLAASGDRAPVPG
FT                   QVRDYLNVGSLESERGHGYEVVSAQPGLQPYTVLRRHGDVIDSGRVIVGGERFTVRGLD
FT                   PGKPLTVATRVLTPGENPEHREVRVRVDGRDAGVWRLPEAREEWTTARFTVPAELVTSS
FT                   EVAVELEPVRPLLSPYPEYTSFGYWIVQ"
FT   gene            complement(150385..151140)
FT                   /locus_tag="Svir_01390"
FT   CDS_pept        complement(150385..151140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01390"
FT                   /product="short-chain dehydrogenase of unknown substrate
FT                   specificity"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95227"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB4"
FT                   /protein_id="ACU95227.1"
FT                   /translation="MIDAVGNPQSLLLLGGTSDIALAIAEKYLSARPLRVVLAARPSAR
FT                   RDQAVERLTTAGAEVTSIDFDATDLDSHPAVIDKAFADGDIDVTVVAFGVLGDAEQAWQ
FT                   DHRAAVQLATVNYTAAVSVGVPLADRLRKQGHGKVIALSSVAGERVRRSNFVYGSTKAG
FT                   FDGFYLGLGEALRPHGVTVTVVRPGQVRTKMTEGMGKAPLEQTAEQVADIAVKAARAGK
FT                   ELVWAPGAFRFVMSVLRHVPRPIFRKLPI"
FT   gene            complement(151137..152498)
FT                   /locus_tag="Svir_01400"
FT   CDS_pept        complement(151137..152498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01400"
FT                   /product="FAD/FMN-dependent dehydrogenase"
FT                   /note="PFAM: FAD binding domain; D-arabinono-1,4-lactone
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95228"
FT                   /db_xref="GOA:C7MSB5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB5"
FT                   /protein_id="ACU95228.1"
FT                   /translation="MSTERRTLTGWGRTAPTTADVLRTPDVDVIARAVTEAGDRGVIAR
FT                   GLGRSYGDPAQNAGGLVIDMTALDRIHSIDPDNAVVDVDAGVSLDTLMRAAIPYGLWVP
FT                   VLPGTRQVTIGGAIANDIHGKNHHSAGSFGNHVLSMDLLTADGRIRTLTPDGPEKDLFW
FT                   ATVGGIGLTGIIVRATIRMQRTESAYFVVDADRTADLDETLELFTNGSDLNYDYSMAVP
FT                   DLISRDGRLGRATFSRGSLARVDQLPDKLKADPLKFDAPVLMTIPDIFPNGMVNRLTAT
FT                   ALGELWHRTVPKKGVRGKIQNLTQFYHPLDMLREWNRGYGSRGFLQYQFSVPFGREDAL
FT                   KDLCRRIANSGHYSFLNVIKRMGEANPAPLSWPSPGWMLSVDFPVKEGLAEFCDELDAE
FT                   VLAAGGRLYTAKDSRTSAETFHRMYPRLDEWRKIRQSVDPDRIFISDMARRLEL"
FT   gene            152642..153094
FT                   /locus_tag="Svir_01410"
FT   CDS_pept        152642..153094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01410"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95229"
FT                   /db_xref="GOA:C7MSB6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB6"
FT                   /protein_id="ACU95229.1"
FT                   /translation="MVATDSQASEVESASHAPSPGLLAQILRFVLIGGFCALVDSGLYW
FT                   LLLQAGAWVHLAKAISFIAGTTTAYFLNRRFTFTAAQKGGAGQLGGFMLLYTVTFFVNV
FT                   GTNALALHLLPELGWRIALAWIIAQGTATTINFIMLKWVVFREPRG"
FT   gene            153255..155129
FT                   /locus_tag="Svir_01420"
FT   CDS_pept        153255..155129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01420"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95230"
FT                   /db_xref="GOA:C7MSB7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB7"
FT                   /protein_id="ACU95230.1"
FT                   /translation="MSSQTARFSEHKGTGRLLTQRGLFAGPSDLVSKDLYAEIVEGVAT
FT                   RRRETVILEPSARVSGNTYFGRFPASYWQRWTTVKSVAVEAEVSGSGQLAVRASDMEGE
FT                   PRTVTVRTVEDAKGEHVRLDAPLDKFLDGGALWLDLETESGTLTVSNVRWTVDSPEKIR
FT                   PTAVTICTMNRADDCLGNLFALADSLPALDTLDAIYVADQGTDTVDSREGFAEVAERLG
FT                   DKLHYIKQPNLGGAGGFTRGLYEVAGSTDTEHANVLFMDDDVLLEPDLIIRLTAFSNCA
FT                   ANPMIVGGQMLNLLHPHQLHVGAEYAELNTLEPGQPVPHSLSTADLLGVDEETGKPNRQ
FT                   ERRVDAGYNGWWSCLIPYEVVKTIGYPLPFFFQWDDAEYSYRARAHGFPTVTLPGAGVW
FT                   HADFHWKDWDEWHRYFNLRNSIITAALHSPFDLNLLSRVLLAQLVRYLLSMQYGLSATL
FT                   ITAVEDFLKGPDILHDGGVAAMKRIREIRAQYPETKRYAPTEVPGIPSNDISIINTAPR
FT                   PSLQRLVLLKRIIYRLLGKHRFELGAIPSDEAHWWHVSQFETAVVTDASQEGVRVRRYD
FT                   RQKMFELAKRGVQVINRLRKEGKAVQEEYKRALPRLTSRENWKRLYQL"
FT   gene            155333..156118
FT                   /locus_tag="Svir_01430"
FT   CDS_pept        155333..156118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95231"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB8"
FT                   /protein_id="ACU95231.1"
FT                   /translation="MVQSFSLSLAAIDILFEHLRLGHAPFPFEVPHLGQTFTERSQIRQ
FT                   AVFRDLESRDLMRGGRVDADVEAALVTFARGPVAITAAAKLEKGEKLFARSAVDGQLAV
FT                   LAKRDGNLIVFNEIRPVGLVPEIVNLIPSTRPAPGQSVTVAQPQPQQDRGRHAAPDSYD
FT                   PFAGVSAPTSRRDPQLRMVERMFTKPQLRMGQFTAFAQGGGGKSRHLDPVAWFDSEDGR
FT                   IFTTSRTAEDGQRWLTYAPADNARIVQHLSSQVQPFLQR"
FT   gene            156309..156704
FT                   /locus_tag="Svir_01440"
FT   CDS_pept        156309..156704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95232"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSB9"
FT                   /protein_id="ACU95232.1"
FT                   /translation="MAASVTTGSGSSMTSEAKKMLASAKSGGFMVSEEAAKPIRDVLDR
FT                   MKWRVEELINELGNIAGTEPALGNHEYGKRVAVHQQEAFAGDEGSAISVLQALHSVLDD
FT                   SYNALEIAVKKYSESESSASDVFKGKA"
FT   gene            157524..157982
FT                   /locus_tag="Svir_01450"
FT   CDS_pept        157524..157982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95233"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC0"
FT                   /protein_id="ACU95233.1"
FT                   /translation="MESRRIFDEKRQELNSYNIEYREGIPPSEFDYLGIAHEKLKSDVE
FT                   YISPEGITVYSDGYHKLYKLFSDLSEELKAAVNKSKQGWEGEAAESAHGYFTSLATWSE
FT                   GNSVNADMASQIIAAEADAASAEKSSMPEPIPFDLEMVSWMPMKRWCR"
FT   gene            158195..158626
FT                   /locus_tag="Svir_01460"
FT   CDS_pept        158195..158626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95234"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC1"
FT                   /protein_id="ACU95234.1"
FT                   /translation="MKTGAADGAVAAMRASFNSKNVGSMASEAKKMLASAKSGGFMVSE
FT                   EAAQPIIDVLTEMTDRVDRLSHELSFVSSQAPTLGSHDYGQRVAEHQYEAFWGGDGSAV
FT                   QVLKQLRNVLEDASNALNIAKKKYQESEAGATNTFGGRI"
FT   gene            159843..160781
FT                   /locus_tag="Svir_01470"
FT   CDS_pept        159843..160781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95235"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC2"
FT                   /protein_id="ACU95235.1"
FT                   /translation="MPEPIPFDLEKEMESWGSNPLTTIEQISKTFEKWEESRAAHEQAA
FT                   EVMHRYDAELQEAGNKQPVFAEPPSFGGGSAESSVKPSGVIQVPDTSATGGGTKASGYA
FT                   GVPGGSVSPSTGGGGYGGGGLGAPSPTPPPGGGPSTGAGVVPPVTRPSGLNPGGGMTRP
FT                   PAGGRGSQRSGFGPGGMGAVPAAGLAGGFGPGGGGGGGSYGGGRVPGAGFGPGGGAGGA
FT                   GGAGAGSGAATGARPMGGPAAAGPGAAAAAAGAAGRGGMGAAPMGAGAGAGKGGQGGED
FT                   NEHQRPTYLVEADPDDVFGTDQRTAPPVIGA"
FT   gene            160906..161409
FT                   /locus_tag="Svir_01480"
FT   CDS_pept        160906..161409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95236"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC3"
FT                   /protein_id="ACU95236.1"
FT                   /translation="MTNRWRGGRTIALISVVGVLLTGCSFFNSSRDIDPCSLVTDSELS
FT                   AYGDYGEPERRDRGNQRICTWYNSTTQPLRTTVTPQLNIYVNHKQRYYTAGQNDVETGY
FT                   AAGRRYKVRTTDSTCTVTMPVFKNTVGSKKKKGTVDIAVTMPDPKDNCPTARKIAEIVS
FT                   PRLH"
FT   gene            complement(161461..162372)
FT                   /locus_tag="Svir_01490"
FT   CDS_pept        complement(161461..162372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01490"
FT                   /product="predicted glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95237"
FT                   /db_xref="GOA:C7MSC4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC4"
FT                   /protein_id="ACU95237.1"
FT                   /translation="MPDVEAKPLPDDAVVAVVVTRHRRELLAESLKVIAAQTRPVDHLV
FT                   VVDNGPDKPARDVVAECGLPFTYVPSHHNLGGAGGFALGMLHALAMGAEWVWLADDDGR
FT                   PADENVLRVLLEEAQRRNLAEVSPVVANIDAPEKLAFPLRRGLTWKRATSELGTDFLPG
FT                   IASLMNGALFRASTLDVVGVPDLRLFVRGDEVELHRRLVRSGLPFGTSLRTAYLHPNGS
FT                   DEFKPMLGGRFHAQDPEDEVKRYYTYRNRGFLLSQPGMRKIGALELLRFGLYFVGVKRD
FT                   PKAFAQWLRLVRQGRRERFFRY"
FT   gene            complement(162365..163171)
FT                   /locus_tag="Svir_01500"
FT   CDS_pept        complement(162365..163171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01500"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95238"
FT                   /db_xref="GOA:C7MSC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC5"
FT                   /protein_id="ACU95238.1"
FT                   /translation="MISIDVRNAYVDFPIFDAKTRSLKKRVLGKVGGKIGTESRVPIIE
FT                   ALHDINLSLKSGDRVALVGHNGAGKSTLLRLLSGIYEPTRGFARVRGRVAPVFDLGVGM
FT                   DQEISGYENILIRGLYLGMSRKEMEKRIDDIADFTELGDYLSMPLRTYSTGMRVRLALG
FT                   VVTSIDPEILLLDEGIGAVDAAFLNKARDRLVDLVKRSGLLVFASHQDDLLLELCTSAI
FT                   WMDEGRMKMQGSLREVLTAYKGRDPFENMSPEALQRLEESSAASSA"
FT   gene            complement(163178..164068)
FT                   /locus_tag="Svir_01510"
FT   CDS_pept        complement(163178..164068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01510"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95239"
FT                   /db_xref="GOA:C7MSC6"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC6"
FT                   /protein_id="ACU95239.1"
FT                   /translation="MTSAPPRSDSRTFARAFSDIRDGFKQPELWGHLAWQDIKQRYRRS
FT                   VLGPLWITISMGVTALGLGLLYSQLFGASVGTFLPYITTGFIVWNFILGCLTDGTDTFI
FT                   ANEGLIKHLPAPLSVYALRTVWRQCIMFAHNMVIYFIVIAIFWGDITTPDYTLTEDGMS
FT                   HPGLNWEVLLALPGFALLAINAGWVVLLFGITSTRFRDIPQVVSSLINLLFFMTPIVWT
FT                   TDILKDKFGDTADWRDWVAELNPLYHFIQVVRAPLIGNAVSWHHYAVVGGITVVGWALA
FT                   LVVMRNYRARVSYWV"
FT   gene            164317..164946
FT                   /locus_tag="Svir_01520"
FT   CDS_pept        164317..164946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95240"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC7"
FT                   /protein_id="ACU95240.1"
FT                   /translation="MVSLLQAYADRPDPQSVAVVGNQPLDPDPARAEAIDSCDLVIRVN
FT                   GFVCDEPGGPPTVGARTHVVVFNRALRATKWVFTNYRSRLYLMVEPGRLHWEPEDIPQW
FT                   WPADLGFVPVSNREVTLPLSEAMGLSSRQEAAWATTGTMAAWIAHSSFPDADLVLSGFS
FT                   FVDNPHQTSWKHAAGDSCIVGPEHRIALEGKLLQSWIDAGRARLLR"
FT   gene            164989..165462
FT                   /locus_tag="Svir_01530"
FT   CDS_pept        164989..165462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95241"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC8"
FT                   /protein_id="ACU95241.1"
FT                   /translation="MTSTNPLRSLRAGLGRRLARFVDFRIDDRTRGRLDDHEARIIEQE
FT                   HCTVDHRRRLDALESGLDRVRGDLLWTTGEVKRLIPHVAAQEVQLEDLREKFSLTPPSD
FT                   DKQIAEARTLIEEIQRQHAQIRTRLSGIAMYEDRLRKLEERAEAEKAGTEVVE"
FT   gene            165465..165986
FT                   /locus_tag="Svir_01540"
FT   CDS_pept        165465..165986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01540"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95242"
FT                   /db_xref="GOA:C7MSC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSC9"
FT                   /protein_id="ACU95242.1"
FT                   /translation="MLRPATDGDVETIRRWRNHPKVRRASFTTHEIGPEEHRAWWEAVS
FT                   ADPTRRVLIFERNGVPSGVVLFTGVGSELVEWSKYVDVDGLGSERAAAWEELEYEAIDY
FT                   AFDVLGADRIGASTLAANTPVRRLHERTGFVELRRYTRTIDGVDREVVWSELSARAWKA
FT                   RRTRRETAGE"
FT   gene            165979..167028
FT                   /locus_tag="Svir_01550"
FT   CDS_pept        165979..167028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01550"
FT                   /product="N-acetylneuraminate synthase"
FT                   /note="PFAM: NeuB family; SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95243"
FT                   /db_xref="GOA:C7MSD0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD0"
FT                   /protein_id="ACU95243.1"
FT                   /translation="MSEVRIGKYTVGPDHPPFVIAEMSGNHNGDLDRALAIVDAVADSG
FT                   AHAVKLQTYRADTITIDVDRPEFRIDNEASLWHGENLYRLYERAHTPWEWHERLFARAR
FT                   ERGLEVFSSPFDPTAVDLLESLDACAYKIASSEIVDLPLIELCARTGKPLVISTGKATI
FT                   AEIDAAVRTARDAGNDQILLLGCTASYPAPAEDSNLRALPVLEQAFGVPVGLSDHTMGI
FT                   GVPVAAVALGACAVEKHVTLARDDGGVDSAFSLEPHELAALVTETRRAWEALGVPRIGP
FT                   KASERGGLRLRRSLYVVEDVRAGDVVTEHNVRSIRPAGGLPPAEITTVLGRTFRVDAAK
FT                   GTPLTWDLL"
FT   gene            complement(167069..168205)
FT                   /locus_tag="Svir_01560"
FT   CDS_pept        complement(167069..168205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01560"
FT                   /product="predicted PLP-dependent enzyme possibly involved
FT                   in cell wall biogenesis"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95244"
FT                   /db_xref="GOA:C7MSD1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD1"
FT                   /protein_id="ACU95244.1"
FT                   /translation="MSDFLPYGRQSVNDDDIAAVAEVLRGDWLTTGPAVTRFEADLAEH
FT                   TGGTPAVAVTSGTAALHVAYAAAGIGPGDEVVTTPLTFVATAATAALHGAKVVFADVEP
FT                   DTGNLDPAAAHAAVTDRTKVLAAVDYAGHPAELDQLRKVADSVGALLLEDAAHSLGSSW
FT                   RGRPVGSLADLTTFSFFATKNLTTAEGGAVVSPSAELVERARAFRNHGLVRDRARQRYP
FT                   DEGGWHQEVHAFGLNYRLPDVLCALGSSQLRRLWAFKQRRAEIHARYDEGLRDVPGVLT
FT                   PVCRAEADPMWHLYPLRVLDGRRRALFDHLRANGIGVQVNYIPAYWHPVFEDLGYRRGL
FT                   CPNAEAYYAQELSLPLFADLSDADVDRVIDTVRSFFGV"
FT   gene            complement(168198..169181)
FT                   /locus_tag="Svir_01570"
FT   CDS_pept        complement(168198..169181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01570"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95245"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD2"
FT                   /protein_id="ACU95245.1"
FT                   /translation="MAELDGSSILLTGGTGSFGKAFISYALAELNPRRLVVLSRDELKQ
FT                   YEVRQQFDDDPRLRWFIGDVRDRRRLERAMHGVDYVVHAAALKQVDTGEYNPFEFVQTN
FT                   VVGSQNVIEAAIDSGVKKVVALSTDKASSPINLYGATKLCADRMFISANHYAAAHPTRF
FT                   AVVRYGNVMASRGSVIPLFRSLAEQGKSLPITHKEMTRFWITLPQAVRFVVESFDLMRG
FT                   GELYVPRIPSMRLVDLAQAIAPGSPMHEVGIRPGEKLHEEMIAPDDSRRTVRLGDRYIV
FT                   QPHIAGWGYEPPEEGTPVPEGFSYRSDTNDLWLSTDDIKKLIAEHE"
FT   gene            169250..169990
FT                   /locus_tag="Svir_01580"
FT   CDS_pept        169250..169990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01580"
FT                   /product="spore coat polysaccharide biosynthesis protein F,
FT                   CMP-KDO synthetase"
FT                   /note="PFAM: Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95246"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD3"
FT                   /protein_id="ACU95246.1"
FT                   /translation="MNIVIQARASSTRLPGKVLRPLGEAGDLSVLGWVVRAARLTVGVD
FT                   RVVVATSDNADDDAVAAEARRCGADVVRGPLDDVLARFLVACTEYPADAVMRLTADCPL
FT                   HDPALLGQLVALWRAQPDLDYVSTTLVRTLPRGFDAELVRVPVLVEQGRIPVGPHREHV
FT                   TYGVKNSPDVHRCSGIVVQPRADDLRVTLDTEDDWALLEALVRELSTRHGDGPFAWRDV
FT                   VAVLRSRPDLVALNAHVEQKKVTG"
FT   gene            169987..170982
FT                   /locus_tag="Svir_01590"
FT   CDS_pept        169987..170982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01590"
FT                   /product="spore coat polysaccharide biosynthesis protein,
FT                   predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95247"
FT                   /db_xref="GOA:C7MSD4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD4"
FT                   /protein_id="ACU95247.1"
FT                   /translation="MTRLLLRADASPTIGVGHVARMVAFAEQARGLGWSVAFSGTLTGA
FT                   DWFAERLAELDVTVVDPTDPNDDEGLPHLVRKLGSDVVVVDHYGIGEVRPAVNAAGAAL
FT                   VSLEGGVFGRRAADVVVDSGFHSRPRPDDGSGVVLRGPRYAPIREQVLRARRLRAERVA
FT                   EPGRPPEVVVVLGGGAVWREEVTRVLSRLRDTGLPFNADVVAHGDPDVPRAGTGQRFTV
FT                   SRPDTRLPERLAAADLVVSAAGVTLLEACCIGVPIALVLLVDNQEAGYRAAVEQGFAVG
FT                   LGRADTLHGATEALVRLLGDPAERRRLASVAADVVDGRGAKRVLEAVPAG"
FT   gene            complement(171019..171570)
FT                   /locus_tag="Svir_01600"
FT   CDS_pept        complement(171019..171570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01600"
FT                   /product="Protein of unknown function (DUF2587)"
FT                   /note="PFAM: Protein of unknown function (DUF2587)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95248"
FT                   /db_xref="GOA:C7MSD5"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD5"
FT                   /protein_id="ACU95248.1"
FT                   /translation="MTEPNNPDTGRPDTSQHVVVVGPDGSPVGAARVNPEDEEKTESVG
FT                   DMVEEPAKVMRIGTMIKQLLEEVREAPLDDASRNRLREIHATSIKELEKALAPELQEEL
FT                   ERLVAPFTADTTPSDAELRVAQAQLVGWLEGLFHGIQTALFAQQMAARVQLEHMRRGLP
FT                   QGARQSTEQQSGLGSTGQYL"
FT   gene            171709..172908
FT                   /locus_tag="Svir_01610"
FT   CDS_pept        171709..172908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01610"
FT                   /product="cysteine desulfurase family protein, VC1184
FT                   subfamily"
FT                   /note="PFAM: Aminotransferase class-V; TIGRFAM: cysteine
FT                   desulfurase family protein, VC1184 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95249"
FT                   /db_xref="GOA:C7MSD6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD6"
FT                   /protein_id="ACU95249.1"
FT                   /translation="MAFDVARIRGLFPALGDGWIHLDGSAGMLVPEQVASAVSTAMRAP
FT                   VSAPGGGFPASQRAESIVAAARRAVADLTGADPDAVVLGPNAPALLSRLADTLADTWTL
FT                   GDEVVVSRLDEPANTDPWLRAMKRIGGNVRWSEIDIETCELPAWQYEQLVGSRTKAVSV
FT                   TAASGSVGTRPDVSTIAEIAKKVGALVVVDATYAAPFVPLDIAELGVDVLVLSAQAWGG
FT                   PAVGALVFRDRELLDRIPSIALDPHATGPERLELGPHAYPLLAGLVASVDYLADLDDAA
FT                   AGSRRDRLLTSLGSAKSYHVGLLAQLSTELRSLPHVMLIGDAARRIPTLAFTVADRKAA
FT                   DVARHLASRNVCAFADDGTTGVFAVLGVGEVGGAVRIGLAHYSNVFEVNQLVQVLEELV
FT                   "
FT   gene            complement(172918..173892)
FT                   /locus_tag="Svir_01620"
FT   CDS_pept        complement(172918..173892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01620"
FT                   /product="putative NAD(P)H quinone oxidoreductase, PIG3
FT                   family"
FT                   /note="PFAM: Zinc-binding dehydrogenase; Alcohol
FT                   dehydrogenase GroES-like domain; TIGRFAM: putative NAD(P)H
FT                   quinone oxidoreductase, PIG3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95250"
FT                   /db_xref="GOA:C7MSD7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD7"
FT                   /protein_id="ACU95250.1"
FT                   /translation="MRAIRLREPGGPEKLEWADAPDPVAGPGEVLVEVAASAVNRADLL
FT                   QRQGHYPPPPGASEILGLECSGTIVEVGDGVEGWRVGDHVCALLAGGGYAQQVAVPAGQ
FT                   LLPVPNGMELTTAASLPEVACTVWSNVVMHARLTEGETLLVHGGAGGIGTHAIQVGKAL
FT                   GATVAVTAGSDERAQRCRQLGADIAINYREQDFVEVIKAETGGADVILDNMGAKYLGRN
FT                   VDALATGGRLVVIGMQGGTKGELHLGKLIAKRASITATTLRSRPKEEKARIVAEVRERL
FT                   WPLVERGTVRPVVDRAYPMSQAGDAHRALEAGGIFGKILLTAQ"
FT   gene            174015..175544
FT                   /locus_tag="Svir_01630"
FT   CDS_pept        174015..175544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01630"
FT                   /product="aminopeptidase Y"
FT                   /note="PFAM: PA domain; Peptidase family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95251"
FT                   /db_xref="GOA:C7MSD8"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD8"
FT                   /protein_id="ACU95251.1"
FT                   /translation="MSSLRARWRPGVAIAACASLALVGAGTATAAPDPVSDLPDQLAEK
FT                   VTLGQLNRHLSALQRIAHMNDGNRASSTEGFNASAEYVANKLEQAGFDVTRQEFPFTYS
FT                   ETLAEKLVADGAEIPVIMMEYSPSTEEGGFTAPLAVVPVDDTPGCEASDYGDVTGKIAL
FT                   VQRGTCSFAEKTLAASEAGAAALLVYNNEEGPVNGTLGEKNDDYVPAGGISQADGEALI
FT                   ALDGTEITLELRSFMEDRTTYNVIAETQTGRKDNVVMAGAHLDSDPAGPGINDNGTGSV
FT                   ALLETALALGAEPDINNRVRFAWWGAEEFGLVGSTYYVNSLSFEQQLDIALYLNFDMIG
FT                   SPNAGYFVYDGDDSDGEGAGPGPYGSAQIEAAFVDYLENTVGVPTEGRDFDGRSDYGEF
FT                   IAVGIPSGGLFTGAEGEKTEEQAAKWGGVAGEAFDPCYHQACDNLGNVDRVALDRNADA
FT                   MAYVIGKYALSTEEINGVAPQGAKDEAKLAKQRVSQMRMSVQAAQGDAVFA"
FT   gene            176018..176473
FT                   /locus_tag="Svir_01640"
FT   CDS_pept        176018..176473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01640"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95252"
FT                   /db_xref="GOA:C7MSD9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSD9"
FT                   /protein_id="ACU95252.1"
FT                   /translation="MRWLTDTEMSVWRSYIVSTLMLRQRLHRELSERHALSLIDYEVMV
FT                   CLSEAENNAMRMTELAKTLGSTKSRLSHQIARMEAEGYVRRIKHVGDRRGVTAELTQKG
FT                   AELLHESAPTHVKGVRAHFVDLLTEQEKQLMGRAFSRVVTHLSGLGD"
FT   gene            176496..176580
FT                   /locus_tag="Svir_01650"
FT   tRNA            176496..176580
FT                   /locus_tag="Svir_01650"
FT                   /product="tRNA-Ser"
FT   gene            176837..177151
FT                   /locus_tag="Svir_01660"
FT   CDS_pept        176837..177151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01660"
FT                   /product="cation/cationic drug transporter"
FT                   /note="PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95253"
FT                   /db_xref="GOA:C7MSE0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE0"
FT                   /protein_id="ACU95253.1"
FT                   /translation="MAWVILIVSGMFEAVWAIALGKSDGFRKVVPSLIFVGALIISMGG
FT                   LAIAMRTLPTGTSYAVWVAVGASLAVAYSMATGEESVSILKIVLLLGLIGCVIGLKLVH
FT                   "
FT   gene            177318..177788
FT                   /locus_tag="Svir_01670"
FT   CDS_pept        177318..177788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01670"
FT                   /product="rrf2 family protein, putative transcriptional
FT                   regulator"
FT                   /note="PFAM: Transcriptional regulator; TIGRFAM: rrf2
FT                   family protein (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95254"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE1"
FT                   /protein_id="ACU95254.1"
FT                   /translation="MRLGQAVEWMLHTCLNLSWVDEPVSTARLADIYRLPSAYLNKQLQ
FT                   ALAREKILVSVPGARGGFRLARDPAEISLLDVVVAVEGKAEAFRCAQILRNGPGGDPDV
FT                   DYSSYCVVSQSMRRAELAWRRELAGRTIADIAADVVRRNPDAPELVRDALTN"
FT   gene            178043..178804
FT                   /locus_tag="Svir_01680"
FT   CDS_pept        178043..178804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01680"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95255"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE2"
FT                   /protein_id="ACU95255.1"
FT                   /translation="MKIAVLGATGTAGSRVVRRLKDENVDVVAVSRASGVDLVTGDGLV
FT                   DALAGVDAVVDASNALPPNGSMEWGEALTTATRNVVDACGRRKVSRLVFLSILGAEDPV
FT                   FDEFPYCVAKREQESIIGESGLNATIVKTTQWYEFATNPAAVVFHDDRVEVQDWLVQPV
FT                   AADTVADVLVREALDTSGGGQVLIAGPERIRLPELARRRLKTLGDERPVHAIEPDLPVL
FT                   AEGALLAWERAKVMGPGLEEWLASLRRETTR"
FT   gene            complement(178807..179547)
FT                   /locus_tag="Svir_01690"
FT   CDS_pept        complement(178807..179547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01690"
FT                   /product="predicted Zn peptidase"
FT                   /note="PFAM: Domain of unknown function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95256"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE3"
FT                   /protein_id="ACU95256.1"
FT                   /translation="MALRRGFKATARRLAADVRDELGIAAFEPLDPYALARLYGVEVFT
FT                   LDAPWLPRDAVEHFTGTAAESFSGALIQIGTGCVIVENHTHTDTRRRSTVAHEMAHVLL
FT                   EHEFGVLVTGGTPCRSTTTEIEQEAAELSGELLLPRDAARTAAFRGWTDTTIARYFRVS
FT                   ERMARWRMNVTGARRIARRTRDRRAHGAAERSVPDVTVRNPTTEATSARHTSKFPQWTR
FT                   LDHAPGPPNRLSKVARSSDDSIGP"
FT   gene            complement(179549..179917)
FT                   /locus_tag="Svir_01700"
FT   CDS_pept        complement(179549..179917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01700"
FT                   /product="Helix-turn-helix protein"
FT                   /note="PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95257"
FT                   /db_xref="GOA:C7MSE4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE4"
FT                   /protein_id="ACU95257.1"
FT                   /translation="MTGRVDTQRLYEALDAQRRARNLSWRQLARQAGVSPSLLSRMGNG
FT                   QRPDLDGFVALVQWLGAQAEEFMVWPDERPRDEQPSLESQLALLLRARDDLDEADREYL
FT                   LDIVRATMRRIKADRRGV"
FT   gene            180057..180311
FT                   /locus_tag="Svir_01710"
FT   CDS_pept        180057..180311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95258"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE5"
FT                   /protein_id="ACU95258.1"
FT                   /translation="MCSSFSVVFRFSPDSLTWVVSRGKKVLSRHCRKRDAVREAARLAR
FT                   ADGRAEVRVERMDGTIQCRHRYGLSRSSGSVRAREGEQR"
FT   gene            180323..181474
FT                   /locus_tag="Svir_01720"
FT   CDS_pept        180323..181474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01720"
FT                   /product="beta-glucosidase-like glycosyl hydrolase"
FT                   /note="PFAM: Glycosyl hydrolase family 3 N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95259"
FT                   /db_xref="GOA:C7MSE6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE6"
FT                   /protein_id="ACU95259.1"
FT                   /translation="MKRLMLAAACVALLGTAACGDGGDQAGDGNTASPPPDQQDTQQTS
FT                   ATQQPGGECAGVIEGLSPRERAAQLLVVGVDPTDPAAAVALVREHRVGGIFIGGNPTAL
FT                   FTDNALDRVQEAAGDIPVSVAVDDEGGRVQRIDELVGPIPSARQMAQSMTPQEVRELAR
FT                   ERGEQLSARGVTVDYAPVVDLTDGPANGVIGDRSFSADPQTATEYAAAFASGLSEAGVQ
FT                   PVIKHFPGHGRASGDSHQELVQTPPLDELRTHDLVPYEDLSVYPDDTQVMVGHLDVPGL
FT                   TDGQPASLSPAAYRLLRDEYDYDGVVLTDDLGAMRAVTDNYTLDEAVLLALQSGADQPL
FT                   WSSGGDVGPVLDKLEAAMADGQLSQERVDEALTRVLTAKGVCG"
FT   gene            complement(181493..181906)
FT                   /locus_tag="Svir_01730"
FT   CDS_pept        complement(181493..181906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01730"
FT                   /product="sporulation and cell division protein, SsgA"
FT                   /note="PFAM: Streptomyces sporulation and cell division
FT                   protein, SsgA"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95260"
FT                   /db_xref="GOA:C7MSE7"
FT                   /db_xref="InterPro:IPR006776"
FT                   /db_xref="InterPro:IPR038658"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE7"
FT                   /protein_id="ACU95260.1"
FT                   /translation="MDNNAVQQSQFVYLSGCETPVLSRLTYVPGAPFTVTMAFKVAPGE
FT                   WVEWEFARDLLITGLHAPAGIGDIRIRPDLPGQSDDMLVIELESPDGYAAVEISRNDVQ
FT                   RFVDATLARVPLGYESERLDIDTVIACLTTTRP"
FT   gene            182357..183046
FT                   /locus_tag="Svir_01740"
FT   CDS_pept        182357..183046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95261"
FT                   /db_xref="GOA:C7MSE8"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE8"
FT                   /protein_id="ACU95261.1"
FT                   /translation="MLDRTGILSASATSLDVDSDLPDDAYRPRTYRSRIFGLATVALML
FT                   AVAVIGVLDREHRRTEVARNVVDGVDDVEDSPDVDEVERVPIASSSHPSPSVLHVPGHE
FT                   AVSVPRPSNAQVAPSAPEVRLTEVKDRPERSPSPSGAPTEVGLPTQDRERVPAEVLRVD
FT                   RSEPPMPTQLPGADGSDEMLDIPVPASWCREHEQWWATSDGRWGDERDPRRSETIRTSA
FT                   SVRPGNS"
FT   gene            183215..184243
FT                   /locus_tag="Svir_01750"
FT   CDS_pept        183215..184243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01750"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal; 3-Oxoacyl-[acyl-carrier-protein
FT                   (ACP)] synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95262"
FT                   /db_xref="GOA:C7MSE9"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSE9"
FT                   /protein_id="ACU95262.1"
FT                   /translation="MQVSTQNARGAAVLAGLGGWLPPRVVDNDELSRRLDTSDEWIRTR
FT                   TGIARRRVVDPGMSTTDMAVEAGRRALDSAGEYGEDIDALVLATSTPDHPCPASAPEVA
FT                   SALGLKEAAAFDVAAVCSGFVYALATAVGLISGGVAGRVLLIGADAFTTLLDPDDRTTV
FT                   PIFGDGAGAVVLREGSPDELGAIGPFDLGSDGELKDLLIVPAGGSRKKASDDPRDHFFT
FT                   MQGQAVFRHATAKMASSSRKVLEKAGWTTTDVDRFVGHQANIRILQAVAKNLGLPVDSL
FT                   VVNLEHTGNTSAASIPLAFVDGVVDGTLQEGDRVLVTAFGAGLTWGSTVLRWPALRCAP
FT                   LP"
FT   gene            complement(184258..185742)
FT                   /locus_tag="Svir_01760"
FT   CDS_pept        complement(184258..185742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01760"
FT                   /product="family 3 adenylate cyclase"
FT                   /note="PFAM: HAMP domain; Adenylate and Guanylate cyclase
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95263"
FT                   /db_xref="GOA:C7MSF0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF0"
FT                   /protein_id="ACU95263.1"
FT                   /translation="MSARLRAVLRTSLGFATIGFGTSFCGAALVLLLLSLQGLPDALDP
FT                   ERWVIPVSALGYVLLAFAVGTVWAGYLQRRTVMWFLTDREPTAQEAMRALRIPLDLAVV
FT                   SGTLWAAGAVLFGVLSVVFGSWLDALGVVLTIVLGGFATTGLTYLAAERVARPLLSVSL
FT                   RVAGPRRVASANTVLTRLVVTWGLSSGVPLVGVLLLLLPPDIGREDPTSSLLVLALIGL
FT                   VVGALATALFARAVAAPLHRLRSALHDIGAGRRDVSVGIDDAGEIGMLQASVNDLAAGL
FT                   RERERLRDLFGRHVGDDVARHALEHGISLSGDVREATALFVDVADSTTLAAELPPDEVV
FT                   RRLNRLFEVVVEATNANSGLVNKFQGDAALCVFGAPDRHADSATAALRTARAIRDAVRE
FT                   AGELDIGVGVATGQVFAGQLGAPSRMEYTVIGDAVNEAARLTEHAKQVPGRVLASGPTI
FT                   EAATATERARWHEHAALRLRGRSAPTVTWTDSPDSP"
FT   gene            complement(185827..186867)
FT                   /locus_tag="Svir_01770"
FT   CDS_pept        complement(185827..186867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01770"
FT                   /product="Ku protein"
FT                   /note="PFAM: Ku70/Ku80 beta-barrel domain; TIGRFAM: Ku
FT                   protein, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95264"
FT                   /db_xref="GOA:C7MSF1"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF1"
FT                   /protein_id="ACU95264.1"
FT                   /translation="MARAIWSGALNFGLVTVPIELYSATQDHTIHFRQFQRGTSDRIRY
FT                   LRVNERTGEEVPYDQIVKGYDLGGDKYVIIEPEELDEIAPGRSRTIDIDVFVDLEEIDP
FT                   IYFQKTYWLAPAKDEFARAYTLLIEAMSRTNRVGLARFVMRGKEYLAAVRASTGVLALN
FT                   TLLFPEDIRSPQQEIDKLPTAVRPREKEIDMAVNLIESMTDQWRPEQYHDTYNERVMQL
FT                   IEAKRVGRTVTPAEPPREATQVVDLFEALSRSVESRRKGRRGTGAESGRTRGRPSEPQQ
FT                   DTGARAAQPQGKRKRTEPDLSEVTKGELDRMARDLDIKGRSKMRRDELEKAVKKAERQL
FT                   ARRRAS"
FT   gene            complement(186899..187441)
FT                   /locus_tag="Svir_01780"
FT   CDS_pept        complement(186899..187441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01780"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: DNA ligase D, 3'-phosphoesterase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95265"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF2"
FT                   /protein_id="ACU95265.1"
FT                   /translation="MFTDMANRDALGIAPATPHLRCSVRARGPVEAHHPRSRYVIERQG
FT                   VSGPHYDFRLLLGDVAACWAIPAEPSLTPGDKRLAIRSDSPSPASSETDPAAVWDMGTV
FT                   ANLGELSWEHALAEGQLSLRLSGERIHGVFVMVRAHRGSDQEQWLLITKGTDVEVGDLT
FT                   PYRTGSPFVAGPTKDAG"
FT   gene            complement(187629..188432)
FT                   /locus_tag="Svir_01790"
FT   CDS_pept        complement(187629..188432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01790"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   Sigma-70 region 3; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; RNA polymerase sigma-70 factor,
FT                   sigma-B/F/G subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95266"
FT                   /db_xref="GOA:C7MSF3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF3"
FT                   /protein_id="ACU95266.1"
FT                   /translation="MTESTTQGSRTPSDDYQHLTPLFEEFAALDPDDPRRAELRDRLVT
FT                   GHLPLAEHIAQRFSGRGVAKEDLVQVARVGLINAVDRFDPSRGSDFLSFAVPTVMGEVR
FT                   RHFRDTGWVIRVPRRLKELHLSINNASTQLSQRLGRAPTPSEIADHLGLTLEEVFEGLE
FT                   AGNAYHSMSLDEVLSADTENLALGDTLGEEDAALAGVENHETLQPLVKQLPERERTILA
FT                   LRFVHNMTQTQIAERIGISQMHVSRLLARTLKKLREGLVEEDNIG"
FT   gene            complement(188429..188947)
FT                   /locus_tag="Svir_01800"
FT   CDS_pept        complement(188429..188947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95267"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF4"
FT                   /protein_id="ACU95267.1"
FT                   /translation="MVHYGLHADYCGWETLNGRQNTEVTVTETKPPTSPTSTSVGAQDD
FT                   IELRLGASLVHLPIIRSVAASIAMRADFDLDSIADLRLAVDEACSTLITRALPDSTMTC
FT                   RFTIDEDQLLFRGTVLSTETEAPSTTSFGWRVLTTLADAASAWTEQHPENGQRNWIHIE
FT                   LAKRKPAFT"
FT   gene            complement(188956..190056)
FT                   /locus_tag="Svir_01810"
FT   CDS_pept        complement(188956..190056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95268"
FT                   /db_xref="InterPro:IPR040701"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF5"
FT                   /protein_id="ACU95268.1"
FT                   /translation="MDTTRLRELATTDGPFASVYFDDTHNTESAAKELELTWRELRDRL
FT                   AEQNAPEQALDALEDAILDGEPPTGERCGRGLVATPDGVVLDRRLTEPPARSVTRVSER
FT                   PYLVPLIEHGERPPPHVVAVVDRVGADVTAVDADGEVIDSRTVEGTDHYIHKIPGGGWS
FT                   ERNIDRHADELARQNIELAAEHTTDVARRLGAPLVVVAGEPQARKTLLEALPQPVRGHA
FT                   TEVQPGGRHKGAGNRELEERIDELLADVTRARKDEAVERFSQAVAMPTGLGVAGLESVT
FT                   AAFRDHNVETLLIGVPGDVEVFTGPEPTMVAVQKEALQAQGIDEIGRARADEALVLAAI
FT                   TLNAEVIHVGDRIDLTEGFGAILRHD"
FT   gene            190230..191018
FT                   /locus_tag="Svir_01820"
FT   CDS_pept        190230..191018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01820"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95269"
FT                   /db_xref="GOA:C7MSF6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF6"
FT                   /protein_id="ACU95269.1"
FT                   /translation="MIWWHAVLITLAGVWAGMINTVVGSGTLVTFPVLVALGYPPVTAT
FT                   TSNAIGLAPGSISGAIGYRHELRGQRQRLLSFLPASLIGAICGAVLLLSLPPDAFETVV
FT                   PVLVGLAVVLVIVQPRVSSWVLRRREERKRKQGASGPGVGGSVLVITLIFLIGVYGGYF
FT                   TAAQGVMLMAVMGMLLDESLQRLNGVKNVLSAVVNVVAGTVYAFVAPVNWAAVALLAVG
FT                   SIIGGLLGAKIGRRLSPTALRSVIVIVGVAAMVQLILRQL"
FT   gene            complement(191138..192193)
FT                   /locus_tag="Svir_01830"
FT   CDS_pept        complement(191138..192193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01830"
FT                   /product="aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95270"
FT                   /db_xref="GOA:C7MSF7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF7"
FT                   /protein_id="ACU95270.1"
FT                   /translation="MSAIPTRADLAALPAYVPGRTVPGAIKLASNEVPEGPLPSVVDAI
FT                   TKAGTEINRYPDMGAWALVDRLANEFDVPASRVAVGCGSVSLCQQFVQALCAPGEEALF
FT                   AWRSFEAYPIVTQVAGATPVRVPLTASHHHDLDAMLAAITPRTRLVFVCNPNNPTGTAL
FT                   RTEELTAFLDRVPSDVVVVLDEAYREFVTDPDVPDGMELARAYRNVAVLRTFSKAYGLA
FT                   GLRVGYAVAAEEVIEAVRKVYVAFSVNAVAQAAALASLDAKDELLARCDDIVRERTRVH
FT                   DALRELGYAVPETLANFVWLPLGERTNAFAEHALENKVVVRPFAGEGVRVTIGTPEEND
FT                   VFLAAARSFLA"
FT   gene            192305..192970
FT                   /locus_tag="Svir_01840"
FT   CDS_pept        192305..192970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01840"
FT                   /product="dienelactone hydrolase-like enzyme"
FT                   /note="PFAM: Dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95271"
FT                   /db_xref="GOA:C7MSF8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF8"
FT                   /protein_id="ACU95271.1"
FT                   /translation="MTQTHTQDYERSDGRRLRLTYAEPDGAVRGGLVVLHEMGGVTDAA
FT                   RFLVASLAAEGWLAVTPELGRFDADEDGVGQAGQTLLSATDTAFAWLVQRGVFGDQLGV
FT                   VGFDLGGTAALVVAANRKLGAAVSVGGRGISSPASPALPALVNIAGTLTSPWLGLYGDN
FT                   GDEASQAEVERLKEEAAKAKVATNVVRYPGASHRFDADPEAAAEAWQRVLAWFDAHLR"
FT   gene            193147..193563
FT                   /locus_tag="Svir_01850"
FT   CDS_pept        193147..193563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95272"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSF9"
FT                   /protein_id="ACU95272.1"
FT                   /translation="MSGAEASLVPVSRELDAVGARVRTGQLRLDREAAQRLLDELSAVR
FT                   SRVETLITQASADGIDRSLRFGDNIVAHVMGDRLRGAASGGTDAAIPVLERFLAQLEKV
FT                   SDIVSRAAGLVTDEDEEAAGRLDSIGRQTSGRRS"
FT   gene            193560..194636
FT                   /locus_tag="Svir_01860"
FT   CDS_pept        193560..194636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95273"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSG0"
FT                   /protein_id="ACU95273.1"
FT                   /translation="MNNEDNVTIPEVPEILPPIVCLPWPLPEPPLAPEHFHDEIDWSTF
FT                   SHEELYRMATTGLDLEGANEVAAEWSRLGAELDDIGAELRRMLDVAADAWQGEAAEQTR
FT                   DTLQRLVAWTEETADASNRVCGCVTEQADLAARTAHEMPPPPPRKPPFFGPPASGTPVF
FT                   ALGAEFVEDPASERDRITTAHHHAAEVMRRYQEQSRDVYTRVPTFPDPAPDMGVKRTPD
FT                   EPEREDSPEDTTTASAVVGGGIQGLAGGVAAPGSSPGTYSGSGTGGTPGGQAAQGLGTG
FT                   AGQVVASSTPAVSGAVGGRGATGMGAMPMAGMGARRKEEDIEHRRPSYLEEDEDLWHGQ
FT                   TLPTPPVIGEEPRHGGRF"
FT   gene            194633..195421
FT                   /locus_tag="Svir_01870"
FT   CDS_pept        194633..195421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95274"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSG1"
FT                   /protein_id="ACU95274.1"
FT                   /translation="MRLGDSGWFSLHPGEFFLLWTGLGLGELPPALGVASAGRTSAARA
FT                   RLRDSVDRSLQERGLGTVGEPDRDVAALLEALAASTVRADLEIVTEGGTFRAVGGSGPY
FT                   GHVTAGFVEDELEIKIGPVSEYTLVSTMFGAVDPLPAGVGSPGNVPVEDYLRACRAGEH
FT                   GGADAFLDVLRGAGARPVEANTFLRAIRDARSAGRFGVGVDDGAGRWSRASSTVNWVDT
FT                   AAGRYALRRKDGWVTVTPVDPQRLLGMAEELVGEVAPGRL"
FT   gene            195495..197516
FT                   /locus_tag="Svir_01880"
FT   CDS_pept        195495..197516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01880"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="PFAM: AMP-binding enzyme; TIGRFAM: acetoacetyl-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95275"
FT                   /db_xref="GOA:C7MSG2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSG2"
FT                   /protein_id="ACU95275.1"
FT                   /translation="MRADSADSSGHDVSQGAADDAPEMLWRPTEEQVEGTRIADFRKWL
FT                   RDNRGVDVADYDELWSFSVNSIPEFWSAVADYFGVRWHTKPAEVLSDARMPGARWFPGG
FT                   TLNYAEHALLPVAGAKKADDDFAVIFHREDGVERLLTYGQLRAEVAAARAALRELGVGK
FT                   GDRVVALAPNCPETLVAFLAAASLGATWSSCSPDFGVRAVADRFTQIEPKVLIAVNGYV
FT                   YNGRAFDVRPTVERLREELPTLAATVLVDYEGGGRVQGALDWKTLLAEHAGAELEFEPV
FT                   ESDHPLWVLYSSGTTGLPKGIVQGHAGITVEHLKALALHCDLGPGERFFWFTTTGWMMW
FT                   NFLVSGLLVGSTIVLYDGSPGYPDLRTLWRLAEQHRVTYFGTSAPFVQSCLKKGLRPGA
FT                   EFDLSAMRALGSTGAPLTVEGFRWIADAVGRHVQICSVSGGTDLCTAFVGSAPDVPVWL
FT                   GELSCRSLGAAVESYDDAGNPVVDQVGELVITKPMPSMPVFFWNDPDGTRLREAYFEDF
FT                   PGVWRHGDWIKITSRGSAIIYGRSDSTLNRGGVRMGTSEFYRIVEGFDEVLDSLVIDTS
FT                   AAGDEGELLCFLVLAEGASLEDLEQPLRQELRKALSPRHVPDRFVLVDEVPRTLNGKKC
FT                   EVPVKKILKGVDPDRAVSRDALANPDALAPFVAYASGK"
FT   gene            197608..197700
FT                   /locus_tag="Svir_01890"
FT   tRNA            197608..197700
FT                   /locus_tag="Svir_01890"
FT                   /product="tRNA-Ser"
FT   gene            197761..197836
FT                   /locus_tag="Svir_01900"
FT   tRNA            197761..197836
FT                   /locus_tag="Svir_01900"
FT                   /product="tRNA-Arg"
FT   gene            complement(197942..199176)
FT                   /pseudo
FT                   /locus_tag="Svir_01910"
FT   gene            199179..199388
FT                   /pseudo
FT                   /locus_tag="Svir_01920"
FT   gene            complement(199420..200145)
FT                   /locus_tag="Svir_01930"
FT   CDS_pept        complement(199420..200145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01930"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95276"
FT                   /db_xref="GOA:C7MSR5"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSR5"
FT                   /protein_id="ACU95276.1"
FT                   /translation="MTVDEKKRAVREHVWALLEEHRAAPAGVHGRIPAFFGAEKAADRL
FT                   AELPEWQSAKIVKAVPDTAQQPVRARALDEGKLVYMAVPKLAEPRPFYLLDPDTLPVSP
FT                   AEAADKGAAAKVGQAVDVDSMRPPDLIVCGSVAVNRHGVRLGKGAGYSDIEVAFLQEAG
FT                   LIGPETTIVTTVHDLQVIDDDLPETRHDFSVDIIVTPTTVIRCDEPRRPSGLLWDDLPA
FT                   EKIAAIPALAARLRQQSNA"
FT   gene            complement(200158..201240)
FT                   /locus_tag="Svir_01940"
FT   CDS_pept        complement(200158..201240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95277"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSR6"
FT                   /protein_id="ACU95277.1"
FT                   /translation="MDPKTIRRWESGETEEGPQPWLRPKLAQCLQVSPEQLEELLAGDD
FT                   EPATNDRVDYSLRNPAAADLRTVADLRDEVHDLDKRYDSAPSTSLLARTGHCLGQVAFL
FT                   RANASNHRVRHELLAVETEAATLMGQLVWDASQRRDHATAHDYFDQAISAAQRLRDPTA
FT                   EGRALLRKSFVALYGERAPETGLQLTMRTTEVVAGSSHVLAGLALLHTAEAYAMLGRQR
FT                   DCERALRDADSRIERIGEADAALNLFSPTQPGRLAGSCYLFLGKPKLAQPILETTAHQL
FT                   RDRSKSQAIVLGNLALAYLRQRRLDEAVGALHRAVDVVEATRGGGGLNIVFSACRELRP
FT                   WRNVDLVQDVYDRVMTLMTA"
FT   gene            201492..201689
FT                   /locus_tag="Svir_01950"
FT   CDS_pept        201492..201689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95278"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSR7"
FT                   /protein_id="ACU95278.1"
FT                   /translation="MTSQNSHRSEVVHDSLRVFLDDLAARAAVVLSEHINVGNHCAACG
FT                   LTWPCSRAVLADHNLEMAHP"
FT   gene            201905..202429
FT                   /locus_tag="Svir_01960"
FT   CDS_pept        201905..202429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01960"
FT                   /product="Protein of unknown function (DUF742)"
FT                   /note="PFAM: Protein of unknown function (DUF742)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95279"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSR8"
FT                   /protein_id="ACU95279.1"
FT                   /translation="MQAHARDWRLDQRCANTASGVVGEFVAHSIATAGTADSGSSHVGE
FT                   PARSGLIAVRLLLMARSLVIQVWDNHESAPTSLSESPFQADIEDWGYDLPRPGRRVVWC
FT                   VITRQNRGIDDTVRLSPVLPRRERKRYPEPRVLINPLRDIRLLQRVLDGLRSLDRSAEK
FT                   ETNTDHLRRAG"
FT   gene            202588..203559
FT                   /locus_tag="Svir_01970"
FT   CDS_pept        202588..203559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01970"
FT                   /product="predicted dehydrogenase"
FT                   /note="PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95280"
FT                   /db_xref="GOA:C7MSR9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSR9"
FT                   /protein_id="ACU95280.1"
FT                   /translation="MVGLGKQALEDHVPGLLGSDAAELVAICDENDAVLREQQYRLQVN
FT                   GYANVEAMFDAEQLDFVVVCVPHDAGRQIIEAAASRGIHVLKEKPFATTLSEAKELAKE
FT                   CERAGIHLMVTLQRRFNPIYTSFHQLADQIGTPFVVDAAYTLHIADPSEGWRGHINRAG
FT                   GGCVIDMGYHLVDMLLWYFGLPDRILADMSINARPDRDYDAEDTALIHFSYDSGLYGSL
FT                   LLSRFIGPKTEQIRLVGSKGIVHLERGRIQRLTNDGEVVESLAREQAWPSAAVSQVNHF
FT                   CRVVEGLRPNVSGPRENLAHLSFIQGCYESARTRTYVNPKEL"
FT   gene            203560..204816
FT                   /locus_tag="Svir_01980"
FT   CDS_pept        203560..204816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01980"
FT                   /product="predicted PLP-dependent enzyme possibly involved
FT                   in cell wall biogenesis"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95281"
FT                   /db_xref="GOA:C7MSS0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS0"
FT                   /protein_id="ACU95281.1"
FT                   /translation="MKALAVNGGTPVITEPGPHFTWPPITPNTTKAVLDQLETSVSIYD
FT                   RSGVIAELEDALKDYFGVRHAVLTSSGTAAIHSAYAAAYVEPGDEVIVPAYTFLATATP
FT                   LLHLGAIPVLADSDETGNVSVADVEERITDKTTAIMATHLWGLPAAVDQLRQLADEHGL
FT                   LLLEDASHAHGAIVADRKVGTFGHIAAFSMNGPKPLSAGEGGFALTDDDELFYRLLLHG
FT                   HYNKRCRTEIPTQHLAHRYAVTGMGLKFRIHPLAASIALDQLANLDEYLTGRQRIADYL
FT                   CRELAQLPGLAVPAVPAETRPAWYGLPLTYVPDELGGLSIERFHQALLAEGLREIDRPG
FT                   STCPLNLLPLFQDPDPMLPGYRHANRVAYRPGQFPVAEQVWRHTLKLPVWHREEDLPLV
FT                   DRYLEGIRKVIDNHEELLG"
FT   gene            204823..205272
FT                   /locus_tag="Svir_01990"
FT   CDS_pept        204823..205272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_01990"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="PFAM: NUDIX domain; TIGRFAM: mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95282"
FT                   /db_xref="GOA:C7MSS1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS1"
FT                   /protein_id="ACU95282.1"
FT                   /translation="MIDASVFAELAAHATGDGVQQLVVGAVVQADGKVLLLKRPADDFM
FT                   GGIYELPSGKVEGGEKLDAALVREVAEETGLTVTDIVAYLGSFDYTSGSGKKSRQFNFA
FT                   VGVAKSGPVRLSEHDSHLWVPLDEQPPVTDAVEEILRIHRRFHQA"
FT   gene            complement(205450..205878)
FT                   /locus_tag="Svir_02000"
FT   CDS_pept        complement(205450..205878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02000"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95283"
FT                   /db_xref="GOA:C7MSS2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS2"
FT                   /protein_id="ACU95283.1"
FT                   /translation="MALRVGDLPRSIEFYSKLFDTEPAKRRPGYANFAITEPPLKLVLL
FT                   EGEPGQPTVLDHLGVEVESTEQVEQAARRLADEGMKTLVENGTTCCYAQQDKVWVHGPG
FT                   QEPWEVYTVTGDSATFSADSADSAGSAASTTPDTCCPT"
FT   gene            205975..206352
FT                   /locus_tag="Svir_02010"
FT   CDS_pept        205975..206352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02010"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95284"
FT                   /db_xref="GOA:C7MSS3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS3"
FT                   /protein_id="ACU95284.1"
FT                   /translation="MSKQLPLAAMDACCSPLVRAPLTQEQAVELSRLFKAMADPVRLRL
FT                   LSLIASHAGGEVCVCDLTDAFDLTGPTISHHLKVLRESGLITGERRGTWVYYRVHPEVL
FT                   ARLSAVLTPEGSEVETASSAK"
FT   gene            206467..206556
FT                   /pseudo
FT                   /locus_tag="Svir_02020"
FT   gene            complement(206614..207639)
FT                   /locus_tag="Svir_02030"
FT   CDS_pept        complement(206614..207639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02030"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95285"
FT                   /db_xref="GOA:C7MSS4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS4"
FT                   /protein_id="ACU95285.1"
FT                   /translation="MPTAARPPDRTHPAARTVTALVSTVLLTIGIAACSTPTVDDIPPH
FT                   AVATHDDPAFRDVFRHGFADVDGVRMHYVAGGSGSPVVLIHGWPQTWYGWWPIMPALAE
FT                   HHTVYAVDLPGLGDSTGRPTGYDKATLARYVHTLIADRLGVRDATVVGHDFGAAVAFQY
FT                   ASQFPDDTVRLGYFDLPLPGPAIDATTYRTLSWHIAFHSQHRLPEAVVSDDVRDYLALF
FT                   YPQVSFGGTAFGGESDRSPFTDAEIDEYARTYSRPEVLSGGFELYRALDKDVDDTIAAA
FT                   PVRVPTLLLTAQGQLDAVQATVAPRMTNIVRAVDVPRAGHWLVEENPEFVTTELLRFLE
FT                   G"
FT   gene            complement(207835..208461)
FT                   /locus_tag="Svir_02040"
FT   CDS_pept        complement(207835..208461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02040"
FT                   /product="methyltransferase family protein"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95286"
FT                   /db_xref="GOA:C7MSS5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS5"
FT                   /protein_id="ACU95286.1"
FT                   /translation="MHTTDAVTFWDDVHASRPATTGPRPNVRLTEIVTGLPPGDALDLG
FT                   CGNGGDALWLAGQGWHVTAVDISTVAVERLTALAASGDLADRVTAVRCDLGESFPAGEF
FT                   DLICAHYLHTPFDLDRATVLRSAAHALRTGGRLLVVDHGSTAPWSWNQDPDVRFPSPQE
FT                   VAEDIGLDWTKWTIERAEAPRRIATGPNGHTAEVIDHVLLIRRTV"
FT   gene            208550..209155
FT                   /locus_tag="Svir_02050"
FT   CDS_pept        208550..209155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02050"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Helix-turn-helix; Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95287"
FT                   /db_xref="GOA:C7MSS6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS6"
FT                   /protein_id="ACU95287.1"
FT                   /translation="MDRDTNDVLAAVGPRLRALRRHRGITLAELATATGVSESTLSRLE
FT                   SGQRRATLELLLPLARVYNVPLDDLVGAPRTGDPRVHLTPIHRFGMTFVPLSRRPGGVQ
FT                   AFKMIIPARPEPAEPTPQTHDGFEWLYVLNGRLRLVLGERDLTLQPGEAAEFDTSLPHW
FT                   LGSADGGVVELLILFDPQGVRTHIHTAPHRPPHGESRR"
FT   gene            complement(209362..209856)
FT                   /locus_tag="Svir_02060"
FT   CDS_pept        complement(209362..209856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02060"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF421)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95288"
FT                   /db_xref="GOA:C7MSS7"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS7"
FT                   /protein_id="ACU95288.1"
FT                   /translation="MDIVLRVLAIYLILVVLFRTMGKRTMAQVTTVDLVLLLVISEATQ
FT                   QAMLGDDYSITTSALAIITLMFVDWMADLLKFKSTKFSRLIEGAPIVLVEHGKPLETRM
FT                   RKEHININDVLLAARKQQGLLHLTQIEYAILESSGDISIIPASDAAKQEHVDRTTSAPD
FT                   G"
FT   gene            complement(209878..210471)
FT                   /locus_tag="Svir_02070"
FT   CDS_pept        complement(209878..210471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95289"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS8"
FT                   /protein_id="ACU95289.1"
FT                   /translation="MYPGSLTCGFEPVPVGKAPLIRVGEAEVGDDRSDIADLIGESPSS
FT                   QHREWVLNRLVQAVLTVIVLAGLAGAWGEGVSSEVEATGADGRLRVTYERFVRNLGQTR
FT                   LQVRFPPGSAQQGSIRLFITQDYLADNEITTVTPDADTVTADGDRLVYEFPVPNGGPLT
FT                   VTFDLRPNSGLGVLNATVGGSTVDSVQLWQLVYP"
FT   gene            210724..213018
FT                   /locus_tag="Svir_02080"
FT   CDS_pept        210724..213018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02080"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function DUF262; Divergent
FT                   AAA domain; Uncharacterized conserved protein (DUF2081)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95290"
FT                   /db_xref="GOA:C7MSS9"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSS9"
FT                   /protein_id="ACU95290.1"
FT                   /translation="MASTLYRDTGFTLMHLVEDIKEGRLALPDIQRPFVWPTAKARDLF
FT                   DSMYRGYPVGTLMFWQTDADPGSTRQIGTGAVERVPQLLVVDGQQRLTSLYAVLTGEPV
FT                   LTKSYESKRIRIGFRPEDETFVVTDAAIENDPEFIPDITKLWEQGYKGVIRRFMDRLEE
FT                   LSGGSLSDSDRERLEERIDKVRSLREFRFQVIELDADEEQVAEIFVRINSEGVQLNQSD
FT                   FILTLMSVHWEKGRRELEAFCRAAVEAGPSDLSPRNPYLEKPSPDQLLRVGVALAFRRA
FT                   RLQHVYSILRGKDLDTGKVSAELRERQFEKLEQAQQLVLDLDNWHEFLECLRFAGFRNR
FT                   KMITSDATIVYSYALWLIGKHDFNLDTKTLRRVIGRWFFMTHTTGRYTNSPESQFEFDL
FT                   GRIADLKPGDGDAYVAELDRVVRANFTNDYWTISLPNRLDTSSSRSPVWFAYLAALNLL
FT                   DAELLFGGGKVKDSIDAAMTRSRSIERSNLFPKRYLAGHGVTSARQINAIGNMALIDWS
FT                   SDPASSEADPAQYWPILSARLGGERLKDHMRWHALPVGWEQLDYPEFLEKRRSLIAAVV
FT                   REAFERLWDGQPANHSLSIEELIRSPESQNLEFKTTVCRNMRTGEVDRARSHVVVKTVC
FT                   GFLNAEGGSLVIGVGENDAGNEVIGVEGDMATLGKSKANQDGYEMYLRQVLDANLSVPT
FT                   VSTVKIRFHQVRGRTLCELAVAQSGRPVFAKPPKHQGSSKATDFWVRVGNATKQLHGDD
FT                   MVRYQEDHWGQ"
FT   gene            213175..213465
FT                   /locus_tag="Svir_02090"
FT   CDS_pept        213175..213465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST0"
FT                   /protein_id="ACU95291.1"
FT                   /translation="MTPIRRVLASALLTATALTVGAGIAQAAAPEAATAPGDTVRTEQV
FT                   DRDRQGPEGETTQADDAETAMEVLRILLGPSSPLGDMLELDLEGLEGVLLS"
FT   gene            213634..213831
FT                   /locus_tag="Svir_02100"
FT   CDS_pept        213634..213831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95292"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST1"
FT                   /protein_id="ACU95292.1"
FT                   /translation="MADETRRPDREEGAEADETQLGKARRSIEEAKKEVEADHRVAETQ
FT                   QGSESLPLDSPTQHETGHST"
FT   gene            complement(213848..215386)
FT                   /locus_tag="Svir_02110"
FT   CDS_pept        complement(213848..215386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02110"
FT                   /product="asparagine synthase, glutamine-hydrolyzing"
FT                   /note="PFAM: Glutamine amidotransferases class-II;
FT                   Asparagine synthase; TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95293"
FT                   /db_xref="GOA:C7MST2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST2"
FT                   /protein_id="ACU95293.1"
FT                   /translation="MIAISGIVAAYGPFDPLEGMRMLDRLTHRGPDGQGTQALDHAWLG
FT                   HRRLAVVDLEGGAQPLRDPNGRYWLVGDGEIYNYERLRHELEARGHTFRTRTDQESALH
FT                   LLEDEGTEALSRLWGMFAFAGATVDGRFFAARDTMGLAPLYWARQDGTVVFSSELKAFD
FT                   PHRRPDVELFPPGHVWSPQDGLTEFRPLPEVEPIAPTVANHEDPEPPEEVFATIRDRLI
FT                   HAVERYTEADVPVGALLSGGLDSSIVTAIAARHAQRKGRKFRTFAAGLVDSDDVLAARE
FT                   VAEALGTEHSERLYTNDELIDWMPEVIRVIESFDPQLLHSSVPNLLVSKRAARDVKVVL
FT                   LGEGADELFAGYGYYGEISGEAELHETLLSAIRDLHMGGLQRVDRVAGATGLEPRTPFL
FT                   DLDVVELGLSLPARWKLSSGSRPEKWLLRKAFDGWLPESVLWRPKAQFGQGTGSRDVLG
FT                   EYYASTVSKEEFENERYVLDPPLHSREELAYFRMFQRELKGVDPQRLVGRFEGW"
FT   gene            complement(215492..216076)
FT                   /locus_tag="Svir_02120"
FT   CDS_pept        complement(215492..216076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02120"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95294"
FT                   /db_xref="GOA:C7MST3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST3"
FT                   /protein_id="ACU95294.1"
FT                   /translation="MTQQLGTPRRRDAVSNRAAILRAAAAAFSERGRAVDVREIARCAG
FT                   VGMGTLYRHFPSKDALIETLLTESYARWVDQARRSARARASAWEALESFITDALTFQRR
FT                   DRAVLENLAAATTDATGVSVCQRLLRPLVEELVTAAHTEGALRPGVRADDVLAVLAALG
FT                   RLVELDTSAEAVRRCLQIVLSGLRNGGELTP"
FT   gene            216180..217169
FT                   /locus_tag="Svir_02130"
FT   CDS_pept        216180..217169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02130"
FT                   /product="flavin-dependent oxidoreductase, F420-dependent
FT                   methylene-tetrahydromethanopterin reductase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95295"
FT                   /db_xref="GOA:C7MST4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST4"
FT                   /protein_id="ACU95295.1"
FT                   /translation="MTVKYSILDLAVIGRGETPKQALEASVALAQRAEETGYHRVWYAE
FT                   HHNFSSIASSATSVVIAHVAAHTSTIRLGAGGIMLPNHSPLVIAEQFGTLATLHPGRID
FT                   LGLGRAPGTDQNTLRALRRDPTSADAFPHDVRELQGYLRGESLIPGVDAIPGKGTNVPL
FT                   YILGSSLFGAQLAAALGLPYAFASHFAPDALRQAVALYREQFRPSEQLQEPYVIAGVNV
FT                   IAADDEDDAQEQYLTMKRQRVNLLLGRRGHRFTDEEADQILASPHGAHIHNMIKYTAVG
FT                   TPEKAKAFLDDFAVHADADELITAHQSPTVKQRLRSVELLAQVAGLMS"
FT   gene            217270..217569
FT                   /locus_tag="Svir_02140"
FT   CDS_pept        217270..217569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95296"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST5"
FT                   /protein_id="ACU95296.1"
FT                   /translation="MSGQRDEQGDDMATHEETLAQLYQGVEHCENIHNAIQHALLMATN
FT                   LSESLQNSLGGTGAYDEVGGYSESVLTQLQLSAQTVEQTKQAIENLMARFEIVY"
FT   gene            complement(217633..218310)
FT                   /locus_tag="Svir_02150"
FT   CDS_pept        complement(217633..218310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02150"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95297"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST6"
FT                   /protein_id="ACU95297.1"
FT                   /translation="MTRRALATLPHRVYDDALTLWDYHVLRHAPRRSDVGIGLGSHDLG
FT                   VAEHAATLFHEGRFELLVFTGATTATTARLFPRGEAAHYRERALELGVPDDAVLVEPHA
FT                   RNTGENIRFTRRLLADSGITVRTATLVCKPYHQRRAYATTRKQWPELDVHCSAERITLD
FT                   EYMDAIGDADRVVHMLVGETQRILVYARRGFTIAQEVPAEVDAAYRRLVSAGYVSRLVQ
FT                   EGL"
FT   gene            complement(218381..218755)
FT                   /locus_tag="Svir_02160"
FT   CDS_pept        complement(218381..218755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95298"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST7"
FT                   /protein_id="ACU95298.1"
FT                   /translation="MTPKLFESVEAYNAAHPASPFPADRHARSVLRGYRAAMQGVTDDV
FT                   TGTGSGASLTVDFLPGGAPLPDESDRVGNVVASRWGEGPVLVLAENVSLRTAWEAIKEA
FT                   WPKYLSEVRTALEPIRKADA"
FT   gene            218917..219318
FT                   /locus_tag="Svir_02170"
FT   CDS_pept        218917..219318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02170"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR, DNA binding; MerR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95299"
FT                   /db_xref="GOA:C7MST8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST8"
FT                   /protein_id="ACU95299.1"
FT                   /translation="MRIGAVSARTGLSLRTIRYYEEVGLVTPSARSQGGFRLYTEPDVA
FT                   RLNLIRRMKPLGFQLDEMRELLGLLYPEPRADDEPAVLEEHELRRLREFTEKAERRCLE
FT                   LRATLDTAEEFAALLRDRLARHTERARKT"
FT   gene            complement(219362..220330)
FT                   /locus_tag="Svir_02180"
FT   CDS_pept        complement(219362..220330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02180"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95300"
FT                   /db_xref="GOA:C7MST9"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C7MST9"
FT                   /protein_id="ACU95300.1"
FT                   /translation="MTETTETIETTDSSRLDKARGLLFGLALGDCLGAPFEGRTDATHA
FT                   DIVTAENAAGPLVHTDDTALALVLARHLAHRRATRGDGRGGYIDRDVLAREFARTWEAE
FT                   PWRGYGGGVTKTFQLIVSGTPWPEASRAVFPEGSFGNGGAMRVAPVALVGGDVDRVVEL
FT                   ARRSTEVTHAHADALHGAVCQAVAAYHALHLDRAESVRARAFVEPLREVLPSPLWRERL
FT                   DRVVELSEQHADPGQAAVALGNDVSALASVPLALLSFLRNAGRPEEVIRFAILAGGDTD
FT                   TVAAMAGALAGAHRGFAALSPHVVDRLEAAGSLHHYAGLLV"
FT   gene            220674..221573
FT                   /locus_tag="Svir_02190"
FT   CDS_pept        220674..221573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02190"
FT                   /product="spermidine synthase"
FT                   /note="PFAM: Spermine/spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95301"
FT                   /db_xref="GOA:C7MSU0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU0"
FT                   /protein_id="ACU95301.1"
FT                   /translation="MSELREPLTRGLSQLWELDRVIWEGDTAFQHVVIAETEQGVSLFC
FT                   DNDPQSTELAQRHYHDALFVPAALLAERVERVLAVGSSEGVISQLAVAAGATHVDHVDI
FT                   DREVVELCAEHLPYGYTPEELERAERGDGPVKMHYADGWEFVRRVAENDDEDAKYDIIV
FT                   ADLPGEREDDAQHNRLFGTEFLRYCVGALREGGVVTSQVGCPTLWLNTMLRRALARFSE
FT                   VFGTVAYYGSDEFDWAFLVGRPDVVADPTARMVERLSELPYRPTTLDAEALVANSVLPY
FT                   TLRQERKQRGEDLRYAAG"
FT   gene            complement(221609..222235)
FT                   /locus_tag="Svir_02200"
FT   CDS_pept        complement(221609..222235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02200"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95302"
FT                   /db_xref="GOA:C7MSU1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU1"
FT                   /protein_id="ACU95302.1"
FT                   /translation="MGGEVGGGGIRVVLAEDQTMVVEAFAELLNLQPDITVCATAKNGV
FT                   DALAAVAEHDPDVLVADIEMPRGSGLDVAAELHRRGSRTKVLIVTTFARSGYLRRAMDA
FT                   GVTGYVLKDAPIGELADALRKVHAGGTVVSAELALAAWDHSDQLTDRERELLRQVADGA
FT                   TNRDIARRLHLAEGTVRNYLSAAMAKLGARNRTEAAKAARERGWI"
FT   gene            complement(222235..223353)
FT                   /locus_tag="Svir_02210"
FT   CDS_pept        complement(222235..223353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02210"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95303"
FT                   /db_xref="GOA:C7MSU2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU2"
FT                   /protein_id="ACU95303.1"
FT                   /translation="MTTTHEPHPETASTDSSWWSEVGWVHLVYLAFLIPQPIYDPDSGL
FT                   WDWVLVVGIVLVFLPLYVFAWVRPDLARWGSVVPMTALGVVTTPLNSGAAVLFVYAAAI
FT                   AGVRESRRIALRWFIGLTVVLCVLVSFSPVPLPQRLWGLGPPLVFIWIIGLTQIEQAER
FT                   DREAAELRLRNARVEHLATVSERERIARELHDLLGHSLTSMIMHAQLCQNLVEVDPARA
FT                   REAAAKAERTARAALTEVRAAVSGLRQASLDAELESARETLSSVGVELVTRCDRSLRLV
FT                   GSTEHGLALALREAITNVARHARARSCCVSLSVVDEELRLVIADDGTGGRHRAGNGLAG
FT                   MRERISVLGGRVEWSGSAGTTVTIAVPLRVAT"
FT   gene            complement(223350..224087)
FT                   /locus_tag="Svir_02220"
FT   CDS_pept        complement(223350..224087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02220"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95304"
FT                   /db_xref="GOA:C7MSU3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU3"
FT                   /protein_id="ACU95304.1"
FT                   /translation="MNRRLFGVELLDEVRGIVREPTALFFSILMPVGFFALFVSMFGHH
FT                   TSEGLSSGTRMLGTFGTFGVLAVTLLNPGIGVAQDRHIGWLRMKRVQAVPLPVTLASKV
FT                   LAALPYSLGVLLAMTGTAALTGTLQASPLQLLRLYVVLSFGAMPFALLGVAVGFLAGPN
FT                   ATTAVLNAILLPAAVVSGLWLPLDLLPDFFGTAAVFLPTYHLAELAVAQFADTAFTGHL
FT                   AVLAGWAALLTGVAALAYRRARL"
FT   gene            complement(224084..225046)
FT                   /locus_tag="Svir_02230"
FT   CDS_pept        complement(224084..225046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02230"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95305"
FT                   /db_xref="GOA:C7MSU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU4"
FT                   /protein_id="ACU95305.1"
FT                   /translation="MTRCHYPHIRRRSTVRTVRTVLTARGVSHRYGGTVALDGVDLTVE
FT                   TGECVALLGPNGAGKTTLVNLAVGLLPRQRGGISLVGGDPRSARTRRHLGVVQQSLGFP
FT                   GTLKVGELIAGAAVRGGRPRSNAAPIMAELGLTDLAERRAAKLSGGQRQRVQLAMALVT
FT                   DPTLLVLDEPTVGLDAPTRRQLWRILERRREKGAGILLTTHLIDEAATVSDRVVVLAHG
FT                   RTLASAAPAELVSRLPDRTITARTDLDDERLTALPEVASFEREGELVRIGTRHPERLLR
FT                   ALLAEDPALTGLRVEGAGLEEAVVALTTRPRDANRGRVR"
FT   gene            complement(225104..225304)
FT                   /locus_tag="Svir_02240"
FT   CDS_pept        complement(225104..225304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95306"
FT                   /db_xref="GOA:C7MSU5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU5"
FT                   /protein_id="ACU95306.1"
FT                   /translation="MFMPRRVTRPWPTTRLALFVLALTFAATAAVQAFLAASMSEWWPT
FT                   VVAAALAAAAVWCLAMALTTR"
FT   gene            225966..228941
FT                   /locus_tag="Svir_02250"
FT   CDS_pept        225966..228941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02250"
FT                   /product="nitrate/nitrite-sensing histidine kinase with
FT                   HAMP domain protein"
FT                   /note="PFAM: Nitrate and nitrite sensing; HAMP domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95307"
FT                   /db_xref="GOA:C7MSU6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU6"
FT                   /protein_id="ACU95307.1"
FT                   /translation="MLAIAFIPSLVFLLTGVAMAGYLIYDAIQVRSFTTKVHNAAEPAG
FT                   VLFASLREERRLTLQELATTRSLRAELDQQRRQTDEAARRMAADLESIAEDAPANVRES
FT                   TRDAQRRLQQLAELRQRVDNGDTSLQEAYDFYNGIIDTYTVGLNGVAQETPNAETAYKR
FT                   MVAMPLFVSADSMSRGYALAAAGIESGGLTEQEFRTYIGQIGTYHSTLEQAVPDMVPSV
FT                   REKYEQLVASDAWETLTRVENAFLRGNTTELPVPEPAWHAAAAEVSGALWNLYVEQSTV
FT                   ATELALDEAEATLTTSIVAGTGVIAVALAVSLLAWRMSDRLAKRLVSLREATLEVADER
FT                   MPRIIERLRDGEQVDLESEVSYLDHGDDEIGEVAEAFNKAQRTAIAAAVDEAKTREGTR
FT                   KVFLNIAHRSQVIVHRQLAVLDAAERKQEDPDQLDLLFRLDHLSTRARRNAENLIILGG
FT                   EQPGRQFRKPVPLIDIVRGAIAETEDYKRVSTNRLPDIAVVGPVVSDLVHLLAELLDNA
FT                   TSFSPPQSRVEVRGELVGRGVVIEIEDQGIGMEADELDRFNRMLRNPPDFGFMALTEES
FT                   RLGLFVVARLAAKHHLTVTLRESAYGGTRAIVLVRTELLSEIPTEIEGESASGVEETAT
FT                   LTTSLPASGGVRPVPRRQPKALPSRAGDSAGDSAGDSAGDNDGQPTDTSTATGISSGAL
FT                   SPGEGVDTPTTQYTPRSSSEPAEERRGLPPGGGKGRADSSNSVRPELPRRERRRKHEES
FT                   SQYDGGYDPGVAAVRGRLLGNTADTADAADAVDAAEVTKITGSVNTADLDVLGDTGNAA
FT                   STADGTDVARGQRQAEPSSDRPGKHADDGDRPTVGELFETMSEAELSGESWSVPTQHVP
FT                   RLPRELPRAPRPNFGSRPRHEARPAQEQPLQRSWPDNGPSTPAPSSGTNALNGERPPLP
FT                   RRRRQQNLAPQLREETTSTDLTGGDDEYTTTPEQARSRLSAFQQGTRRARQHHIGSDDS
FT                   GD"
FT   gene            228949..229359
FT                   /locus_tag="Svir_02260"
FT   CDS_pept        228949..229359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02260"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Roadblock/LC7 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95308"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU7"
FT                   /protein_id="ACU95308.1"
FT                   /translation="MANSVVNELDWLLDDLVSQVAGAERAVVLSADGLLIGRSSNLSEE
FT                   DGEHLSAVASAFQSLARSTGRHFGGGQVRQTVVEMDHAFLFVTAAGRGACLALLTAEDI
FT                   DMGMVAYAMNMMVKRVGAVLSAAPRVEPHTTP"
FT   gene            229356..229763
FT                   /locus_tag="Svir_02270"
FT   CDS_pept        229356..229763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02270"
FT                   /product="Protein of unknown function (DUF742)"
FT                   /note="PFAM: Protein of unknown function (DUF742)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95309"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU8"
FT                   /protein_id="ACU95309.1"
FT                   /translation="MTDNDRDGFGDIGGDDEETWFEEGSAGLVRSYVVTGGRTRSDNYG
FT                   LDMMTLVVALCSPEEATHLPAEYARIVRLCQRPMSVAEVGGHIDLPLPLVKVLLSDLIE
FT                   QNYVIFRKAAPLSETPNQHILQAVLDGIRKL"
FT   gene            229744..230337
FT                   /locus_tag="Svir_02280"
FT   CDS_pept        229744..230337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02280"
FT                   /product="predicted GTPase"
FT                   /note="PFAM: Conserved hypothetical ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95310"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSU9"
FT                   /protein_id="ACU95310.1"
FT                   /translation="MASANSNDRRLTATAVKLLIAGGFGVGKTTMVGSVSEVPPLRTEE
FT                   MLTSASEGVDDLSGVEAKTTTTVALDFGRITISPELILYLFGTPGQDRFWFMWDELAQG
FT                   ALGAVVLADTRRLETCFPAVDYFERRGLPFVVGVNCFDNAYRYGTEEVREALDVDPSVP
FT                   VLLCDARDRESTKQVLITLIQHVMRSANMTPIPY"
FT   gene            complement(230433..231062)
FT                   /locus_tag="Svir_02290"
FT   CDS_pept        complement(230433..231062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02290"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95311"
FT                   /db_xref="GOA:C7MSV0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV0"
FT                   /protein_id="ACU95311.1"
FT                   /translation="MDGVRAHRIFAACYDRMNASAEKAFLGRRRHELLSGLSGTVLDIG
FT                   AGTGANLTHLRSAQRVVAVEPDPAMRARLARRAAEMELPVELSAASAEALPFADASFDA
FT                   VVFTLVLCTVSDPDAALAEARRVLRDDGKLVLLEHVRGTGRLARAQDLITPLWKVLGAG
FT                   CHPNRDTLGTLRRRDEFELEDVEKFSELPRWLPTSPMLQVTARPTR"
FT   gene            complement(231105..232391)
FT                   /locus_tag="Svir_02300"
FT   CDS_pept        complement(231105..232391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02300"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="PFAM: 4Fe-4S binding domain; Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95312"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV1"
FT                   /protein_id="ACU95312.1"
FT                   /translation="MTELSGQSSFDSHKPPARDLLDDCVHCGFCLPTCPTYQLWGEEMD
FT                   SPRGRIYLMDLAERGEIGLEGAFFQHIDACLGCMACVTACPSGVQYDRLLEATRPQLER
FT                   NVRRSTSDRFFRNAVFALFPYRRRLRLAAVLGLLYQKSGLPKLLERILPPRLRAAQALL
FT                   PPVRLREAFATLPRRIRPSGPVRRRVALLSGCVQDVFFHEVNAATQRVLAAEGCEVLTP
FT                   RRQGCCGALGLHAGREEHAVDRAKRTIATFEGLPVDAIVVNVAGCGSSMKEYVHLLADD
FT                   PEWAQRARDFSAKVRDVNELLAELEPRAPRRRMDAKVAYHDACHLGHAQGVREQPRALL
FT                   RTIPGLEVVDLPEADLCCGSAGIYNLVQPEPAAELGERKANNIRDVAPDLLVTANPGCL
FT                   LQIRRYLGDEIPMLHPIQLLDEAINGEPR"
FT   gene            complement(232388..233527)
FT                   /locus_tag="Svir_02310"
FT   CDS_pept        complement(232388..233527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02310"
FT                   /product="FAD/FMN-dependent dehydrogenase"
FT                   /note="PFAM: FAD binding domain; FAD linked oxidases,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95313"
FT                   /db_xref="GOA:C7MSV2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV2"
FT                   /protein_id="ACU95313.1"
FT                   /translation="MTAATSTPSTPPTVLAPADLREAHEALADTHGPVDIRGSGTATHW
FT                   ADPPRPATTVLDTTRMTGVLTYNPADMTVSVRAGTPLRELAAELAPNGQRVAFDPARVE
FT                   QGATIGGLIATADSGPLSLTYGSLRDLVIGATVVLADGTVARTGGHVIKNVAGYDLAKL
FT                   LHGSYGTLGLLAEVVLRLHPIPTATRTVRVELPLSDAARKAASVLRGQREPVSLEWFDG
FT                   QLVVRFEGTVEGTRTRARQLAAELGGTVLDEDTAAATWARHAELVRQATVRLGIRPSRL
FT                   VDVLTECGCADGARATVGLGTGVATVTVSDSDVERVHDITTAAGGVSVLRRAVPGARAW
FT                   GQTPSAVRVLRAVKNELDPNRRLCPGRLDSWLEERKAKS"
FT   gene            complement(233524..234981)
FT                   /locus_tag="Svir_02320"
FT   CDS_pept        complement(233524..234981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02320"
FT                   /product="FAD/FMN-dependent dehydrogenase"
FT                   /note="PFAM: FAD binding domain; FAD linked oxidases,
FT                   C-terminal domain; TIGRFAM: glycolate oxidase, subunit
FT                   GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95314"
FT                   /db_xref="GOA:C7MSV3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV3"
FT                   /protein_id="ACU95314.1"
FT                   /translation="MLMLDATVRSALTAAVGEDNVISDPVALRSYECDGLTGFRVVPEL
FT                   VVLPTDTDGVVAAVRACHDHGVPYVARGAGTGLSGGALPVADGIVISLQRLRRVLEVDP
FT                   LDRRATLQPGVTNLDITKAAAQYGLYFAPDPSSQQVCTIGGNVAENSGGAHCLKYGFTT
FT                   NHVLSMTVVLPDGELVTLGGDTTEQLGPDLRGVFIGSEGTLGIVCEITVRLLPVPETVR
FT                   TLLADFDSVREAGEVVSDIVAAGIVPAAVEMMDNLAIQAAEQAVHAGYTLDAAAALVVE
FT                   LDGPATECAEQFEQVKAICERHNCTRLHVADNADERARIWKGRKAAFAAVGRISPDYFV
FT                   QDGVVPRTRLAEVLGRIEDMGRTAGLRVANVFHAGDGNLHPLVLYDAAAGEQERAEKLA
FT                   KRIAELCVELGGSLSGEHGIGTDKACSMPRMFSVDDLDTMDRVRSAFDPDRLCNPGKLL
FT                   PTPRLCGEAPGPYRPHPLEEAGVIERL"
FT   gene            235131..235328
FT                   /locus_tag="Svir_02330"
FT   CDS_pept        235131..235328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95315"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV4"
FT                   /protein_id="ACU95315.1"
FT                   /translation="MRCASCRRGLDHCHGTVVLHGSGDFGGVECTEPDCVDVEPARHLF
FT                   VIGCGSVEGGCACAAVPAMS"
FT   gene            complement(235337..236674)
FT                   /locus_tag="Svir_02340"
FT   CDS_pept        complement(235337..236674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02340"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95316"
FT                   /db_xref="GOA:C7MSV5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV5"
FT                   /protein_id="ACU95316.1"
FT                   /translation="MTRRAGVRDTVRVVGGVITPTIAGGVIRRRPHMLAWLDRLQLDHT
FT                   AVRVCEDLRARYGPGPVWLRVPGRSIALLLDPDDVDRVLTSTPSPFSPAAREKRAALNH
FT                   FEPHGALVTPASERAPRRRYNERVLESDRPVHCLAGRVRGIVGEETRLLLTTTTELDWR
FT                   HHARTWWRIVRRLVLGDHTRDDAGITDELAALRMRANWAFLLPKAGRRRDAFRRRLDEH
FT                   LSRAEPGSLAAVIAEREPEDDTVDPFGQVPQWLFAFDAAGMVVLRALALLAIHPKQAKV
FT                   AREEAAVDDPGAWPYLRACVLDTVRLWPTTPLVLRESTAATSWRGTRLPPATLFLAFAP
FT                   YFHRAAELVPFADTFTPEAWLDGRAQDLPGLIPFSAGPARCPGENVVLLVASAMLAEFL
FT                   RAGEYRLLAPRTLRSHDHARDRLPTTVNSFGIRLAYTPYETRGSSA"
FT   gene            complement(236671..236877)
FT                   /locus_tag="Svir_02350"
FT   CDS_pept        complement(236671..236877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95317"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV6"
FT                   /protein_id="ACU95317.1"
FT                   /translation="MNAHNSTAPSQNPRPVLPYTEEPDPEQRRRAVRAVASAALDAKDC
FT                   AELLEALGLSPEEGRTIPAQRIR"
FT   gene            237028..237498
FT                   /locus_tag="Svir_02360"
FT   CDS_pept        237028..237498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95318"
FT                   /db_xref="GOA:C7MSV7"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV7"
FT                   /protein_id="ACU95318.1"
FT                   /translation="MGTDAYLAFIALGLIMIVADGQLLYHSGKRYLSDVDEGDAIYSMA
FT                   KLVTVLFHLVMFGFLALLSVLSFEFGGHTVRAVIGNLGILLLLLALVHAVTMAVMSQMH
FT                   DSRITDDQYMRQPPRTGISTNIQLQRGSVVAPVSGQAGPEPRIGPPVEDQTN"
FT   gene            complement(237669..238316)
FT                   /locus_tag="Svir_02370"
FT   CDS_pept        complement(237669..238316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95319"
FT                   /db_xref="GOA:C7MSV8"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV8"
FT                   /protein_id="ACU95319.1"
FT                   /translation="MHTWTFAASAALGWALFLLVILHLVSSFDPIFDPVSRYAFTDAGR
FT                   GMLEVSLLSFAVGVISVRGALLASGLPVSRTATILIITTATGLVAAALFPATYTPEVNP
FT                   VSGLIHQYASLLAFLSLPGVAVSMLDQIRDVEELQRVRRMLTRLVWVSLASLALFGLGY
FT                   LSDKVTFGFTPLEMLVSLPVGLLQRVVFVLDFLTLTGLLALANRAVWVRTAQ"
FT   gene            complement(238403..239194)
FT                   /locus_tag="Svir_02380"
FT   CDS_pept        complement(238403..239194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95320"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSV9"
FT                   /protein_id="ACU95320.1"
FT                   /translation="MPRIDIAERAGVGLDGLPRPTEDRVVITADTVVVLDGATEQREGL
FT                   PSGGWYSRRLAEQLETRLRTDSDADLTTLLSASIRAVAEEQDLVPRHSPSSTVAMVRWG
FT                   SEHVEALVLADSPVVAFTAHGPDVLLDDRLDRLRKRGALRTRADVDRLRNSEGGFWVAE
FT                   AMPEAATRALRRRWSLAETEAVVLATDGVSVGIDTYRVLDWPDVLRLSREHGADAVLDV
FT                   VRQAEVDDADCRRWPRSKRHDDQALVVVDFTEDRGVIRAKP"
FT   gene            complement(239252..239881)
FT                   /locus_tag="Svir_02390"
FT   CDS_pept        complement(239252..239881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02390"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Uncharacterized BCR, YitT family COG1284"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95321"
FT                   /db_xref="GOA:C7MSW0"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW0"
FT                   /protein_id="ACU95321.1"
FT                   /translation="MRTPVELSPVPLSTAPATRLTRLFLGLICYGTSMAMMTRSGLGLN
FT                   PWDVLHEGVADRTPLTFGTVTALTAALVLLLWIPLRQRPGFGTVANVVVIAVVVDVVRL
FT                   LLPDAHQLVWQVVLLLGGVVLNGVATAVYVGARLGPGPRDGLMTGLSARTGRSVRSVRT
FT                   AIELTVLATGWLLGGTVGVGTVLYALAIGPLTQLFLPYVTWAPRNR"
FT   gene            complement(240391..241722)
FT                   /locus_tag="Svir_02400"
FT   CDS_pept        complement(240391..241722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95322"
FT                   /db_xref="GOA:C7MSW1"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW1"
FT                   /protein_id="ACU95322.1"
FT                   /translation="MVVAVRPAAFAAFPADARRHSLLSSVLRRLIVVLGLAVGGWIVSM
FT                   LVAGAAAAEETSGTDLASTPACSDEVGSGDGADTVPPATDADIQPDRPELDDLDESTTG
FT                   HTDTSDHYGATDYTTSDESAAGDAALTIPAETTQPTPQTEQSTETAEKPVPSTSAGTPS
FT                   HTPDTLRPLKATEGPEPVEPVESTEAAESMNQAPLVPQLLQATADTLLATTSKLVHTTG
FT                   NLTGELIGVLPKVTDSLGDAARRIIDIPSRLPDVGTAPGRTLPGITLPPGAALPPGATL
FT                   PPGITLPHLPLPIGLDDLLGTDPPDSDQPADTSPGEPRTEPVAPAERAPKAPVAPVPTP
FT                   PQSDQWTDTSQWSPSREGDDPKVGEKPMRPLGPVSPAPTAPASAASTSTSVASSQDNTH
FT                   IHRGEHGVLSKTPTITQLRLLGVSRDHDAVGIGKEAALPTTSPD"
FT   gene            complement(241872..243035)
FT                   /locus_tag="Svir_02410"
FT   CDS_pept        complement(241872..243035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02410"
FT                   /product="succinyldiaminopimelate aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95323"
FT                   /db_xref="GOA:C7MSW2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW2"
FT                   /protein_id="ACU95323.1"
FT                   /translation="MREPVLVERMRPFTSTIFAEMTALADRTSAVNLGQGFPDTDGPAG
FT                   MLDAARDALFGGANQYPPGPGLPELREAIAKHRARYGTEYDPEREILVTAGATEAIAAS
FT                   LLALTGPGDEVIVIEPYYDSYAAAVAMAGATRRVVSLVPDGDRFALDLDAVRAAVGPKT
FT                   RAVLVNSPHNPTGTVFTRAELAELAQVCVEHDLIAITDEVYEHLTFDGAEHLPLAGFPG
FT                   MSSRTVTISSAGKTFNCTGWKIGWVCAAPELVSAVRAVKQFLTFVSGGPFQPAVAHALR
FT                   HELSWVESLRESLQAKRDRLCAGLAEAGFAVRPSAGTYFVCADVRPLGFTDAEELAWRL
FT                   PESIGVATVPVSVFTDHPKAWNHLLRFAFCKREEVLDEAIQRLRTLS"
FT   gene            243086..244369
FT                   /locus_tag="Svir_02420"
FT   CDS_pept        243086..244369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02420"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Protein of unknown function (DUF445)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95324"
FT                   /db_xref="GOA:C7MSW3"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW3"
FT                   /protein_id="ACU95324.1"
FT                   /translation="MAPVGRSTRPDAQQREEAKRRDLRRMKLVALSFLIGATLIFLGTS
FT                   WAQSKGAPAWVGYVRAAAEAGMVGALADWFAVTALFRHPLGLKIPHTAIIPNKKDVLGN
FT                   SLGDFVGANFLSEPVVRDKLRRVETSRRVGEWLARPENAERVTAEVATVVRGAVTVLRD
FT                   EDVQAVMEQAVVRQVVDKEWGPPLGRLLQQVLTDGAHYRLVDLVVDRAYEWVRENHDTV
FT                   LRVVSDRAPSWSPRFVDTMLADKVYGEVLSFAWAVKTDVNHPMRLAVDRFLAEFAQDLQ
FT                   DDPETMARAETVKRQLVEHPEVRKVIDSAWSTAKEMLLAAAEDPSSELRRRVCAGLASF
FT                   GRRLQDDPALAQKVDGWVEGAATYVVTRYSREITTIITDTVERWDAEETSRKIELQVGR
FT                   DLQFIRINGTVVGALAGLAIYSVAQALF"
FT   gene            244748..245272
FT                   /locus_tag="Svir_02430"
FT   CDS_pept        244748..245272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02430"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95325"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW4"
FT                   /protein_id="ACU95325.1"
FT                   /translation="MSIGHTLLGLLETGPRHGYDLKRVYDERFGKDRPLHYGQVYSTLA
FT                   RLLRNGLITEVGAEPGQGPERKSYAITDAGVSDVDQWLSTPEKPEPYLHSTLYTKVVLA
FT                   LLSGRDAELILDTQRRAHLAAMRELTRRKTEGDLADALICDHALFHLEADLRWLELTAA
FT                   RLGELAGTVTS"
FT   gene            245269..245952
FT                   /locus_tag="Svir_02440"
FT   CDS_pept        245269..245952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02440"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95326"
FT                   /db_xref="GOA:C7MSW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW5"
FT                   /protein_id="ACU95326.1"
FT                   /translation="MSDEPLLQATALYKSFGATQALRGASIEVHAGEIVAVVGPSGSGK
FT                   STLLHCLAGILDPDSGTVRYRGRDLDSLSDKHRSALRRTEFGFVFQFGQLVPELTCVEN
FT                   VAMPLRLSGVRRRTAEARALEMMTRLQVDDVADSRPGDVSGGQGQRVAVARALVTGPRV
FT                   VFADEPTGALDSLNGERVLRLLVETSRASDTAVVLVTHEARVAAYSHREVVVRDGCTDP
FT                   LGVPA"
FT   gene            245949..247883
FT                   /locus_tag="Svir_02450"
FT   CDS_pept        245949..247883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02450"
FT                   /product="Predicted permease"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95327"
FT                   /db_xref="GOA:C7MSW6"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW6"
FT                   /protein_id="ACU95327.1"
FT                   /translation="MNAVRDLLLGVRLSFGTGRARGVGLLRTGLTAFGVGLAVAGLLLV
FT                   FASFHGLSERLERIGARTPIEAKAGEPALGYLAQTSYYRGEELTAVYLEPRREDAPVPP
FT                   GVDAVPAVGQAVVSPGLAGLLVSDEGALLRPRFADVEIVGTIGAEGVAEPGELWYYLGA
FT                   EGLDEDHGAELVGGFGAPVGPFEIGPFFTVVFLVAGSILVSPLLVFIATGSRLAGADTE
FT                   RRLSALRLVGADIGQIRRIAAAESLIGAFVGLVLAVGFFFVGRPLVAGADLGGLGMYPQ
FT                   DLVPPWPLVVVVVLATPVITVGSALFGLRNVVVEPYGIVRESEPTRRRGWWRVTLVGVG
FT                   VLLFLPDVWLGVEPGGTLSALFAGVGSFVLLVGVSVLMPWLVEWVVRRLRGGPPSWQLG
FT                   VRRLQLDSGTPARVVAGITVVFAGAITVHTLFGGAGGVAVEESNEVHVFAIDEEVERTA
FT                   IALSDGVPGVTVTGPGRVTLDPAVPDAVEHLRNALAPLGWKVEISREADGAELANTEGT
FT                   LGAVLGTASTFTLLLAGGNLLVLTSAQVLQRRRAFAALRATGVPGGVLGRSLLWQNCVP
FT                   MLIGVLLATAVGLGVAGLIARLFDQRFRPDWFTLAGYSAMVVLLVVAVTGASLPVLRAV
FT                   VRETGLRGE"
FT   gene            248016..248417
FT                   /locus_tag="Svir_02460"
FT   CDS_pept        248016..248417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02460"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95328"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW7"
FT                   /protein_id="ACU95328.1"
FT                   /translation="MICPKCQNVMTTVDKNGIHIEQCGGCRGIFLDRGELEQIVRAENS
FT                   YYGSAPPPPYSPTTQPPPPPPPPALHAAPAPTQHYGQPPYYGDSPKPYRGGGYYGDSPR
FT                   PYQGGYYGDSPRPYGGYRRRRSFLESLFD"
FT   gene            248426..249088
FT                   /locus_tag="Svir_02470"
FT   CDS_pept        248426..249088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02470"
FT                   /product="predicted nucleoside kinase, CMP and AMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95329"
FT                   /db_xref="GOA:C7MSW8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW8"
FT                   /protein_id="ACU95329.1"
FT                   /translation="MLDLKICPACGDRAQRPAVEEERLVCAACGHRAAFHRLPLFALTG
FT                   PSGGGKSTVGPELARRLSGEVVVLEQDVLWTGGLRDDVDGHPRFRSTWLRMAAMIHQSG
FT                   RPVVLCGTVVPPEFEPLPERVFFADIHYLALVAEPEVLTRRLRARPAWRGWDEPRIAEM
FT                   LEFTEWLRREAAGMSPPVELFDTTEASLTESVDHVERWVRRGLAAHRASEAVRVGAD"
FT   gene            249157..249627
FT                   /locus_tag="Svir_02480"
FT   CDS_pept        249157..249627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02480"
FT                   /product="Helix-turn-helix protein"
FT                   /note="PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95330"
FT                   /db_xref="GOA:C7MSW9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSW9"
FT                   /protein_id="ACU95330.1"
FT                   /translation="MARTSTRDGGHDETSSAAGSAESDGPMDRVASLGKDIGAYIRQQR
FT                   NHAKISLRQLSKLAGVSNPYLSQIERGLRKPSAEILQQIAKGLRISAEALYVQAGILDR
FT                   PVGGPVVDAVRADASLTERQKQVLLDVYESFLRENQGMEAAGEQRPDRKHKE"
FT   gene            249634..250326
FT                   /locus_tag="Svir_02490"
FT   CDS_pept        249634..250326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95331"
FT                   /db_xref="InterPro:IPR020340"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX0"
FT                   /protein_id="ACU95331.1"
FT                   /translation="METTRTEDVRKVVNTAKEQVRTSLLAALGAGSLAGRAVVETVSKA
FT                   KTRVSSSSDAAKRNVEDLPSELGELRERLDPAELRKTWDEYTDAMVKLYHRLAASGEQT
FT                   WDEVVEPQVKRGIEQVEEALRAAQQRVDDVTADARERVDEMVRMLMRKGQEGESDGDES
FT                   ASAKTGPTGSIEAARSAREKAMKPGTSTTTTTATARSAREKAMKPGTTTTGMTPTGQSD
FT                   NGSRGKGN"
FT   gene            250474..250773
FT                   /locus_tag="Svir_02500"
FT   CDS_pept        250474..250773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02500"
FT                   /product="Protein of unknown function (DUF2516)"
FT                   /note="PFAM: Protein of unknown function (DUF2516)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95332"
FT                   /db_xref="GOA:C7MSX1"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX1"
FT                   /protein_id="ACU95332.1"
FT                   /translation="MPLFAYWIVLVIDWAGVLVGLFAFVHAVTQRADAFTAADRLSKPA
FT                   WMAITGGATVAMLLFQFYGAGMIFWLAALVASLVYIVDVRPKLIEVQRGGSNWW"
FT   gene            250790..251335
FT                   /locus_tag="Svir_02510"
FT   CDS_pept        250790..251335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02510"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95333"
FT                   /db_xref="GOA:C7MSX2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX2"
FT                   /protein_id="ACU95333.1"
FT                   /translation="MNVGNWSIAGTLMPVPVSERLDLVAEPVAKALESIDDPVGVVEID
FT                   PDLADTAKFCEAYSSPLSASANCVVVSGKRAGEVRYAAALVLATTRADVNNVIRRRLDV
FT                   RKASFAPMEEAVELTGMAYGGITPIGLPSGWPILIDQAVASAPEVVVGSGIRGSKLLVT
FT                   GATLAKLPGAEVIDGLAK"
FT   gene            251363..251818
FT                   /locus_tag="Svir_02520"
FT   CDS_pept        251363..251818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02520"
FT                   /product="Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /note="PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95334"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX3"
FT                   /protein_id="ACU95334.1"
FT                   /translation="MGWMGRVTATAERSIDAPAEEVKSKLADYREVRPRILTEEYRDYT
FT                   LVEGGTGAGTVARWKLQATSKRVRDVRATVSEPQPDTLVETDANSSMVTTWTVRPEGDD
FT                   RSVVRVETTWQGASGIGGFFERVFAPKGLKRIYDGVLDNLAEEVRGR"
FT   gene            251818..252816
FT                   /locus_tag="Svir_02530"
FT   CDS_pept        251818..252816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02530"
FT                   /product="predicted NADP-dependent oxidoreductase"
FT                   /note="PFAM: Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95335"
FT                   /db_xref="GOA:C7MSX4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX4"
FT                   /protein_id="ACU95335.1"
FT                   /translation="MEATEVRLASRPEGMPTLDHFEVVDVEVPKPGPGQVLVRNTWLSV
FT                   DPYMRGRMSSAKSYVAPFEVGEVMDGGAIGEVVESNTDELAVGDVVLHGLGWRTHAVLD
FT                   PARARKLDPSAAPVQAHLSVLGMPGLTAYAGLFDVANMREGDTVFVSGAAGAVGSLVGQ
FT                   LAKLRGAKRVIGSAGSAEKVRWLLDELGFDAAFNYKDGPVREQLRQAAPDGVDVYFDNV
FT                   GGEHLEAAIGALNVHGRIAVCGMISQYNATEPTPAPRNLAQIIAKRFTMRGFLVGDHEH
FT                   LRPTFLAEVSPLVRDGKIVYRETVVDGIRQAPQAFLDLLTGGNTGKMLVRL"
FT   gene            complement(252837..253775)
FT                   /locus_tag="Svir_02540"
FT   CDS_pept        complement(252837..253775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02540"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="PFAM: Formyl transferase; Formyl transferase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95336"
FT                   /db_xref="GOA:C7MSX5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX5"
FT                   /protein_id="ACU95336.1"
FT                   /translation="MFGYQTWGHRTLRALLESEHDVALVVTHPHSDHAYERIWADSVAD
FT                   LATEHGVEVILRNRPDQALADRLAELEPDLIVANNWRTWIPPEIFRLPKHGTLNVHDSL
FT                   LPAYAGFSPIIWALLNGEKEVGVTAHMMDEELDAGPILLQRAVEVGPKDTATDLFHKTV
FT                   DLIGPLVSESLELIASGRANPVPQDRSKASFFHKRSIEDSRIDWTWPAEDIERLVRAQS
FT                   DPYPNAFTYYRGQRIRITKAFVTERPYGGTPGRVFIREGDGVVIVAGADARHGRNPGLA
FT                   IERLRTDDGVEHAATDFFRSMGGYLTRYPED"
FT   gene            253957..255324
FT                   /locus_tag="Svir_02550"
FT   CDS_pept        253957..255324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02550"
FT                   /product="lysine/ornithine N-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95337"
FT                   /db_xref="GOA:C7MSX6"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX6"
FT                   /protein_id="ACU95337.1"
FT                   /translation="MSTVLRDEGPSYDLLGVGFGPSNLALAIAVSEHNAASRGPHLNVR
FT                   FLERQKTFGWHRGMLIDDATMQVSFLKDLVTMRNPASDFSFLCYLHERGRLVDFINHKT
FT                   LFPLRVEFHDYFCWAAERVGDLVRYGTEVTAVRPVVDGAEIVRFEVHTNTGEVYSARNL
FT                   AVATGLIPSLPDGIVESKRVWHNSDLLYKVDEMSAASRFVVLGAGQSAAETTALLHSRF
FT                   PDAEVCAVFSRFGYSPSDDSPFANRVFDPAVVDEFHGAPPEVRKQILDYHANTNYSVVD
FT                   LDLIEELYRRHYREKVLGVERLRIFQASRIAQLAETEDGVRVTVESLTTSERTVLEADA
FT                   VVCATGYRPGDVTTLLGDAASICRRDDAGRPLVARDYRLLTTPDSGAAVYVQGGVTEHT
FT                   HGITSSLLSNNAVRAQEILDSLLSRITAARAGEAGAAPADSNGRSTYAHAAVGVVG"
FT   gene            255344..255550
FT                   /locus_tag="Svir_02560"
FT   CDS_pept        255344..255550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02560"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: MbtH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95338"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX7"
FT                   /protein_id="ACU95338.1"
FT                   /translation="MTNPFDDPEGRFYVLVNDEEQHSLWPSFVDVPAGWRVVFGEDTRQ
FT                   ACLDYVERHWTDLRPASLRAVEG"
FT   gene            255855..256910
FT                   /locus_tag="Svir_02570"
FT   CDS_pept        255855..256910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02570"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95339"
FT                   /db_xref="GOA:C7MSX8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX8"
FT                   /protein_id="ACU95339.1"
FT                   /translation="MSIAAPEAGTQRAVSARRSAHALRALGLLAAVVALAFVALLSIWL
FT                   GSKDIPFAQTWNILLDGSGDSDAAIIIHDYRIPRTLLGIVVGAALGLSGALMQALTRNP
FT                   LAEPGILGVNTGASTGMVVAIAFLGIGSVVGYVWFALLGAAVASFVVYALGATGRGAAS
FT                   PERLVLAGAALTAVLYAFNTAVLLSNVEAYDEYRFWMVGSLAGRYYDVLLPLLPFVAVG
FT                   VVLGLSLMRALNVMAMGDELGKALGSRPNRTRVLGAVAVTLLCGSATAAIGPIAFVGLA
FT                   VPHAARLLVGPDQRWVLPYSLVLAPLLLVGSDVVGRVVAPPSEVQVGIVTAAIGVPVFC
FT                   ALCRRRRLASL"
FT   gene            256916..258013
FT                   /locus_tag="Svir_02580"
FT   CDS_pept        256916..258013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02580"
FT                   /product="ABC-type enterobactin transport system, permease
FT                   component"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95340"
FT                   /db_xref="GOA:C7MSX9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSX9"
FT                   /protein_id="ACU95340.1"
FT                   /translation="MSDDTTTRSSTRPSAPRPVTGTVLRTRRETIALRVDPRAVLVGSV
FT                   LTFALLVTMAITLTTGEYELSVSEVLAAVIGQGEGAADFIVNTLRLPRLLTALFVGAAL
FT                   AVSGAILQSLTRNPLGSPDFVGFTNGASTGALLVIIAVGGTMTQVAVGALLGGIVTSVL
FT                   VYLLSYRRGVQGYRFVLMGVGVNALALSVNSYLITRADIYDAVSAQAWLVGSVNGRDWD
FT                   HVAVSGLALAILLPLAASQIRALSMLELGDHTATALGVGVQRSRAILIVASVLLSGFAT
FT                   AAAGPIWFVALAAPQLARRLTRSPNPGLVTSALMGGLLLTVSDLAMQRLFPAAQLPVGT
FT                   ATGCLGGLYLMWLLASEWRGKGRYA"
FT   gene            257986..258894
FT                   /locus_tag="Svir_02590"
FT   CDS_pept        257986..258894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02590"
FT                   /product="ABC-type cobalamin/Fe3+-siderophore transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95341"
FT                   /db_xref="GOA:C7MSY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY0"
FT                   /protein_id="ACU95341.1"
FT                   /translation="MAREGQVRVTGKNSSDGGAGSRLRAEGLTLAYDDSVVVRDLGVAV
FT                   PDGSFTVIVGPNACGKSTLLKALARMLRPTTGAVYLDGQIITSYRSREVARRLGLLPQS
FT                   SIAPNGITVGDLVARGRYPHQKLLRQWSSEDEAVVVEAMRRTGVADLADRLVDELSGGQ
FT                   RQRVWLAMVLAQQTPILLLDEPTTFLDIAHQIEVLELCADLNADSGHTLVAVLHDLNQA
FT                   CRYATNLIVLAPGGRIAAQGDPREIVTAELIADVFGLPCRVMDDPETGTPMIVPAARRR
FT                   PDSRGRSEDHGAVAVHEHAPL"
FT   gene            complement(258847..259725)
FT                   /locus_tag="Svir_02600"
FT   CDS_pept        complement(258847..259725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02600"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="PFAM: Formyl transferase; ACT domain; TIGRFAM:
FT                   formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95342"
FT                   /db_xref="GOA:C7MSY1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY1"
FT                   /protein_id="ACU95342.1"
FT                   /translation="MTRDNPLVHERQYVITFGCPDRKGIVSRISSFLAEIGGWIVEAAY
FT                   HTDPDTGWFFTRQAVKADSVPFDIDELRARFAGVARSLGSETDWSVDDTGQRPRVVILV
FT                   SKEGHCLYDLLGRVASGELDADVRAVIGNHDVLADITQAHGIPFHHVPFDGDDAKSFEQ
FT                   IAKLVDEHDPHAVVLARFMRILPPELCEAWAGRAINIHHSFLPSFVGARPYHQAYARGV
FT                   KLVGATCHYVTPELDAGPIIEQDVIRVDHRDTVSDMVRKGRDIEKVTLARGLRWHLERR
FT                   VLVHGNRTVVF"
FT   gene            complement(259859..260353)
FT                   /locus_tag="Svir_02610"
FT   CDS_pept        complement(259859..260353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02610"
FT                   /product="Protein of unknown function (DUF2505)"
FT                   /note="PFAM: Protein of unknown function (DUF2505)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95343"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY2"
FT                   /protein_id="ACU95343.1"
FT                   /translation="MATRIEHRATFAHDTADVYAAQTDEQALRARLERLGGKHAELREH
FT                   VVTESGVRYTLSQGIAADKLPSLVRSLHSGDLIVRREHVWTDLGDRYTGTIAVAVSDVP
FT                   GRITADVELAPSADGCTQLTRGEVAVRIPLVGGKIESFVVDQVTRLLETETDFTKQWLA
FT                   R"
FT   gene            260379..261434
FT                   /locus_tag="Svir_02620"
FT   CDS_pept        260379..261434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02620"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /note="PFAM: UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   C-terminal domain; FAD binding domain; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95344"
FT                   /db_xref="GOA:C7MSY3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY3"
FT                   /protein_id="ACU95344.1"
FT                   /translation="MSIVETVDRKSLREYTTLRLGGPARRFVVAETTEDLVTTVRGLDD
FT                   AGEPVLLVGGGSNLVIGDDGFDGTVVRIATTGWSDDFRTVAAGQDWDAYVAATVAAGLG
FT                   GLECLSGIPGCAGATPIQNVGAYGCEVSQVVESIELYDRRARKVRTVPADELGFAYRTS
FT                   VLKGTDSGVVLSVRFRLFDDGLSVPVRYAELARTLGVELGTRVPVSEAREAVLALRRGK
FT                   GMVLDARDHDTWSAGSFFTNPIVAEADVPRVLARIAEVVGEDVNVPRYPADGGVKLSAA
FT                   WLIERAGFAKGHPGPGGRVSLSTKHTLALTNRGGATTADLLALARQVRDGVYERFGVEL
FT                   HPEPLLVNCAL"
FT   gene            complement(261454..262185)
FT                   /locus_tag="Svir_02630"
FT   CDS_pept        complement(261454..262185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02630"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95345"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY4"
FT                   /protein_id="ACU95345.1"
FT                   /translation="MSTRTAVITGASAGIGAATARALANAGFHVVLGARRLEKLQPLAE
FT                   ELSGTAYQLDVTDADSVASFVDRIPECHVLVNNAGGARGLDRVEHADEERWRWMWETNV
FT                   LGTLRITKALLPKLLASGDGHVITVTSIAGHEVYDGGAGYTSAKHAQSALHRTLRSEHL
FT                   GDPLRLTEIIPGMVETEFSINRFDGDTERAAKVYEGVTPLTAEDVAEVIAFAATRPPHV
FT                   NLDQIVLKPRAQYSGSRVHRE"
FT   gene            262271..263116
FT                   /locus_tag="Svir_02640"
FT   CDS_pept        262271..263116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02640"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95346"
FT                   /db_xref="GOA:C7MSY5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY5"
FT                   /protein_id="ACU95346.1"
FT                   /translation="MRSEVVGASGVRMGVRVDGELDAPAIVFVHGWAQSARVWECQFAD
FT                   PQLRGRFRLLAPDLRGHGTSETPEDGYDDPAVWADDLAAVLEAAGPNAVVVGWSYGGLV
FT                   ITDYLRVHGTRGLAGIVFVGAITEIGKGRPGGRVGPAMSAALPDALSDDLDVALPALRT
FT                   LAAGMASRPVPGHVTQALLGASLSVPPKVRKALFRRDVDSADVLADIDVPTLVLHGTDD
FT                   AVVDVSAGEYTAGKIAGAVTRWWEGVGHLPFVESSREFDTTLRWFAEQVVDGAVGRTER
FT                   "
FT   gene            263121..264416
FT                   /locus_tag="Svir_02650"
FT   CDS_pept        263121..264416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02650"
FT                   /product="UDP-N-acetylglucosamine:
FT                   1L-myo-inositol-1-phosphate
FT                   1-alpha-D-N-acetylglucosaminyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1; TIGRFAM:
FT                   UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate
FT                   1-alpha-D-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95347"
FT                   /db_xref="GOA:C7MSY6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7MSY6"
FT                   /protein_id="ACU95347.1"
FT                   /translation="MTISGYRKAIWPRRIAVLSVHTSPLEQPGTKDAGGMNVYISQTAV
FT                   EMARRGVSVEVFTRATSSDQPPAVELAPGVLVRHIPAGPFEPLERGELPSQLCAFTSGV
FT                   LRTEAFQEPGYYDLIHSHYWLSGQVGWLARDRWGVPLVHTAHTLAKVKNAALASGDTPE
FT                   PRTRVIGEEQVVAEADRLVVNTDVEADQLVRLYDAAPDAVRTVSPGVDLERFRPGSRAA
FT                   ARAALGVPADAVVLAFAGRIQPLKAPDVLLRATAALVRRDPGLRRRLVVLVAGGPSGSG
FT                   LEQPRSLMDLAVELGIDDVTRFLPPQGGQDLVNVYRAADVVAVPSHNESFGLVALEAQA
FT                   CGTPVVAARVGGLPVAVDDEVSGLLVPTHDTEDWADALARVALRPEVRAVLSRGAREHA
FT                   QRFSWRRTTDALLDIYREAMAAFRGTALEVAV"
FT   gene            264413..264958
FT                   /locus_tag="Svir_02660"
FT   CDS_pept        264413..264958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02660"
FT                   /product="Protein of unknown function (DUF2596)"
FT                   /note="PFAM: Protein of unknown function (DUF2596)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95348"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY7"
FT                   /protein_id="ACU95348.1"
FT                   /translation="MNAGKGGEEFRRVDQVISSTLEAAGLAYDRRGEGVYFVTLPGVKK
FT                   LQTNCWLIVREHSLAVEAFVCRRPDEAHEDVYRFLLRRNAKLYGVHYTIDSVGDIYLVG
FT                   RFGLDTVTESEVDKVLGQILEAADGDFNTLLELGFATSIRKEWDWRVSRGESLANLKAF
FT                   EHLVRPESPHSPGSLTAD"
FT   gene            265519..266268
FT                   /locus_tag="Svir_02670"
FT   CDS_pept        265519..266268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02670"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="PFAM: Phosphoglycerate mutase family; TIGRFAM:
FT                   phosphoglycerate mutase, BPG-dependent, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95349"
FT                   /db_xref="GOA:C7MSY8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY8"
FT                   /protein_id="ACU95349.1"
FT                   /translation="MAELGTLVLLRHGQSTWNAENLFTGWVDVPLSEQGEAEARRGGEL
FT                   LAEAGLLPDVVHTSLLRRAISTANIALDVADRHWIDVRRDWRLNERHYGALQGKNKKET
FT                   LEQFGEEQFMLWRRSYDTPPPPIEPGSQYSQDGDVRYADLGDKLPTTECLKDVVERLLP
FT                   YWESAIVPDLRAGKTVLIAAHGNSLRALVKHLDGISDEDIVGLNIPTGIPLRYDLDENL
FT                   KPTNPGGTYLDPEAAEKAAAAVASQGR"
FT   gene            266447..267697
FT                   /locus_tag="Svir_02680"
FT   CDS_pept        266447..267697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02680"
FT                   /product="histidine kinase"
FT                   /note="PFAM: His Kinase A (phosphoacceptor) domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95350"
FT                   /db_xref="GOA:C7MSY9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSY9"
FT                   /protein_id="ACU95350.1"
FT                   /translation="MTAPASIALALAASVAGLLVGFLVGRSRLTHSRMRPQGPTAAQLL
FT                   ERFVRSSNSGVLILNRFGDLVLHNHRAEELGLVRDNRADARARKAAEQVVDGGTPTEVD
FT                   LSPLSVRRRGPEAVLGEVRPLGDGFTVVEAMDHSEAVRLEATRRDFVANVSHELKTPVG
FT                   AIAVLAEAVLDAADDPDEVRRFGEKILRESTRLGKLVTELIALSRLQGAEKLPELTVVD
FT                   IDTVVDEALGRIRLAAESAGIDITTDSASGLSVEGDRTLLVTALSNLLDNAVAYSPAGS
FT                   PVSISRRLVDGYVEVAVTDRGIGIPESDQQRVFERFYRADKARSRATGGTGLGLAIVKH
FT                   VAANHGGEVRLWSSPGVGSTFTLRIPTHPETTGGRTSAPPAATASAGPAAPTEAGGRIE
FT                   RPVPAVLQKSTGGGGKP"
FT   gene            267694..268383
FT                   /locus_tag="Svir_02690"
FT   CDS_pept        267694..268383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02690"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95351"
FT                   /db_xref="GOA:C7MSZ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ0"
FT                   /protein_id="ACU95351.1"
FT                   /translation="MTRVLIVEDEESFADPLAFLLRKEGFTAAIATDGQQALEEFDRNG
FT                   ADIVLLDLMLPGMSGTDVCRELRQRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARVRAVLRRGGDSSGDSQQEQTVLIGGPVRMDVERHVVTVNGTEVPLPLKEFDL
FT                   LEYLLRNVGRVLTRNQLIDRVWGADYVGDTKTLDVHVKRLRSKIEPEPGSPRYLVTVRG
FT                   LGYKFEP"
FT   gene            268479..269450
FT                   /locus_tag="Svir_02700"
FT   CDS_pept        268479..269450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02700"
FT                   /product="exopolyphosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95352"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ1"
FT                   /protein_id="ACU95352.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGARPTPMHSEKTVLRLVERVSAD
FT                   GELDKKVVDELVLTIARAKEAAQRHGCEELLAFATSAIRDVSNASEVLERIVDETGIEL
FT                   RVLTGEQEARLTFLAARRWFGWSVGRLLVLDIGGGSLEVALGDDEEPELAESWPVGAGR
FT                   ITRTRFVNDPPTRPEVVSTTAWLDDQLGGLAERVAAVGVPDRVVGTSRMLQSLARLTGA
FT                   APSSAGPYVRRVLTHAGLRQLIAFISRMSSDDLAQLEGVSSSRAHQLVAGALVAESTMR
FT                   ALSLDSLEICPWALREGVILQRLDHSDSADRTALLTGWRRGA"
FT   gene            269542..271284
FT                   /locus_tag="Svir_02710"
FT   CDS_pept        269542..271284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95353"
FT                   /db_xref="GOA:C7MSZ2"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ2"
FT                   /protein_id="ACU95353.1"
FT                   /translation="MAELLAEHGGQLGGTPRRRRRRAAEDGDASGGRQPGIADTAPQAI
FT                   IERVRAEGASSGSTSRSGGRPNGRAQAGDEARRGRPGQPRTGPQKLPPRPPQGSGSYPV
FT                   PGGEDVGRPPLPPRGRGARPTGASGSLPVTPPAPQSSLPPSNTHSTGYGKPVANGFRPP
FT                   QNTGSHPAPPPGGGAVSGVVQQSAGSGAQQPPQPNQGPPRDVAERMNATRRVPAPVPPP
FT                   PQAGTQEGTLAARLDGLDDVDESGVQQPAQPGGPASQQGGRAQRSGAFPMPHRRRPPRT
FT                   APAVPPEPSTEQFPAVAESDAEKTALAEPVRDEEKTTLSEAVRPDEPPAGLSNWPGARG
FT                   DGQSVDSSNEATQVGVAAVLNSDDDDDDDHGPATGHYVPNFDDDDEDDDFDGLRHRTGV
FT                   LGDDPLGEDDDFDDHGTRYADYDDESYPDMYAGNPYADDDDDEPDSDSDDAGSAEEEEP
FT                   KKRRFRKARRAEPVAADSEDADEDDGDADDSELGDSPAKQWLVLAGQLALGVAGGAGVW
FT                   LGFNWLWGRLPAAALIAALVVTVGLVWVVRKVRRAEDTQTTVLALLVGLVVTVSPAALL
FT                   LVSR"
FT   gene            271299..272099
FT                   /locus_tag="Svir_02720"
FT   CDS_pept        271299..272099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02720"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95354"
FT                   /db_xref="GOA:C7MSZ3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ3"
FT                   /protein_id="ACU95354.1"
FT                   /translation="MAGPEIAVTLSTASVWPLRARSAFELAADLGYDGVEVMVWVDPDS
FT                   QDVGALRQYSKTTGVPVRSVHSPSLLITQRVWSPDPVVRLRRSVEAALELEASTVVVHP
FT                   PFRWQRRYGAAFSDLLAELEQESGVALAVENMFKVRPPGGGRNVRVSAFRPSIDPTDVG
FT                   YAHYTLDLSHTAAAGMDALALADRMGDGLSHVHLADGTGAPRDEHLVPGRGNQPCAELL
FT                   ERLVERNYRGSVVLEVNTRAAKYAARRVADLAEALLFTRLHLGQ"
FT   gene            272188..273114
FT                   /locus_tag="Svir_02730"
FT   CDS_pept        272188..273114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02730"
FT                   /product="L-proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95355"
FT                   /db_xref="GOA:C7MSZ4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ4"
FT                   /protein_id="ACU95355.1"
FT                   /translation="MEPLRSLILAAADNDVIRRVVATAPGSRQIVARFVAGESVADALE
FT                   VVHTITADGRRATLDYLGEYTSDPELAERTVRTYLRLLDELAERRLAESVEVSVKLSAL
FT                   TVDGDEVLASRNLGLICEAAADCGTTVTVDMEDHTTTDATLRAVRKARRTWPWVGAVVQ
FT                   SYLRRTESDVATLAYEGSRVRLCKGAYAEPAEVAFTDAHAVDLSYVRCANSLLAGGAYA
FT                   MFATHDPRLVNVLRQRTRWYGRRQGSYEYQMLYGIRPDEQRRLAAEGETVRVYVPFGEH
FT                   WYGYLMRRLAERPANLALFLRALVSRS"
FT   gene            273111..273935
FT                   /locus_tag="Svir_02740"
FT   CDS_pept        273111..273935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95356"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ5"
FT                   /protein_id="ACU95356.1"
FT                   /translation="MNSIDLEPVTFAAACEMRSLGDGTFTADLRQEWSIGKHPHGGFLL
FT                   ALLARTAIRALAEAGEPPVDPLAVSAEFLHAPALGPVLLRADIRKIGRRVTVVAVSLEQ
FT                   RGRSCVEARVTAGRLALRPPVWNDVPALPLEPPPNAVPLSGKTSEGLFHLAQGCDVRVD
FT                   PATAGYLVGRKDDPPRLRLWARPRHGEVDPYFALLAGDLNPPVVFNLGRTGWAPTVQLT
FT                   ALLRTRPHPGWLRIQVGCRVIQEGWFDSDAVVVDSQGRIVCQARQLALSPLP"
FT   gene            273999..274811
FT                   /locus_tag="Svir_02750"
FT   CDS_pept        273999..274811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02750"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   TIGRFAM: pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95357"
FT                   /db_xref="GOA:C7MSZ6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ6"
FT                   /protein_id="ACU95357.1"
FT                   /translation="MGTIAVLGAGKIGEALLSGLLSGGRSAEDLLFTERHPERAAELES
FT                   RYGITNVTIEEAAARADLLVIAVKPQDIDPVLAELAPLLRPSSLVVSLCAGLPTSLFER
FT                   RLPPNTPVVRVMPNTPMLVGEAMSAVSPGSHATREHVQTVTELLSCVGKVVEVPESQQD
FT                   AVTALSGSGPAYFFYLVEAMIDAGILLGLPRAVAERLIVQSAVGAAKMLDEGAGHPVLL
FT                   REAVTSPGGTTINAIRELENHGVRAALLAAIEAARDRSVELGRAQQQD"
FT   gene            275019..275234
FT                   /locus_tag="Svir_02760"
FT   CDS_pept        275019..275234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02760"
FT                   /product="DNA-binding protein, excisionase family"
FT                   /note="PFAM: Prophage CP4-57 regulatory protein (AlpA);
FT                   TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95358"
FT                   /db_xref="GOA:C7MSZ7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ7"
FT                   /protein_id="ACU95358.1"
FT                   /translation="MPPNEEEDVSGTRHVQFLTVAEVASLMRVSKMTVYRLVHSGELPA
FT                   ARVGKSFRVPEKAVHEYLDNAYFDVG"
FT   gene            275581..276576
FT                   /locus_tag="Svir_02770"
FT   CDS_pept        275581..276576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02770"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95359"
FT                   /db_xref="GOA:C7MSZ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ8"
FT                   /protein_id="ACU95359.1"
FT                   /translation="MPSNIVLVTGVSGELGGRLLSRLGACPGLDRIVGVDISPPSRGVL
FT                   RQLGRLSRVEFVRADIRNPLLAKIMTSAKVDTVVHVGPLCHPAGYGERADVKEANVIGT
FT                   MRLLAACQNSPYVRKLVVASTTAVYGASSRSQAVFTEDAELIPAVASGYSKDAVELEGY
FT                   VRGFARRRPDVGVTTLRFADIVAGDLDTVFSRYFSLPLVPTVLGFDARLQFLHAEDALT
FT                   MLEQATTEEKPGVFNVAGDGVLTLSQAIRRAGRIALPVPRPVMTPVGKVLRGAHAVNVS
FT                   ADLVRLLNFGRVVDTTRLVREFGYSPRWTTRQAFDEAVRTATSWRGRLRR"
FT   gene            276597..277523
FT                   /locus_tag="Svir_02780"
FT   CDS_pept        276597..277523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02780"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="PFAM: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95360"
FT                   /db_xref="GOA:C7MSZ9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:C7MSZ9"
FT                   /protein_id="ACU95360.1"
FT                   /translation="MVPLSAVNTHGEPNTGANVVPFPGRGGGPERGEGPSGLIDFVRRR
FT                   LTGDYRVDEFGFDPELTETVLLPLLRPLYERWFRVSTHGLDNIPAEGGALLVSNHSGVL
FT                   PFDAVMTAVAIHDEHPAHRFLRMLGADLVFDTPILGSLARKTGQTLACHPDAERLLRNG
FT                   ELVGVWPEGFKGIGKPFSARYKLQRFGRGGFVSAALRTGVPIIPCAVVGAEEIYPKIGD
FT                   IQPLARLLRLPYFPVTPFFPVLGPLGTIPLPTKWHIEFGQPIRTDDYAVDASDDQMLVL
FT                   TLTDQVRESIQNLLYRRLARRRGVFTG"
FT   gene            complement(277670..278641)
FT                   /locus_tag="Svir_02790"
FT   CDS_pept        complement(277670..278641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02790"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD-superfamily subfamily IB hydrolase, TIGR01490; Haloacid
FT                   Dehalogenase superfamily, subfamily IB, phosphoserine
FT                   phosphatase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95361"
FT                   /db_xref="GOA:C7MT00"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT00"
FT                   /protein_id="ACU95361.1"
FT                   /translation="MEAVCVSRWWGRGKRRERERLAALAGEASADAAVAMEAASLATTE
FT                   PETKPDTEQEPHEAPKPPPVPQDLTAAAFFDVDNTMMMGASIFHFARGLAARKYFSTSD
FT                   LAGFAWQQVKFRVGGRENHQGMQSSREQALSFVAGRSVEEMVAIGEEIYDELMADKIWA
FT                   GTRALAQMHLDAGQRVWLVTATPVELAAIIARRLGLTGALGTVAESVDGVYTGRLVGDL
FT                   LHGRAKAHAVRALAAREGLDLRRCTAYSDSQNDVPMLSVVGTAVAVNPDSGLREIARAR
FT                   GWEIRDFRTGRKAAKIGVPSVLGAGAVAGAVAAGLAHRKRIA"
FT   gene            complement(278703..279830)
FT                   /locus_tag="Svir_02800"
FT   CDS_pept        complement(278703..279830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95362"
FT                   /db_xref="GOA:C7MT01"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT01"
FT                   /protein_id="ACU95362.1"
FT                   /translation="MEAEAVSRAAWFRTRRRDDERFARAVESGSDSDSFGAELAVVAAL
FT                   RRLGDSVTVDDRARERIVRRIVASPPRPRPRARLRPAALLAGLFSLVVALTGLGTALAQ
FT                   NALPGEPLYHLKLVQETVTLGLTFDAEDDAVRRLSYASRRLDEMTELGRHEGPDDSDED
FT                   GYQLALREFTAHATEGTSRLTALATRSDTRLLSVLSSWARRESTRLDTLIPALPATVGD
FT                   DLGTLLQRIERRATALSARMDCYEITSATTDDLGALPATSGCAAPSPLPQHTDKPHTRP
FT                   SIPAKRKEHTPPRDVPAPEHRRASMAIPYDTPEQSRRPVQPEGSLDPTDVAPPPTVPAP
FT                   VPAPTRARLPDSSPEEPPLLSIAPLLPGLPAVTIG"
FT   gene            complement(279897..280568)
FT                   /locus_tag="Svir_02810"
FT   CDS_pept        complement(279897..280568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02810"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95363"
FT                   /db_xref="GOA:C7MT02"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT02"
FT                   /protein_id="ACU95363.1"
FT                   /translation="MRLSKAHPTDHDARNATTDIPEATESAESADPSASAVAENWELVR
FT                   AAQHGDSTAFATLYHRHVDSVFRYVLLRVGDRHLAEDVTSETFLRALRRITSISYQGRD
FT                   VGAWFTTIARNLVLDHIKSSRFRLEIVTDEVRDPGTRDNHTNTAPGPEQEVISRSTSDE
FT                   LLRCIADLGDDQRECIILRFIQGYSVAETAAIMQRNEGAVKALQHRAVRRLAKLLPHGL
FT                   R"
FT   gene            280813..282375
FT                   /locus_tag="Svir_02820"
FT   CDS_pept        280813..282375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02820"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95364"
FT                   /db_xref="GOA:C7MT03"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT03"
FT                   /protein_id="ACU95364.1"
FT                   /translation="MTGGSGNVADLAAAAARDRADEPALIDTATGVTFTWREVDRSVTA
FT                   TAQRIQKAGVEPGDRVAVRFPASAAFAVSFFAVLRAGGIAVPLNPYEPASASLTSLADS
FT                   GARVLLTDSSSARSFRAAGVAVLEPVFDDAGDAKGDVAGLTPSARGGEDVAALLYTSGT
FT                   TGPARGVMLSHRALLANVEQLRSLTPSPVEPGDRVFLAVPFHHVYGLGPGLLAVTAAAA
FT                   TAVLAPRFEVRSALSDCLHHQVTVVLGVPAMYVEMVTRPADELGKCLSTVRLLVSGAAP
FT                   LRPKVLADIRAATGLPVYEGYGFTEAAPVVTSTLVTGYAKPGSVGRPLPGVEIRLVDDE
FT                   GRCGPVPADPDEPGDSFDADGCTGLVAVRGPNLFSGYWPDGTHGPDEDGWFRTEDVGYL
FT                   DVDGDLHLVDRVSDLVIVNGFNVYPREVEEVIAQLPQVAEVAVIGVLDRRSGEAVKAVV
FT                   VPAAGAGLSEQQVIEHCESRLAGYKVPRFVEFADELPQSAMGKVRRVDLRGQDGVSEDG
FT                   DHA"
FT   gene            282368..282631
FT                   /locus_tag="Svir_02830"
FT   CDS_pept        282368..282631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02830"
FT                   /product="Glutaredoxin-like domain (DUF836)"
FT                   /note="PFAM: Glutaredoxin-like domain (DUF836)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95365"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT04"
FT                   /protein_id="ACU95365.1"
FT                   /translation="MPESSSQDTEHTVVVLTRVGCPACEQAERDVERICGELGVRWSTT
FT                   DVDTDPELRAEYGDRVPVILVDGAEHGYWSVDEQRLRSALGA"
FT   gene            282852..283724
FT                   /locus_tag="Svir_02840"
FT   CDS_pept        282852..283724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02840"
FT                   /product="AT-rich DNA-binding protein"
FT                   /note="PFAM: CoA binding domain; Putative DNA-binding
FT                   protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95366"
FT                   /db_xref="GOA:C7MT05"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT05"
FT                   /protein_id="ACU95366.1"
FT                   /translation="MVAQRGRRNGRNGSAPAAKSASDVDNAPTAPLPVTGGDPTTAPTG
FT                   AASAGGAGSNTTRSIPEAAVARLAVYLRVLSAMAEQGATTVSSEELSAAAGVNSAKLRK
FT                   DLSYLGSYGTRGVGYEVEVLIGQIERTLGLTRKHKVAVVGIGNLGHALANYGGFPGRGF
FT                   PVAALFDIDPDLIGVPVGGIPVSHLDDIPKVCVERDISIGVIATPPAAAQSVCDRLVAG
FT                   GVQSILNFAPAVLQVPDHVEVRKVDLAVELQILSFHVARKAGGEVEGREADGNAEGGAD
FT                   GDAKGAVMS"
FT   gene            283724..285055
FT                   /locus_tag="Svir_02850"
FT   CDS_pept        283724..285055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02850"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="PFAM: Shikimate / quinate 5-dehydrogenase;
FT                   Glutamyl-tRNAGlu reductase, N-terminal domain;
FT                   Glutamyl-tRNAGlu reductase, dimerisation domain; TIGRFAM:
FT                   glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95367"
FT                   /db_xref="GOA:C7MT06"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT06"
FT                   /protein_id="ACU95367.1"
FT                   /translation="MSILAIGLSHRTADLATLERVAVPAAEVGKVLHELQQADDVSEVM
FT                   LLSTCNRIEVYAVVETFHGGLASIADVLARQAGMETAELYDHFYVHYAGAAVEHVFSVA
FT                   SGLDSMVVGETQILGQVRTAYATARETGTVGSTLHELIQTTLRVGKRVHTETGLDRLGA
FT                   SVVSEALAAAGELSGRRALVVGAGSMGALATSQLRKGGIAEIVVINRTPERAARLVSSL
FT                   TEQGVTAKAAPMAELADEVARADVVVVCTGAKNAVLGTEHVAPRADRPVVVCDLGLPRD
FT                   VEPEVGSVPGVTLVDLETVRKRMAESGTATTDKQLAKASGIILDEVRAYLAGQRSAAVT
FT                   PTVTALRKRAAEVVDAELLRLDRRLPDLDADVRDELGRTVRRVVDKLLHTPTVRVKQLA
FT                   AEKSGTDYANALRELFGLDPQVPTVVSSPSAASQHDQIDGDHSD"
FT   gene            285048..285998
FT                   /locus_tag="Svir_02860"
FT   CDS_pept        285048..285998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02860"
FT                   /product="hydroxymethylbilane synthase"
FT                   /note="PFAM: Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95368"
FT                   /db_xref="GOA:C7MT07"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT07"
FT                   /protein_id="ACU95368.1"
FT                   /translation="MTNPSSRTLRIGTRASNLAMSQTRTIAKMLEEAGQKVELVPVSTP
FT                   GDRSSAPIAEIGVGVFTSALREALLANEVDVAVHSYKDLPTAPQPGIVLAAVSKREDPR
FT                   DVLISRDGLTLGELPPGAKVGTGSPRRMTQLRALGLGLEIVPIRGNIDTRIAKVTSGEL
FT                   DAIVLAKAGLTRVGKLDLITEVIDPMQILPAPAQGALAVETRVDDVDTEHLLRSIVDHE
FT                   ATRVAVAAERAVLATLQAGCSAPVGALAEVVEDLDSEGAVVERLSLRGVAATATEGDSV
FT                   QILRASGVADKHEADRLGRTVASELLDLGAGALSR"
FT   gene            286066..287616
FT                   /locus_tag="Svir_02870"
FT   CDS_pept        286066..287616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02870"
FT                   /product="uroporphyrinogen-III synthase
FT                   /uroporphyrinogen-III C-methyltransferase"
FT                   /note="PFAM: Uroporphyrinogen-III synthase HemD;
FT                   Tetrapyrrole (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95369"
FT                   /db_xref="GOA:C7MT08"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT08"
FT                   /protein_id="ACU95369.1"
FT                   /translation="MTRARKTTGRVAFVGSGPGDAGLLTVRARDLLAKADLVVTDPDVP
FT                   AGVLAYAGPEAEVRPAVGEPGDVAKDLATEAKAGRLVLRLTSGDPLTQQAVIAEVQAVS
FT                   RTNAVFDVVPGVPAGTATPAYAGIALGGVRTEVDLRSGEVDWAKLASAPGAIVLHATSS
FT                   HLAEAASALVEHGMSDQTPVAVTSNGTINTQRTLDSTLASLAADAGELVGPLVVTIGEP
FT                   VSNRQKLSWWESRALYGWKVLVPRTKEQAGDMAERILSHGATPHEVPTISVEPPRSPAQ
FT                   MERAVKGLVDGRYQWLVFTSANAVRAVWEKFNEFGLDARAFSGVKIACVGEATADRVRS
FT                   FGIIPELVPKGEQSSEGLLQEFPPYDDVLDPVNRVLLPRADIATEILSAGLQERGWEVD
FT                   DVTAYRTVRAAPPPAETREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTLVACIGPK
FT                   TAETATEFGLRVDVRPEQPNAVMLVDALAEHAAKLRAEGALPPPRKAKRTRRSSSSSS"
FT   gene            287705..288676
FT                   /locus_tag="Svir_02880"
FT   CDS_pept        287705..288676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02880"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95370"
FT                   /db_xref="GOA:C7MT09"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT09"
FT                   /protein_id="ACU95370.1"
FT                   /translation="MFPEHRPRRLRTTAAMRRLVSETTLRPRQLILPLFVAEDAREPRP
FT                   IGSMPGVVQHTRDTLRRAAVEAVEAGVGGLMLFGVPAERDAVGGGATDADGILNVALRD
FT                   LRSELGDATVLMADTCLDEFTDHGHCGVLDESGAVDNDATLERYAEMALAQAEAGAHML
FT                   GPSGMMDGQVGVIRRALDDAGYTDTGILAYSAKYASAFYGPFREAVDSQLTGDRNTYQQ
FT                   DPGNAREALREIELDIAEGADAVMVKPALAYLDVVKAAAEVSPVPVAAYNISGEYSMIE
FT                   GAAANGWIDRERTILEVLTSIRRAGADLILTYWAAEAAAWLD"
FT   gene            288687..289247
FT                   /locus_tag="Svir_02890"
FT   CDS_pept        288687..289247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95371"
FT                   /db_xref="GOA:C7MT10"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT10"
FT                   /protein_id="ACU95371.1"
FT                   /translation="MTEPGESGEQPEPRESDDERRARGLPPEPTSSGQRGEKVKPPTPV
FT                   TVSFILYVLAGLVLVLAFGYTLTQQDLVAETLIDLNTAENLSEEQIRSGVTTLLWTLFV
FT                   GAVALAVLFALFGWKARQGTRSARTVLTVLTAIIVLLQLLLFPTSLPMLVASLLAVAGT
FT                   VLLYLPSVAPYFPKPQGSGGTRR"
FT   gene            289310..289702
FT                   /locus_tag="Svir_02900"
FT   CDS_pept        289310..289702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95372"
FT                   /db_xref="GOA:C7MT11"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT11"
FT                   /protein_id="ACU95372.1"
FT                   /translation="MTWGPLFAFVGYVGELLSGGRVNTTLWLSVGVGLFALTALWVYAR
FT                   RRFLSTRVTDTELWQGGERLAVDRITAVDDVEAPPGARVLGGGLSVPRKFAEVPLRLDD
FT                   DTVVLAWARDGDALREALRSVLRDRT"
FT   gene            289716..290057
FT                   /locus_tag="Svir_02910"
FT   CDS_pept        289716..290057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95373"
FT                   /db_xref="GOA:C7MT12"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT12"
FT                   /protein_id="ACU95373.1"
FT                   /translation="MTDAVSATPSSSSRHAQDRLHQPFRLVVAAVELVLAVVSGWAVTW
FT                   CWGNAVGTMTIRANDGAELVSRVYEGDWIGLAFACAAVAALLTVDAARQAVLGVRTRRW
FT                   RRRRSSRPA"
FT   gene            290100..291404
FT                   /locus_tag="Svir_02920"
FT   CDS_pept        290100..291404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02920"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="PFAM: Aminotransferase class-III; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95374"
FT                   /db_xref="GOA:C7MT13"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT13"
FT                   /protein_id="ACU95374.1"
FT                   /translation="MSGAVEQSKSWFERATAATPGGVNSPVRAFAAVGGTPRFMVRGEG
FT                   AYLWDADGNRYVDLVASWGPMILGHAHPEVVRATREAASSGLSFGTPTTGEVELAEEII
FT                   RRVEPVEQVRLVNSGTEATMSAIRLARGFTGRSKIIKFAGCYHGHVDALLAQAGSGVAT
FT                   LGLPTSPGVTGAQAADTLVLPYNDIEAVRAAFAENPDSIAAVITEAAAGNMGAVAPREG
FT                   FNAALRDIAHEHGALLIMDEVMTGFRVSAAGWYGREGVAGDLYTFGKVMSGGLPAAAFG
FT                   GRADVMARLAPSGPVYQAGTLSGNPVAVAAGLTTLRLADDAVYRALDANAERLGGLISQ
FT                   ALAAAGVEHTVSYAGNLLSVYFTDRPVHDYAAAAASETWRFKPFFHALLEGGVYPPPSA
FT                   FEAWFVNAAMDDAAFEIIEAALPKAAQAAASAERP"
FT   gene            291401..292039
FT                   /locus_tag="Svir_02930"
FT   CDS_pept        291401..292039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02930"
FT                   /product="fructose-2,6-bisphosphatase"
FT                   /note="PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95375"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT14"
FT                   /protein_id="ACU95375.1"
FT                   /translation="MTRKTRTIVHLLRHGEVHNPEGVLYGRLPGYRLSERGRRQAELVA
FT                   ETLSSHALTYVVASPLERAQETAAPAAAAHGLDVATDERLIEADNLFEGLKVSVGDGAL
FT                   RRPEHWPKLRNPARPSWGEPYLQIARRMLGAVYAARARAEGREALCVSHQLPIWTLRRF
FT                   LEGKRLWHDPRRRQCSLASLTSLVFDDEELVDIVYSEPAGSTDPTVTGA"
FT   gene            292069..292620
FT                   /locus_tag="Svir_02940"
FT   CDS_pept        292069..292620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02940"
FT                   /product="thiol-disulfide isomerase-like thioredoxin"
FT                   /note="PFAM: Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95376"
FT                   /db_xref="GOA:C7MT15"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT15"
FT                   /protein_id="ACU95376.1"
FT                   /translation="MFAAMAVAVAGCSGGGEGDFNFVSPNGQVDIYYEGEQRQELPEMV
FT                   GEDLFDPDKRISTADFEGQVLVINIWGQWCGPCRAEAPELQQLYEKTKDDGVVVLGVDV
FT                   RDYDRSAPQDFMRDRGLTYPSIYDPSGRSLVNLSGYPRTAVPSTIVVDRQGRVAAVFLR
FT                   ALLASDLQPLIDRLVAEDAA"
FT   gene            292703..293476
FT                   /locus_tag="Svir_02950"
FT   CDS_pept        292703..293476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02950"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="PFAM: Cytochrome C biogenesis protein transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95377"
FT                   /db_xref="GOA:C7MT16"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT16"
FT                   /protein_id="ACU95377.1"
FT                   /translation="MNAVSELAASGPLLLAAGLSLLAGAISFASPCVVPLVPGYLAYLA
FT                   ALVGAEAPAVSPDEAPKKGRLAVVGAAGLFVLGFTVVFTASVGGLVWLADALYFNEELL
FT                   QRVGGVIVIAMAFVFLGFIPALQKDIRFRHVPRAGLWGAPVLGAVFGLGWAPCIGPTLS
FT                   GVLAIAAASGSTGARGVFLVLLYCLGLGLPFLLIAAGARWAVGAATWLRRNSRRVQLFG
FT                   GVLLLVVGVLLVTGLWTDLMGWMRNSVISDVRLPL"
FT   gene            293473..295119
FT                   /locus_tag="Svir_02960"
FT   CDS_pept        293473..295119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02960"
FT                   /product="ResB protein required for cytochrome c
FT                   biosynthesis"
FT                   /note="PFAM: ResB-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95378"
FT                   /db_xref="GOA:C7MT17"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT17"
FT                   /protein_id="ACU95378.1"
FT                   /translation="MSDERTVTDDAPQTARPVYRQTRLQRVLAFLRNTWRSLTSMRTAL
FT                   VLLFLLALAALPGALLPQWDLNAQQTAEYIAENGWWGELLNRLQFFDVYSSVWFSAIYL
FT                   LLMVSLIGCLVPRTGEYLRAMRSGPVLTPRNLARLPHHARAEVNGDPDEVIASVRRRLR
FT                   GWRITERNEPGGVRTISAERGYLRETGNLVFHFGILGIIVAFALGAMYSYEGQVIVHAD
FT                   GQEFCNSGIFAYDSFRPGLRVDGTELNPFCVRVDDFEPTYTEQGQPVNYAADIRYQSGE
FT                   DLASGTWRDYRLEVNSPLRTAGDRVYLLGHGYAPTFTVTWPNGESRTQTIQWRPTDQNT
FT                   MLSQGATKFDPPGITDSRTRRENQLAVTGLFAPTAVFHGNILTSSFPDLTEPAVAVDIM
FT                   RGELGMDSGRAQSIFEIDQSMVDSGRLERVARENLRLGESITLDDGTRISFDGVRRWVS
FT                   LQVSHDPTQGWILGFAIAMFVGLGASLAVKRRRFWARVTPLDTDGDSPAEARDVRRSVV
FT                   ELGGLARTDQAGYGEEFTVISRDLLGRTPQD"
FT   gene            295128..296129
FT                   /locus_tag="Svir_02970"
FT   CDS_pept        295128..296129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02970"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="PFAM: Cytochrome C assembly protein; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95379"
FT                   /db_xref="GOA:C7MT18"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT18"
FT                   /protein_id="ACU95379.1"
FT                   /translation="MQMPVNETLSQYSDWSYTTSVVVYLLAMISFLVEQSFGKHGTRAA
FT                   ERSRARQLVGVGAGAGSDSGDTTSDVAEGTSTGRAPRTRTERIGRMGVALTILAAALHL
FT                   AALVLRGLATSRVPWGNMYEYIMAITFVGVVTWLVLLRKYPLRHLSAFVLLPVVILMFV
FT                   GGTMLYAVAAPLQPALQSYWLVIHVAAAAASSGVFLIPGAASILYLIRSAHDRDPVKFG
FT                   RFAPKLPSADILDKVAYRTTVFAFPVFTFGILCGAVWAEAAWGRFWGWDPKETVAFVAW
FT                   VVYAAYLHSRATAGWRGTRAAVINIVGFAVTVFNLFFVNLVSAGLHSYAGVG"
FT   gene            296339..297370
FT                   /locus_tag="Svir_02980"
FT   CDS_pept        296339..297370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02980"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95380"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT19"
FT                   /protein_id="ACU95380.1"
FT                   /translation="MPPARSTQSAQPTRYVARGHPPLSPPQYPDHSYPLGDAGLDTARF
FT                   VRKPKREPKSGWRRAVYVATGKLVNLGESPADRRRRELISRVNQPLRGCYRIAMLSLKG
FT                   GVGKTTITTTLGSTFASLRGDRVIAVDANPDAGTLSQKIPIETTATVRHLLRDADRITR
FT                   YSDVRTYTSQGSSRLEILASDSDPAVSEAFSEHDYLRVISVLERFYNIVLTDCGTGLMH
FT                   SAMKGVLDSADMLVVVSSGSLDGARSASATLDWLDAHGYGDLVTQSVVVINSVRPKAGS
FT                   VDLDKLSAHFAARVRAVARIPFDPHLEEGAEIELERLTNGTRSALLELAATIADGFSGY
FT                   AVG"
FT   gene            complement(297386..297583)
FT                   /locus_tag="Svir_02990"
FT   CDS_pept        complement(297386..297583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95381"
FT                   /db_xref="UniProtKB/TrEMBL:C7MT20"
FT                   /protein_id="ACU95381.1"
FT                   /translation="MLYLLAAIGAATVAFLLWRALGADRIGVSSSSRQAPVAPDDDPEF
FT                   LRRISEQQRRQRNTDEDGTN"
FT   gene            complement(297706..297915)
FT                   /locus_tag="Svir_03000"
FT   CDS_pept        complement(297706..297915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03000"
FT                   /product="DNA-binding protein, excisionase family"
FT                   /note="PFAM: MerR family regulatory protein; TIGRFAM: DNA
FT                   binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95382"
FT                   /db_xref="GOA:C7MTB2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB2"
FT                   /protein_id="ACU95382.1"
FT                   /translation="MTASTGGRLLTPGEVAALFRVDPKTVTRWATAGRIGSIRTPGGHR
FT                   RFRESEVNQLLAELTTDANERPRN"
FT   gene            298071..298496
FT                   /locus_tag="Svir_03010"
FT   CDS_pept        298071..298496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95383"
FT                   /db_xref="GOA:C7MTB3"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB3"
FT                   /protein_id="ACU95383.1"
FT                   /translation="MSERRSDTLLRDLVLYVLARFALVAVITAVLVLFRVPLLVALVMG
FT                   LVVGLPLGLLLFRSLNNRVTAGLAARNEHRARERARLRAQLRGEEPDIDESGGADGPSD
FT                   SSRSSDSSGSGGGSATDDTDRPDESDKPDKPDRGGDE"
FT   gene            298493..299557
FT                   /locus_tag="Svir_03020"
FT   CDS_pept        298493..299557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03020"
FT                   /product="cysteine synthase"
FT                   /note="PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95384"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB4"
FT                   /protein_id="ACU95384.1"
FT                   /translation="MNDAWVRNAIRIIEADANRSADTHLHVFPLPPEWGIDLYLKDESV
FT                   HPTGSLKHRLARSLLLYGLVNGRIGPDTVLVEASSGSTAVSEAYFARMLGLEFVTVVPR
FT                   NTSQEKIDLIEFYGGRCHFVDRPPDMYTEAERLAAECNGHYLDQFTYAERATDWRGNNN
FT                   IAESVFTQLRSERHPIPTWIVVGAGTGGTSATFGRYVRYRRHNTRIAVVDPENSAFYGA
FT                   WQTGERDYQTGMPSRIEGIGRPRVEPSFIPEVIDEMIQVPDAASLAAIRFLRQRTGHWA
FT                   GGSTGTNLYGAFTLISRMLANGERGSVVTLLCDGGERYAGTYYNDAWLAEHGLDIEPYL
FT                   KAFDRFLETGVFPG"
FT   gene            complement(299601..300476)
FT                   /locus_tag="Svir_03030"
FT   CDS_pept        complement(299601..300476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03030"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase family; TIGRFAM:
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95385"
FT                   /db_xref="GOA:C7MTB5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB5"
FT                   /protein_id="ACU95385.1"
FT                   /translation="MATVAEWIEGARPRTLPNAIAPVLVGVGAAAQLDAVSWWRSLLAL
FT                   LVAVALIIGVNYANDYSDGVRGTDNERVGPLRLVGSGAASAKAVLGAALGLFLLAALFG
FT                   LVLVLASGQWWLLLVGASCIAGAWFYTGGSRPYGYAGFGEVAVFVFFGLTAVLGTVYVQ
FT                   AERVSWEALGCAVAVGCLSVAVLVANNLRDIPTDREAGKITLAVRLGDRGTRRFYLALV
FT                   TVPFLVTAALAFAHPVTSVGLLAAPLLVTPVRAVMAGNTGVRLIPVLRDTGMAMLAWAI
FT                   LTGAALAFTG"
FT   gene            complement(300482..301660)
FT                   /locus_tag="Svir_03040"
FT   CDS_pept        complement(300482..301660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03040"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95386"
FT                   /db_xref="GOA:C7MTB6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB6"
FT                   /protein_id="ACU95386.1"
FT                   /translation="MRVVWSNGSEDSVAELARALLDALDGGPAVLPLDPRNPVAGDVRD
FT                   AMRPDEPVEPGTAVIIPTSGSTGRPKGTLLSTQALLASARATHARLGGPGRWLLATPPV
FT                   YIGGLQVLVRSHLAGTTPVVLDTSQGFRPEAFEEAAREVFSSPGPHYTALVPTQLARLL
FT                   DAGGAGAEGFDAIVLGGAALPDELRRRAERAGVSVVPSYGMSETASGCVYDGVPLDGVA
FT                   VRLGDKDRIEVSGAVLAHGYRLDPEQTATSFVDGWFRTNDIGRLSADGRLTVLGRIDDM
FT                   INTGGVKVPARHVEDALTRQDGVAAACVVGLPDPEWGQLVAAVVVPASSAHPPSVDRLR
FT                   DAVKADLGPAAAPKLIRTLDELPLIGPGKVDRSAVRRLLHDHVDHHDGDAEK"
FT   gene            301700..301804
FT                   /pseudo
FT                   /locus_tag="Svir_03050"
FT   gene            302118..302585
FT                   /locus_tag="Svir_03060"
FT   CDS_pept        302118..302585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95387"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB7"
FT                   /protein_id="ACU95387.1"
FT                   /translation="MNSRISRYERAHRLTHLAHQLRGVAERELLFTIDMGEVEPLVKLS
FT                   GAQADVVHSRLRSCGDRTGYEIEDGGDWSLVEPDTHRKTCSVSSSPRMEWLGGGGNTAV
FT                   VTRDMSEHWGYGTAGAHVGPLVVDGLMVVCGFALLALSPRRETRVTAAVPS"
FT   gene            302596..302883
FT                   /locus_tag="Svir_03070"
FT   CDS_pept        302596..302883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03070"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95388"
FT                   /db_xref="GOA:C7MTB8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB8"
FT                   /protein_id="ACU95388.1"
FT                   /translation="MRRNLFAWFSLPGLATGVSRTRFPTTRSGGFPMGENDVGRRIREV
FT                   RAWRGLSLRATAELTGITHGYLAQLERGEKPVKNRQLLEALARTLRVSPR"
FT   gene            302942..303904
FT                   /locus_tag="Svir_03080"
FT   CDS_pept        302942..303904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95389"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTB9"
FT                   /protein_id="ACU95389.1"
FT                   /translation="MAELADLLGGWWVGEVPDAPTRPLAGVLADLRRFHEARNSPGPKV
FT                   AGDYPTQIGTLSRLIRDLLAAAAEPAHEHRVLAPLLTAYHVAGSIAMRLRIPGLPSLAA
FT                   DRMQQVADRLDDPVWQAVAAWGRAQFLSGVNRARQYELAVAAADMAPADRPETRGMANL
FT                   TAAMAAATQGDADLAETHLAEAAAIAERVEPDVSPWPAGVMQLGRTNVGIFRVTVGVEL
FT                   GHGARVAEVAEGVRLETISRGRQASFWLDYGRGLLTDRGRRDEGLSALLRAEQLAPQQV
FT                   HTNVFAREAVAELQRSSRRDASGREVRGLAWRMGLAPTG"
FT   gene            complement(304057..304311)
FT                   /locus_tag="Svir_03090"
FT   CDS_pept        complement(304057..304311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC0"
FT                   /protein_id="ACU95390.1"
FT                   /translation="MAQDRACGGPVGAGDHVLGERAQRLADLTETVRGEFATVLGGHER
FT                   EHDFTQTRVYLSEPCQQFTVAGDHRSPSSPLDGIALVLS"
FT   gene            complement(304860..305783)
FT                   /locus_tag="Svir_03100"
FT   CDS_pept        complement(304860..305783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03100"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase family; TIGRFAM:
FT                   naphthoate synthase (dihydroxynaphthoic acid synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95391"
FT                   /db_xref="GOA:C7MTC1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC1"
FT                   /protein_id="ACU95391.1"
FT                   /translation="MPHAQVSELFDPAEWDEVAGFDFTDITYHRSKRTRSGKRVVRVAF
FT                   DRPEVRNAFRPHTVDELYRALDHARMSSDVGCVLLTGNGPSPKDGGWAFCSGGDQRIRG
FT                   RSGYQYASGETSDTIDPARAGRLHILEVQRLIRFMPKVVIAVVPGWAAGGGHSLHVVCD
FT                   LTLASAEHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRAYTAQEAHSMGA
FT                   VNKVVPHERLEAEALEWAWEVLGKSPTAQRMLKYAFNLIDDGLVGQQLFAGETTRLAYM
FT                   QDEAIEGRDAFLQKREPDWSNYPYYY"
FT   gene            305886..307565
FT                   /locus_tag="Svir_03110"
FT   CDS_pept        305886..307565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03110"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="PFAM: Thiamine pyrophosphate enzyme, N-terminal TPP
FT                   binding domain; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95392"
FT                   /db_xref="GOA:C7MTC2"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC2"
FT                   /protein_id="ACU95392.1"
FT                   /translation="MNPSTAQARVLVDELVRNTVSHVVLSPGSRNAPLSFALHDAAMAG
FT                   RLTLHVRIDERSAAFLALGIAARTGRPVALVCTSGTAAANFHPAVLEADRAGVPLIVLT
FT                   ADRPPELRAAGANQVIDQRGLYGPAVRYFDELAVAERRPGQNAYWRSQICRAWNAAYGE
FT                   WRCGPVHLNIPFREPLVPDGKDDPDDWPEPLDGRPQGARWTELPDFGALPSSVVPSARH
FT                   GLVVACDAGVRAAGEWAELHGWPVVSETGGLGLGGTTAIAGGVWLLGVEEFLAEHKPEQ
FT                   VLCIGRPTVFRQVQRLLSDPDIEVLLVRPDSDWPAPAHNVRQVGQWFDEPAKPADPEWL
FT                   SRWREADAAAVAAVRETLAEQPWPTGLSVASELVENLPPDSLLVVGSSNPTRDVALVGG
FT                   RRPDVLVHRNRGVAGIDGTISTAVGAALVHSGPAYALVGDLTFLHDVNGLLAGPTESRP
FT                   DLTIVVLNDDGGGIFSLLEQGEEQHSARFERVFGTPHGADLSALCAGYGVPYTLASSRE
FT                   VLREALRPAPGLRVVEVRVDRSRHRELHALLRGAVAKAIDTR"
FT   gene            307605..309134
FT                   /locus_tag="Svir_03120"
FT   CDS_pept        307605..309134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03120"
FT                   /product="aminopeptidase N"
FT                   /note="PFAM: Peptidase family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95393"
FT                   /db_xref="GOA:C7MTC3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC3"
FT                   /protein_id="ACU95393.1"
FT                   /translation="MNYRACMRIRTRACFGGVATGLATVLLASTASAAPAPGAPGVGDP
FT                   YYPGDGNGGYDVTHYDIRLTYQPDVDGLSGTTTILATAETELSSFNLDFALDIRSVRVN
FT                   NRPARVERDTADPTEVVVTPSEPLPEGSPMTVVVRYADTPSKVTVDGWTAWKLTDTGAL
FT                   AVDEPHIAEWWFPSNDHPTDKATYDVAVEVPDDVVALSNGVLSSRSKVRAGWTRWHWRS
FT                   TEPQATYLTFLAVGDYDVRQATTPSGLPIVNAYDAGLGSIRPAAEASVERTPEVIEFLE
FT                   GVFGPYPFEAQGGVVTNGLGFALENQTRSVYDAGFFRHGTNMSVVVHENAHQWFGDSVS
FT                   LERWSDIWLNEGFATYAEYLWSEHIGEGTAAELAQYVYDSVPADDDFWQVLPGDPGADA
FT                   QFHPAVYDRGALAVHALRTAVGDEVFFELMRTWLEDKRGGHGNIEEFIALAERLAGTQL
FT                   DDVFEEWLFTKGKPEAGPNGAATRAASAGPVAEPKSYAEIAFTHELLAAGH"
FT   gene            309157..309648
FT                   /locus_tag="Svir_03130"
FT   CDS_pept        309157..309648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95394"
FT                   /db_xref="GOA:C7MTC4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC4"
FT                   /protein_id="ACU95394.1"
FT                   /translation="MRTGDTPEHVDTPETRREHALRLGSWVVLGVASLITLLGVVLVLG
FT                   AFRNDQVIAENRGIATGQVEQVLFDRTLVRYETPDGVSHSPENGVLYPEGLTAGQLVRI
FT                   EYDTTDPELAKVAGRTWLVTLLPVASTLLITWLVAAPLLWFLRTRLRALSKPAAVAGSV
FT                   "
FT   gene            309744..310442
FT                   /locus_tag="Svir_03140"
FT   CDS_pept        309744..310442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03140"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="PFAM: ubiE/COQ5 methyltransferase family; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95395"
FT                   /db_xref="GOA:C7MTC5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC5"
FT                   /protein_id="ACU95395.1"
FT                   /translation="MARASLDKNPADVAAMFDGVAKRYDRANSVMTFGFDRRWRVITGR
FT                   VLDARPGERVLDLAAGTGVSTEEYARGGAWCVAADFSFGMLRGGRHRGVPMVAADALRL
FT                   PFADNSFDAVTISFGLRNFVDTKAALVEILRVVKPGGRLVVCEVSTPPFAPIRFVYRKF
FT                   ILRLMTWFGRKVSSNPDAYSYLFESMLTWPDQRRLAEIIADSGWHSVEWMNLTFGVVAI
FT                   HRARKPKGDS"
FT   gene            310452..311726
FT                   /locus_tag="Svir_03150"
FT   CDS_pept        310452..311726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03150"
FT                   /product="geranylgeranyl reductase family protein"
FT                   /note="PFAM: FAD binding domain; TIGRFAM: geranylgeranyl
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95396"
FT                   /db_xref="GOA:C7MTC6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC6"
FT                   /protein_id="ACU95396.1"
FT                   /translation="MTHDAEVIVVGAGPAGSTVATYLARAGVDVLLLEKTGFPREKVCG
FT                   DGLTPRGVKQLIDLGIDTSREAGWMHNRGLRIFTGELMLELDWPDLTSYPPYGVSRTRH
FT                   DFDELLAKTAVEAGARLLERTTVTGAITDERTGRVVGVEAKRGPERKPVSYRAPLVLAC
FT                   DGVSARLALSVGIEKNDSRPMGVAVRRYYRSPRHDEAYIEGHLELWDRSDPRDPKLLPG
FT                   YGWAFPLGDGTVNVGLGMLSTSKSFRNIDYRKLLHSWLASTPEEWGYREENAVGRIGGA
FT                   GIPMGFNRTPHYRNGLLLLGDAGGMVSPFNGEGIAAAMESARVAAEHVVQALARPEGAS
FT                   RERVLHGYPRVMADRMGGYYRLGNLFAKAIGHPKVMRAATKYGLRISPLIPLVFKGLSG
FT                   CYEHKGGDVVDRLVATLSRITPAPR"
FT   gene            312142..312561
FT                   /locus_tag="Svir_03160"
FT   CDS_pept        312142..312561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03160"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95397"
FT                   /db_xref="GOA:C7MTC7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC7"
FT                   /protein_id="ACU95397.1"
FT                   /translation="MNSSVSAVEVLAQESADSGLGVFLPLVLLFGLAVAFALFSVLLGP
FT                   LFGPSRYNKAKVSAYECGIEPSPQPLTGGGRMPIAYYVTAMLFILFDIEMVFLFPYAVS
FT                   ADLLGLWGVAAVSVFIATFFIADIYVWRRGGLDWN"
FT   gene            312568..313116
FT                   /locus_tag="Svir_03170"
FT   CDS_pept        312568..313116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03170"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 Kd subunit;
FT                   TIGRFAM: NADH-quinone oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95398"
FT                   /db_xref="GOA:C7MTC8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC8"
FT                   /protein_id="ACU95398.1"
FT                   /translation="MGLEEKLPNGFLLTTLEGVVNWARKNSMWPATFGLACCAIEMMTT
FT                   GGSRYDIARFGMERFAATPRQADLMIVAGRVTQKMAPVLRQIYDQMPEPKWVLAMGVCA
FT                   SSGGMFNNYAVVQGVDHIVPVDMYLPGCPPRPEMLLDAILKLHAKVQDEPMGPRRAALR
FT                   AKSGKQTEIIPSSIKYAKK"
FT   gene            313123..313884
FT                   /locus_tag="Svir_03180"
FT   CDS_pept        313123..313884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03180"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase, 30 Kd
FT                   subunit; TIGRFAM: NADH (or F420H2) dehydrogenase, subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95399"
FT                   /db_xref="GOA:C7MTC9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTC9"
FT                   /protein_id="ACU95399.1"
FT                   /translation="MPDEKPETGGELSSAEHSEKGLRPQGSEPAKPTKPVVAGRERRGM
FT                   FGVSGTGDTSGYGGLRLPAYSPPPAERPYGGWFDDFADEFYAALADNGIPADAIQQVTI
FT                   DRGEITFYVQREYLVDICRTLRDDEGLRFELCNSVSGVDYGVDVPQRLHSVYHLTSMTY
FT                   RRRIRLEVAVDVDDPHIPSIVDVYPTADWQEREAYDMFGIIYDGHPALTRILMPDDWEG
FT                   HPQRKDYPLGGIPVEYKGAEIPPPDTRRSYS"
FT   gene            313881..315263
FT                   /locus_tag="Svir_03190"
FT   CDS_pept        313881..315263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03190"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.99.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase, 49 Kd
FT                   subunit; TIGRFAM: NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95400"
FT                   /db_xref="GOA:C7MTD0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD0"
FT                   /protein_id="ACU95400.1"
FT                   /translation="MTTSDRIADVNTDTDTPAENGDGADGARYAEHRDTTEGRVYTVGG
FT                   GDWDDVLADATKSERMIINMGPQHPSTHGVLRLVLEMEGETVTQLRSVIGYLHTGIEKN
FT                   CEYRTWTQAVTFVTRMDYLSPLFNEMGYCLAVEKLLGIEVPRRAQLLRILLMELNRLGS
FT                   HFVYIATGGMELGSTTAMTIGFREREEVLHLLEHLTGLRMNHAFIRPGGLAQDMPEDFE
FT                   EKVTEFCKVMDKRLPLYDKLFTGQPIWRNRLKGVGFLPLDACLALGVTGPVLRSAGLAW
FT                   DLRKVDPYSGYDEIDFEVPTSTDADCWARYLLRVEEMHQSLRIIRQVLKMLEPGPVMVE
FT                   DRKIAWPAQLSISSDGMGNSLEHVRKIMGQSMESLIHHFKLVTEGFRVPPGQVYSAVES
FT                   PRGELGFHLVSDGGTRPLRVHVREPSFVNLQSMPAMAEGGLVADVIAAIASIDPVMGGV
FT                   DR"
FT   gene            315260..316021
FT                   /locus_tag="Svir_03200"
FT   CDS_pept        315260..316021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03200"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95401"
FT                   /db_xref="GOA:C7MTD1"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD1"
FT                   /protein_id="ACU95401.1"
FT                   /translation="MTTPSQQPSKKPETDPFGPEIEEQAQQLAARYPQARSALLPMLHL
FT                   VQSVQGYVSQEGIAFCARQLDLTEAEVSAVATFYTMYKRKPCGEHLVSVCTNTLCAALG
FT                   GDEIYKRLSEHLGEDGKPLGHEETVGEPGEPGSITLEHAECLAACDFGPVLQVNYEYFD
FT                   NQTPEKAVELVDALRRGEKPQPTRGAPLTDFRSVERQLAGFFPEDDVFRSDVDSPSQAV
FT                   ETLRGAQLAADRGWTAPAMPDDAPLPEVEAK"
FT   gene            316181..317455
FT                   /locus_tag="Svir_03210"
FT   CDS_pept        316181..317455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03210"
FT                   /product="NADH dehydrogenase subunit F"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: SLBB domain; NADH-ubiquinone oxidoreductase-F
FT                   iron-sulfur binding region; Respiratory-chain NADH
FT                   dehydrogenase 51 Kd subunit; TIGRFAM: NADH-quinone
FT                   oxidoreductase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95402"
FT                   /db_xref="GOA:C7MTD2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD2"
FT                   /protein_id="ACU95402.1"
FT                   /translation="MTPVLTKRWLSPQSWRLATYEKLEGYTALRKALSGTPEQLVQLIK
FT                   DSGLRGRGGAGFPAGVKWSFMPQNDDKPHYLVINADEGEPGTCKDIPLMMADPHSLIEG
FT                   CIIASYAMRAHRCFIYVRGEALHPIRRLNSAVREAYEAGYLGKNILGSGFDLDITVHAG
FT                   AGAYICGEETALLDSLEGRRGQPRLKPPFPASAGLYAAPTTVNNVETIASVPYIVNGGA
FT                   EWFRKMGTEKSPGPKIYSISGHVEKPGQYEAPLGTTLRQLLEMAGGMKDGIPLKFWTPG
FT                   GSSTPLFTAEHIDVPLDFEGAAEAGSMLGTTAVQVFNETVSVPWAVMKWTQFYKHESCG
FT                   KCTPCREGTYWLTQILERMVDGRGTESDIDTLLDICDNILGRSFCALGDGATSPITSAI
FT                   KYFRDEFVELCEKNRASSPELVGAS"
FT   gene            317452..319941
FT                   /locus_tag="Svir_03220"
FT   CDS_pept        317452..319941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03220"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /note="PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   NADH-ubiquinone oxidoreductase-G iron-sulfur binding
FT                   region; Molybdopterin oxidoreductase Fe4S4 domain;
FT                   Molybdopterin oxidoreductase; TIGRFAM: NADH-quinone
FT                   oxidoreductase, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95403"
FT                   /db_xref="GOA:C7MTD3"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD3"
FT                   /protein_id="ACU95403.1"
FT                   /translation="MTIAPEAAEKDETPVPEGHVKLTIDGEEVIAPKGELLIRTAERLG
FT                   IVIPRFCDHPLLDPAGACRQCLVEVEMNGRPMPKPQASCTMTVADGMVVKTQLTSPVAD
FT                   KAQQGVMELLLINHPLDCPICDKGGECPLQNQAMAHGRTESRFVDRKRTFPKPLSISTQ
FT                   VLLDRERCVLCQRCTRFSSQIAGDPFIDLMERGAQQQIGTSETADLVGGETSTGTPFQS
FT                   YFSGNTIQICPVGALTSAQYRFRSRPFDLVSSPSVCEHCSVGCAMRTDFRRGKVMRRLA
FT                   GDDPEVNEEWLCDKGRFAFRYTEAADRVRHPLVRDPETGQLERASWTHALRVAAEGLAK
FT                   ARDGHGVGVLPGGRLTVEDAYAYSKFARVALRTNDIDFRARAHSAEELDFLASHVVGVT
FT                   PETGVTMRQLETAPLVLCVAFEPEEEAPVLFLRLRKGARKNGTKVVHIGQWTTPAVRKT
FT                   FGELLACAPGAEAGAVDGLMEHAPDVDEQLRAEGSVVLVGERAAEIPGLFSALHRLSER
FT                   TGAPIVWVPRRAGERGAVEVGALPTLLPGGVSVSDADARAELERMWGLDAGSLPDAPGR
FT                   DTTGILQAARNGDLDGLVIGGIEVADLPDPELAREALSRCGFVVSLELRHSEVTEHADV
FT                   VLPVAPVDEKSGSFLTWEGRRREFSVTLDGTGALPDCRVLDTLGVEMDADLFTQTPAAA
FT                   AGDLNRVTEQIKPTARSAAPDVPGAPVPTVGQGQALLATWRQLIDDGALLVDEPHLAGT
FT                   ARRVVARVSKATAAALGEPHSVTVSTDRGSVTLPVEIADLPDDVVWLPGNSPGSTLRTT
FT                   LGVGHGAVVSIAAGGER"
FT   gene            319989..321314
FT                   /locus_tag="Svir_03230"
FT   CDS_pept        319989..321314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03230"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /note="PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95404"
FT                   /db_xref="GOA:C7MTD4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD4"
FT                   /protein_id="ACU95404.1"
FT                   /translation="MTRAELLADDPLWLILLKAVVILLIGPILTVFMIVWERKALGRMQ
FT                   NRPGPNRVGPNGWFQSIADAIKLPFKEQVIPDTADRKIYFLAPMIVAVPAMIGLAAIPF
FT                   GPEVTIFGERTVLQLIELPVSVLLILAGASVGVYGIILAGWASGSPYPLLGGLRSAAQV
FT                   ISYEIAMGLSIVGVALYAQSLSTGEIVAAQEHGWYFYLLLPSFVIYLISMVGETNRAPF
FT                   DLPEAESELVGGFHTEYSSMKFAMFFLAEYCNMIIVSAFATTLFLGGWMFPFVGLDSPL
FT                   NQGWLPLLWFFGKTFLLLFGFIWLRGTLPRFRYDQFMKLGWKVLIPVALIWVMVISLIR
FT                   AIRTDGTVSTGQILVVGAIVIAVLVLLTLLLPEKEVPEEDSVPLTGGGYPVPPLDLTVP
FT                   TMTPRQKALRKQEARKSVESQQSEQVEPASVSSGKEATDGDL"
FT   gene            321301..321864
FT                   /locus_tag="Svir_03240"
FT   CDS_pept        321301..321864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03240"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /note="PFAM: 4Fe-4S binding domain; TIGRFAM: NADH-quinone
FT                   oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95405"
FT                   /db_xref="GOA:C7MTD5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD5"
FT                   /protein_id="ACU95405.1"
FT                   /translation="MGIFDPIKGFGVTFATMFKKVATEEYPEAGAPAAPRYHGRHQLNR
FT                   HPDGLEKCVGCELCAWACPADAIYVEGGDNTEEARYSPGERYGKNYQINYLRCIGCGLC
FT                   VEACPTRSLTMINFYELADDDRQKLIYTKEDLLAPLLPGMEEPPHPMRLGDSEQDYYVK
FT                   GPELARQRGVPSGESVETSEEKAV"
FT   gene            321873..322787
FT                   /locus_tag="Svir_03250"
FT   CDS_pept        321873..322787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03250"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95406"
FT                   /db_xref="GOA:C7MTD6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD6"
FT                   /protein_id="ACU95406.1"
FT                   /translation="MTAMTTGMTAVDTLVLAQADAAATVSTGEAIAFWILGPLALAGAL
FT                   GMVFARNAVHSALWLVLTMLSLGMLYLAQQAQFLGFTQIIVYTGAIMMLFLFVLMLVGR
FT                   ESSDSVVEVLRGQRLMAGLVGVGVAGLLAAALTRAIADVTPAPLLDPWSADGGGAGGLG
FT                   RLIFTDYLFPFELTAALLITAAMAGMVLSFTSRHVKGGKRSQRELVIARFRGEYERPSP
FT                   KPGPGVFATSNSVATPALLPDGSVAPESLSDLIESTPTAQLHTQRKQVNGGASKQGPRA
FT                   LVGSDGASLDGTVGARSNEGEDS"
FT   gene            322784..323083
FT                   /locus_tag="Svir_03260"
FT   CDS_pept        322784..323083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03260"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95407"
FT                   /db_xref="GOA:C7MTD7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD7"
FT                   /protein_id="ACU95407.1"
FT                   /translation="MTPTYYLLLSALLFTIGAVGVLVRRNAVVVFMCIELMLNAVNLSL
FT                   VTFSRINGSIDGQVMAFFVMVVAAAEVVVGLAIIMSIFRTRRSASIDDTNLLKY"
FT   gene            323106..325004
FT                   /locus_tag="Svir_03270"
FT   CDS_pept        323106..325004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03270"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains; NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95408"
FT                   /db_xref="GOA:C7MTD8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD8"
FT                   /protein_id="ACU95408.1"
FT                   /translation="MIASSWLLVAFPALGALVLLVGGHRTNAWGHLLGCATVIASFVYG
FT                   LALFFSESLSEAADTTVYSWIPVESLQIDFGLRVDPLSVTFVLLITGVGALIHIYSIGY
FT                   MSNDADRRRFFAYLNLFVAAMLVLVLGNSFVMLYLGWEGVGLASYLLIGWYQDRPAAAT
FT                   AAKKAFLMNRVGDVGLALAIFLMFKHIGSTNYAEVFAGIGDLSPGVITAIALLLLLGAC
FT                   GKSGQFPLQAWLPDAMEGPTPVSALIHAATMVTAGVYLIARSSPIYNLTEDGRLVVTIV
FT                   GAFTLLLGAIIGCAYDDIKKVLAYSTVSQIGYMMLAVGLGPVGYALGIAHLLTHGFFKA
FT                   GLFLGAGSVMHAMNDEVDMRKFGGLAKKMPITAATFGLGYLAIIGFPFLSGFWTKDAII
FT                   EAAFGQEGWRGWVFGGAALLAAGITGFYMTRLVLLTFFGEERWRKTTSADGRAFQPHEA
FT                   PTVMTVPMIVLSVGSVAAGFLLMSGNTLAEFLVPSVGTLVESEHGVLPPALVPWLTVGL
FT                   SALGVLLAWALFGKKPTPVERPENVSWPVRAARNDLYGNALNEALVARPGLWLTRFAVF
FT                   LDNRGVDGAVNGLAAVLGGGSSRLRRMQTGFVRSYALSMLGGSFLLVAALLLVRFS"
FT   gene            325001..326605
FT                   /locus_tag="Svir_03280"
FT   CDS_pept        325001..326605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03280"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95409"
FT                   /db_xref="GOA:C7MTD9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTD9"
FT                   /protein_id="ACU95409.1"
FT                   /translation="MSWLVALILLPLVGALVVAGLRDNDRAATLVALAVAVVELLLVVP
FT                   TWLAYDPGGERLQQVTSFDWIPALGVHVSFGIDGIALVMIAVTALLVPVVIGVLNSTDK
FT                   LPEGRSTGGFLSLILVQEALTIAVFAATDVFLFYVLFEIMLVPMYFLIGFYGGPKRQYA
FT                   AVKFFLYSFLGGLIMLASAIGAYSLAVDELGEGTFDWATLVAVVSDAPVDTQVWLFLGF
FT                   FLAFAIKAPLVPFHTWLPDAAGQAPVAVTVLLVGVLDKVGTFGFLRYSLPMFPDASEQL
FT                   APLVLTLAVLGVVYGSILAAGQQDMKRFVAYVSIAHFGFIALGIFAFTPQATVGSATYM
FT                   LNHSLATGMLILVLGIVAARGGSTQISDYGGMFKLTPILGGMLLLAGMSTLSLPGTNSF
FT                   ISEFLVLLGAFDSRPVFAIIATLGLVLAAAYVLWLYQRIMTGPVKGAALVDVSDDVAPE
FT                   SAVGGGGSGEGGTATAVAPEKTTTTTRKAIRDLSGKEIAVLAPLVVLIVGLGFYPKPVL
FT                   DTVTPSVEATLQAVQER"
FT   gene            326614..328185
FT                   /locus_tag="Svir_03290"
FT   CDS_pept        326614..328185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03290"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95410"
FT                   /db_xref="GOA:C7MTE0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE0"
FT                   /protein_id="ACU95410.1"
FT                   /translation="MLNLHLAQQGPIEAPAIDLPAVMPLVIVLGAACIGVLLEAFLPRQ
FT                   RRWISQVTLSLLAIVAAGVSLALYIPDAPEYGATTLSDTLAIDPPALFLWGTLLALSVP
FT                   ALLLIADRTVERGGAFVAEAGISPGTFQDKEQAATKSMQTEVFPLMLFALGGMMAFTAA
FT                   NDLLTMFVALEVLSLPLYLMCGLARRRRLLSQEAAVKYFLLGAFASAFFLYGLALLYGY
FT                   AGSVRLSDISLAAAGTDRSDTLLFAGLGLLMVGLLFKASVGPFHAWTPDVYQGAPTPVT
FT                   AFMAACTKVAAFGGMLRVLTVGFESTHWEWRGVMWAVAIVSMAIGAVLGLTQTDVKRMI
FT                   AYSSIAHAGFLLVGAMALTDDGLSGTLFYLLTYGFTTLAAFGVISLVRDGGGEATHLSA
FT                   WAGLAKRSPLLAAVFTFLLFALAGIPLTSGFVGKFVVFSAALSDGMAPLVVTGLVFSAV
FT                   AAFFYLRVVVLMYFSKPAEDGPTVSVPGTFTTAAITLGVVVTLLLGIAPTFALDWAGAG
FT                   GFSIMS"
FT   gene            328661..329674
FT                   /locus_tag="Svir_03300"
FT   CDS_pept        328661..329674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03300"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95411"
FT                   /db_xref="GOA:C7MTE1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE1"
FT                   /protein_id="ACU95411.1"
FT                   /translation="MRDGTIDELRAAVGLQIADEELLRTLVVGLNEVEEILREVARSEV
FT                   SAIEEAARHLVDAGGKRFRPMFTLLAAQFGTGGRRDDVITAAAAVELVHLATLYHDDVM
FT                   DEATMRRGAPSVNARWDNSVAILTGDYLFAHASRLVADLGTDAARIIAETFGELVTGQM
FT                   RETVGPGADDDHVEHYLSVIAQKTGSLIATAGRFGGMFSGASPEHVEALRRFGDIIGTA
FT                   FQISDDIIDITSPSTTSGKVQGTDLREGVRTLPMYYALAHDPDPRLVELLSGPLTDDAL
FT                   VEEALELLRRSGGLERTRATLADYARRAREELAVLPASPARDACESVADYLVARTH"
FT   gene            329687..330826
FT                   /locus_tag="Svir_03310"
FT   CDS_pept        329687..330826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95412"
FT                   /db_xref="GOA:C7MTE2"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE2"
FT                   /protein_id="ACU95412.1"
FT                   /translation="MSVFGQVWVFSAIAFVLGAFLAWLFLVRPAQRRIGELRRRLAEAQ
FT                   RAPKAATSTGSATSGAQNTLIAPAPGGDKDTPIASRTRRFEPAAETRSETAAGEATEHL
FT                   APGPRWPEQDSLRGKTPSTARSSELDELDEEFARIDAFHEEELAGSGDAPSGSAEPTEY
FT                   PGGHAGRLNVDSPGDAGDTGGDAHTRRSTSLFDPASSSNASAGPASGTPPQGAAEGTSS
FT                   TSAFGGRPDKSAERPLPERTTMLPKRQPGRSSLESFDRSKPIQPSMRPVERREPQSRPE
FT                   RGGSLFEPAVAPAPASGTTPPARDTSAAGYGMPPGPFGPGSAMPKPGGERPSPEFTVKA
FT                   SVTALRYCVEGSPEFPRMVAEVWFRSPDDAERVGFRPLS"
FT   gene            complement(330908..331972)
FT                   /locus_tag="Svir_03320"
FT   CDS_pept        complement(330908..331972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03320"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /note="PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95413"
FT                   /db_xref="GOA:C7MTE3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE3"
FT                   /protein_id="ACU95413.1"
FT                   /translation="MTQVDLGLPKLGGLDLVPTTDEKQKTKDYKSDQEVRWCPGCGDYV
FT                   VLNTVQSFLPTLGLKRENIVFISGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLATTRP
FT                   DLSVWVITGDGDALSIGGNHLIHALRRNVNLKILLFNNRIYGLTKGQYSPTSESGKITK
FT                   STPMGSLDTPFNPISLAIGAEATFVARALDSDRKGLTEVLTAAAQHRGSALVEIYQNCP
FT                   IFNDGAFDVLKDADESARRIIPLTPGEPVRFGTEGEYGLARSPWGGLEVGKVSEIGEDN
FT                   LIVHDPTIADSTYAFALSRLSDETLSYTPTGIFRHITRPTYDDQVRAQIDQAAQAKPAD
FT                   LQALLRGKDTWTVE"
FT   gene            complement(331969..333903)
FT                   /locus_tag="Svir_03330"
FT   CDS_pept        complement(331969..333903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03330"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="PFAM: Pyruvate flavodoxin/ferredoxin oxidoreductase,
FT                   thiamine diP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95414"
FT                   /db_xref="GOA:C7MTE4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE4"
FT                   /protein_id="ACU95414.1"
FT                   /translation="MSTCPGGNGEKSALRSARSTEVSRLDRVVIRFAGDSGDGMQLTGD
FT                   RFTSEAAAFGNDLATLPNFPAEIRAPQGTIPGVSSFQVHFADYDILTPGDRPDVLVAMN
FT                   PAALKANIGDVPAGGMVIVNTDEFTKRNLAKVGYESNPLTDDSLSAYEVYEVAMSTLTQ
FT                   GALAETGLGKKDAERCKNMFALGLLSWMYHRPTEGTEAFLREKFAAKPQIAEANILAFR
FT                   AGWNYGETTEAFKTTYEVAPAKLPKGTYRQITGNTALAYGIVAAGQLSGLQVLLGTYPI
FT                   TPASDILHELSKHKNFGVITFQAEDEIAGIGAALGASYGGALGVTSTSGPGIALKSETI
FT                   GLGVMIELPLVVIDVQRGGPSTGLPTKTEQADLLQAMYGRNGESPVPVIAPCSPADCFD
FT                   AVLEATRIALTYRTPVLLLSDGAIANGSEPWLIPDVDSLPDLRVEFASKPNAADGSGEF
FT                   WPYVRDPQTLAREWAIPGTPGLQHRVGGLEKADGKGNISYDPDNHDKMVRLRQAKVDGI
FT                   DVPDVEVDDPSGGQARVLALGWGSTYGPIGAACRRVRRKGIPIAQAHLRHLNPFPANLG
FT                   EVLRSYDKVVVPEMNTGQLAWLLRAKYLVDIHSHTKIAGLPFKAEELEHVFTDIATNVS
FT                   PTDKEVVVK"
FT   gene            complement(334049..334495)
FT                   /locus_tag="Svir_03340"
FT   CDS_pept        complement(334049..334495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03340"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95415"
FT                   /db_xref="GOA:C7MTE5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE5"
FT                   /protein_id="ACU95415.1"
FT                   /translation="MNELDQRIVSCLVANARSSYAEIGKVVGLSAPAVKRRVDRLRETG
FT                   VLRGFTAVVDPEALGWGTEAFVEVHCQGNVSPTRIRAHLEPLPEVVAAYTVSGAADAIV
FT                   HLRAADIHHLEDALERLRGLEIIDRTVSTVVLSTLLERPPTPGR"
FT   gene            334582..335394
FT                   /locus_tag="Svir_03350"
FT   CDS_pept        334582..335394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03350"
FT                   /product="N-dimethylarginine dimethylaminohydrolase"
FT                   /note="PFAM: Amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95416"
FT                   /db_xref="GOA:C7MTE6"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE6"
FT                   /protein_id="ACU95416.1"
FT                   /translation="MPRHYVMCPPRHFAVDYAINPWMDPTVPVDPERAMRQWTELRDTY
FT                   RRLGHQVEEVEPQPGLPDMVFAANSGTVVEGRVLGAKFATRERAAEAEHFRRWFLEHGF
FT                   QDVTMPQETNEAEGDFAWTGRLLLAGTGFRTDPRAHAEAQEILGVPVISLRLVDPRYYH
FT                   LDTALFVLSEADDEQPAQIAYYPDAFSPGSQRVLRRLFPDAVLADAADAECFGLNAVSD
FT                   GRHVILPVEATALAEKVAARGYEPVFVDISELRKAGGGPKCCTMEIRK"
FT   gene            complement(335405..336265)
FT                   /locus_tag="Svir_03360"
FT   CDS_pept        complement(335405..336265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03360"
FT                   /product="ABC-type Mn2+/Zn2+ transport system, permease
FT                   component"
FT                   /note="PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95417"
FT                   /db_xref="GOA:C7MTE7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE7"
FT                   /protein_id="ACU95417.1"
FT                   /translation="MTPDDVMIVVIAGLLSTSCALLGSFLVLRRQALLPDAVSHAVLPG
FT                   IVLVFLLTGDRGSAATVLGATAFGVLCVAGSEWLRRTGVVASDAALALAFPALFSLGVL
FT                   GISAYASGAHIDLDSAIYGDITFAPLRTVDVLGTTVPISLLATGLTAGCTVVFTVLLWR
FT                   PLQTATFDPDFAELAGLRGELVGRMLLVVVVGTAVVAFDSLGAILVITFFVVPAVTARL
FT                   LTRRLGTMLVVAVAAGWVSSLVGHRTALVLDSSIAGTIGLTSGALFVLALAWHRLFRGR
FT                   ASARA"
FT   gene            complement(336262..337152)
FT                   /locus_tag="Svir_03370"
FT   CDS_pept        complement(336262..337152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03370"
FT                   /product="ABC-type Mn2+/Zn2+ transport system, permease
FT                   component"
FT                   /note="PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95418"
FT                   /db_xref="GOA:C7MTE8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE8"
FT                   /protein_id="ACU95418.1"
FT                   /translation="MIERLLSALPLSYPDAVVVVGTAVVGFVAGALGPLAVLRRRSMFG
FT                   DAMSHGTLTGVAVAFLATGAKVPETLLLGATISAALAAFAMIALERTGRLRPDAAIGVV
FT                   LSVSLALGIVLITHISATENSQQSGLTGYLLGQTAGMSERDIAIALVLGAVALAAVTVG
FT                   FRVLRSATFDPGFTAVVGVPTWAVDAASTGLLALAVVLGVRTVGAILMVALLVAPVVAA
FT                   RQVTKRLSTLVPLSGLMGAVCGALGGVLSGHAELPAGPVIVLLATGIALVSVVFAPHRG
FT                   VLARVRKAHRKERSA"
FT   gene            complement(337149..337925)
FT                   /locus_tag="Svir_03380"
FT   CDS_pept        complement(337149..337925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03380"
FT                   /product="ATPase component of Mn/Zn ABC-type transporter"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95419"
FT                   /db_xref="GOA:C7MTE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTE9"
FT                   /protein_id="ACU95419.1"
FT                   /translation="MTPTFGSAPSGTRPHKTTPALSLVDFSASYGGRNVLSGVTVDIPS
FT                   AALAAVVGPNGAGKSTLVKAALGLVPSTQGRVRLLGQPLSRVRRKVAYVPQQDSVTKDF
FT                   PITAVQVVEMGRYPHRGWWRRLTPTDDELVAQAMEQVGVVDLADRPIDELSGGQRQRVF
FT                   LARALAQRAELVVLDEPFTAVDARTESALLDVLTNLCREGVSVIVVHHDLRTVLRRFDH
FT                   AVLLAGGVVADGPVADVLTAENLERAYGIAPLVLDS"
FT   gene            complement(337922..338881)
FT                   /locus_tag="Svir_03390"
FT   CDS_pept        complement(337922..338881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03390"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface adhesin"
FT                   /note="PFAM: Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95420"
FT                   /db_xref="GOA:C7MTF0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF0"
FT                   /protein_id="ACU95420.1"
FT                   /translation="MRALALVVLTATLIVSLAVGYALHPASESATLDPHSGEDPVRVVT
FT                   TTTFLDDTVREIGGEHVTTVRLMGPGVDPHLYQAKASDLQQMRRADLVVAVGLHLEGSL
FT                   MRTLQAVAETKPVLFAGEAVPEHLLLSPPPDAGPEEEYDPHVWFEPRLWAYVVDAVTAQ
FT                   LAELDPAHADDYHRRGAAYRERVLAVGEEARALLADIPERSRVLVTSHDAFRYLGRAFD
FT                   LEVLAIQGISTQQEASTADINRVAEIVAEREVKSVFVETSVSDRTVNAVLAAVRHRGGQ
FT                   ARLGAPLYSDSTGEDGTAEGTYLGMVRANAERIAEGLR"
FT   gene            339176..340039
FT                   /locus_tag="Svir_03400"
FT   CDS_pept        339176..340039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03400"
FT                   /product="Heat shock protein"
FT                   /note="PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95421"
FT                   /db_xref="GOA:C7MTF1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF1"
FT                   /protein_id="ACU95421.1"
FT                   /translation="MHKHRNGLKTALLLGLLSAMIVGISGLFGRGALVIGLLVALAVNG
FT                   YAYFNSDTLALRAMRARPVSEAEQPAMYRIVRELATSARQPMPRLYVSPTQAPNAFATG
FT                   RNPRNAAVCCTVGILQILDERELRAVLGHELAHVYNRDILISSVAGALASVVSFLANMA
FT                   MFAGMFGGNRENGVNPLASLLIVLLGPIAAGIVRMSVSRSREYQADASGAELTGDPLAL
FT                   ASALRKLERGTRALPLAPEPKVAAQSHLMIANPFRPGERVAHLFSTHPPIEERVRRLEE
FT                   MARRSF"
FT   gene            complement(340070..340951)
FT                   /locus_tag="Svir_03410"
FT   CDS_pept        complement(340070..340951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03410"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="PFAM: Nucleotidyl transferase; TIGRFAM:
FT                   glucose-1-phosphate thymidylyltransferase, short form"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95422"
FT                   /db_xref="GOA:C7MTF2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF2"
FT                   /protein_id="ACU95422.1"
FT                   /translation="MKGIVLAGGSGTRLHPITQATSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IREILVISTPSDLPNFQRLLGDGSQWGIDLRYAEQPSPNGLAEAFIIGADFVGDDSVAL
FT                   ILGDNIFHGRGFSGLLREQATNLDGCALFGYAVKDPQRYGVGEVDADGNLLSIEEKPSK
FT                   PKSNLAITGLYFYDNQVVDIAKGLTPSARGELEITDVNLTYLRQGRARMHTLGRGFAWL
FT                   DTGTHDSLLEASLFVQVLERRTGVRIACLEEVALQMGFITPDECYQLGAKLAKSGYGDY
FT                   VMSVARDAGASG"
FT   gene            complement(341192..341866)
FT                   /locus_tag="Svir_03420"
FT   CDS_pept        complement(341192..341866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95423"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF3"
FT                   /protein_id="ACU95423.1"
FT                   /translation="MVAVKRIIGTDVLLVAVGTALVLSACSTETSGTKTDQSANAAADS
FT                   SPPAASALEPGAAAEPDDGRANTPDAEAKQPPPDPDYCASKDLSLALGEAEGAAGTVYR
FT                   PLKFTNVSDFPCVLHGFPGVSYVAGEDGHQVGKPATHTGQKGQALTLRPGEVAHADVGF
FT                   TQVANFDPAVCQPTEVRGLRIYPPKETASLFVEIPGTGCASDELPGNQLTVASIEPGAG
FT                   GH"
FT   gene            complement(342148..342639)
FT                   /locus_tag="Svir_03430"
FT   CDS_pept        complement(342148..342639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03430"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF520)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95424"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF4"
FT                   /protein_id="ACU95424.1"
FT                   /translation="MADPSFDVVSKVDRQEVDNALNQANKELSTRFDFRGTGAKIEWSG
FT                   ERAVVIEAETEERTKAAVEVFKEKLVKRGVSLKAFEAGDPVASGKVYKVNGTIKEGIEA
FT                   DKAKKIAKFIRDEGPKGVQAQIQGDQLRVSGKKKDHLQEVISMLKNQDFGIALQFTNYR
FT                   "
FT   gene            342758..342839
FT                   /locus_tag="Svir_03440"
FT   tRNA            342758..342839
FT                   /locus_tag="Svir_03440"
FT                   /product="tRNA-Tyr"
FT   gene            complement(343001..344482)
FT                   /locus_tag="Svir_03450"
FT   CDS_pept        complement(343001..344482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03450"
FT                   /product="amidase, Asp-tRNAAsn/Glu-tRNAGln amidotransferase
FT                   A subunit"
FT                   /note="PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95425"
FT                   /db_xref="GOA:C7MTF5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF5"
FT                   /protein_id="ACU95425.1"
FT                   /translation="MDYSEYRRFDAVGLAELVAKREVSPAELLETAIARAEQVNGRLNA
FT                   IVHRMYDIARKRAATELSGPFAGVPFLLKDLKQDYEGVRTGAGSRALRDHVATRHSAVV
FT                   QRWLDAGLVVFGRTATPEFGTKGITESAATGATRNPWNLNHTPGGSSGGSAAAVAAGIV
FT                   PVAGASDGGGSIRIPAACCGLFGLKPSRGLVPSGPEHGEYLHGAATDGVVSRTVRDTAA
FT                   MLDVLVRRPDPGGPYLPAVPETSYAESARRAPGTLRIGFTTDSPLGTPVHDEAVAAVQH
FT                   AATLLDKLGHEVEPAKPEVDGVQLARDFMTMWCAETAATIAEIKRTTGASDEDFELDNR
FT                   LLAAAARAVRAPEYVTARNRWNTHTRALAAFHERYDLLLTPTIARPPVRIGELDTPPLL
FT                   RHAGEALLKLRLTGLLVKTKAWNDQILANLAPVPFTQLANLTGRPAMSVPLYRTVGGLP
FT                   LGVQFVGGLGSEPTLLALASQLEAEQPWADAEPVL"
FT   gene            complement(344554..345030)
FT                   /locus_tag="Svir_03460"
FT   CDS_pept        complement(344554..345030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03460"
FT                   /product="protein of unknown function (DUF309)"
FT                   /note="PFAM: Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95426"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF6"
FT                   /protein_id="ACU95426.1"
FT                   /translation="MAKRDRDDAGRPRNARPRDGLGRPLPYGAEGVPRQPEGVTRTPQE
FT                   TLQEAQQLLDEGKPFHAHEVFEDAWKSGPDAERRLWRGLAQLAVGVTHAARGNRTGAAA
FT                   LLRRGADNIAPYADQRPYGIDIPALCDWASTLADSVSGHKTPPDPAAIAPRVLP"
FT   gene            complement(345053..346819)
FT                   /locus_tag="Svir_03470"
FT   CDS_pept        complement(345053..346819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03470"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: Cytochrome C and Quinol oxidase polypeptide I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95427"
FT                   /db_xref="GOA:C7MTF7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF7"
FT                   /protein_id="ACU95427.1"
FT                   /translation="MDTQLDVRPTRIQDPAPTPGKRGQGLLNLFRTTDHKMIGKMYMVT
FT                   SIGFFIVGGLMALLIRAELGQPGIHFLSAEQYNQMFTLHGTLMLLLYATPVLFGFANLV
FT                   LPIQIGAPDVAFPRLNAFSYWLFLLGGLTVVASLLTPGGGADFGWTAYPPLANPEFSPG
FT                   IGGNLWVMGLIVSGLGTILGAVNMITSIVCMRGPGMTMWRMSIFTWNILFTSILVLIAF
FT                   PILTAALVGLAADRLVGAHVFDPSNGGAILYQHMFWFFGHPEVYIVALPFFGIITEIIP
FT                   VFSRKPVFGYRLMVFATMAIMGLSAIVWAHHMFATGAVLLPFFSMATFLIAVPTGIKFF
FT                   NWIGTMWKGQLTFESPMLWSFGFLVTFLLGGLTGIILAAPPLDFQVHDSYFVVAHFHYV
FT                   LFGTIVFATFAGIYFWFPKFTGRMLDEPLAKLHFWLTFVGFHVTFLVQHWLGNEGMPRR
FT                   YADYLESDGFTTLNVVSTIGAFILGLSMLPFLWNVVRSYRFGDPVTVDDPWGYGNSLEW
FT                   ATSTPPPRHNFTELPKIRSERPAFELHYPHMIERMYSEGHITFTGKTKPLDQVTVQPPE
FT                   VQASDATKGESG"
FT   gene            complement(346988..347239)
FT                   /locus_tag="Svir_03480"
FT   CDS_pept        complement(346988..347239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95428"
FT                   /db_xref="InterPro:IPR020311"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF8"
FT                   /protein_id="ACU95428.1"
FT                   /translation="MAGNDIDDTLTRIEQLIAEERELRAQATGTGLSDDEQKRLKNLQQ
FT                   RLDQYWDLLRRRRASAEFGGNPDQVEPRPVSEVESYRQ"
FT   gene            347619..348269
FT                   /locus_tag="Svir_03490"
FT   CDS_pept        347619..348269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03490"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95429"
FT                   /db_xref="GOA:C7MTF9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTF9"
FT                   /protein_id="ACU95429.1"
FT                   /translation="MNSLVAQSDTESLDGLAGWTVDLMDTLGGPGAAVAVGLDNLFPPI
FT                   PSELILPLAGFTAAQGRFSLVEALLWTTAGSVIGAIIVYLVGYIFGRERTRKFITMLPL
FT                   VKESDFDHAERWFAKHGTKAVFFGRMVPLVRSFISVPAGIERMSFWVFLALTTFGSLLW
FT                   NTIFVVSGYFLGANWHVVDEYAGIFQYVVIAAIAILLVVFVVKRLRERRNADV"
FT   gene            349461..352142
FT                   /locus_tag="Svir_03500"
FT   CDS_pept        349461..352142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03500"
FT                   /product="diguanylate cyclase (GGDEF) domain-containing
FT                   protein"
FT                   /note="PFAM: GAF domain; EAL domain; GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95430"
FT                   /db_xref="GOA:C7MTG0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG0"
FT                   /protein_id="ACU95430.1"
FT                   /translation="MPDTHGGSADAGTATGDIPRPDTSRPVAAPSEGGSLSAEARADER
FT                   RFQLYTVAVLTFGLVVAGAVSAWLPFQGSVHLWWIGPLLALAFLGAEQLGVNVDVRSGI
FT                   SWTISFTEIPLVIGLLVAPFEVVLAAHVVAGVTTLLARRVTGRVLYNAGAFLLEVTSAF
FT                   AVAGLVKQALGSVEDMPWLAALAGTLTAPLASTLLAMAAVRVLRRRMRVGTVVRLAGRI
FT                   LVVGFVNASVGLTGYLVISKTPEAWPIVLAVSLGLAALYWAYSDLLREQRDMEALTDVS
FT                   LMVARSGQQAAARPAGKAGDVDVDVDIDVDEWTTIAERIRDQLAAARVVLRLRLDPEQP
FT                   MRTVVVGDDLAAGYDTELDADDPLLRLPGAHVRHLRVTEANPQIRAALLRRGASEALVV
FT                   PLRSANQLLGIVEAYDRLSRWRGFGKYDVQLLGTMASHLATALDNRRLLATLRHDAYHD
FT                   PLTGLLNRPGFRQVAAEPLREHANSVVLRVDLDVFSTVSDALGYTWADRMLMAAGKRMR
FT                   DTLGAGVPLARLEGASFAVLLADCDAERAQEIAQRLREQLSAPYPVDRLTVEANSVVGY
FT                   VLTTAEENAERVDVDSLLQRADMAVRATRGGEEIKSYVPSMGQIFLRRFQMVTQFRQAI
FT                   EEGQVTVHYQPKVTLPDKQVLGVEALVRWQHPEFGRVNPDEFVPAVEAAGLVGVLTSFV
FT                   LDAALDRVRRWLDDGLRISVAVNLSVRNLADAEFPARVAEALERFGVPGELLTLELTES
FT                   DVMQDPERALPILRELSDLGIELAVDDFGTGYSSLAYLRQLPVDQVKIDKSFVFGMGTD
FT                   LGDLAVVRSIVELGHSLGLTVVAEGVEEDLARDQLEAMGCDVAQGYLISRPLSEDRLEA
FT                   WLQARTARSLDPASEPVLTLLT"
FT   gene            352218..352290
FT                   /locus_tag="Svir_03510"
FT   tRNA            352218..352290
FT                   /locus_tag="Svir_03510"
FT                   /product="tRNA-Thr"
FT   gene            352306..352378
FT                   /locus_tag="Svir_03520"
FT   tRNA            352306..352378
FT                   /locus_tag="Svir_03520"
FT                   /product="tRNA-Met"
FT   gene            352410..352574
FT                   /locus_tag="Svir_03530"
FT   CDS_pept        352410..352574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03530"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: Ribosomal protein L33; TIGRFAM: ribosomal
FT                   protein L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95431"
FT                   /db_xref="GOA:C7MTG1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG1"
FT                   /protein_id="ACU95431.1"
FT                   /translation="MAATDVRPKITLACEVCKHRNYITTKNRRNDPDRLEMKKFCPNCG
FT                   THRAHKETR"
FT   gene            352753..353853
FT                   /locus_tag="Svir_03540"
FT   CDS_pept        352753..353853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03540"
FT                   /product="Trypsin"
FT                   /note="PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95432"
FT                   /db_xref="GOA:C7MTG2"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG2"
FT                   /protein_id="ACU95432.1"
FT                   /translation="MKKLMKSTVAAGACALVFGVVVPSTASAVTEPRIEGYSANVQNEA
FT                   VSALIAERGVTQAEAETILRTQQHSVQALDTVLAQLGERAVDGYLDASGQPVVNVVSEA
FT                   AAAVVERAGVTAKVVEHTAAELEAARAALESLPSVADTAIGTDPTTNQVVLTIGAEADD
FT                   AEVAELLAEAERFGDRVRVDRVAGGFDVAIYGGEAITGGGSRCSAGFNVNSGGQNYIVD
FT                   AGHCTGAVSQWNVGPSVGASFPGDDYGLIRNDTGSAPGAVSLYDGTVQQINSASNAYVG
FT                   QSICKSGSTTGLTCGTVQAINVTVNYPQGAVHELVQTSASVNSGDSGGALFAGSVGLGI
FT                   TSGMGGGSSYFQPLTEALSAYGVSLN"
FT   gene            353951..354394
FT                   /locus_tag="Svir_03550"
FT   CDS_pept        353951..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03550"
FT                   /product="acyl dehydratase"
FT                   /note="PFAM: MaoC like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95433"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG3"
FT                   /protein_id="ACU95433.1"
FT                   /translation="MPLDASFVGRTYPPTTTYEVSRAKIAEFADAIGDDNPLYRDPEAA
FT                   RAAGYPDVIAPPTFLTIVNLTTINAIVADPELGLDYSRMVHGDQRFTHHRPVHAGDELR
FT                   LTTRIVDIFARAGNDFLTVEAHIETTAGEPVCTTRAQLVVRGE"
FT   gene            354397..354798
FT                   /locus_tag="Svir_03560"
FT   CDS_pept        354397..354798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03560"
FT                   /product="acyl dehydratase"
FT                   /note="PFAM: MaoC like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95434"
FT                   /db_xref="GOA:C7MTG4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG4"
FT                   /protein_id="ACU95434.1"
FT                   /translation="MNVGDQLPPLSVRITRAQLVRYAGASLDFNPIHWNERFATEVGLP
FT                   GVIAHGMLTMALGGRLVTDWLGDPGRLIDYSARFTRPVVVPDDDTGALVEFTGKVGELR
FT                   DDGTARIDITAKFEGKSVLGKAQAVVRLP"
FT   gene            complement(354839..355714)
FT                   /locus_tag="Svir_03570"
FT   CDS_pept        complement(354839..355714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03570"
FT                   /product="GDSL-like Lipase/Acylhydrolase"
FT                   /note="PFAM: GDSL-like Lipase/Acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95435"
FT                   /db_xref="GOA:C7MTG5"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG5"
FT                   /protein_id="ACU95435.1"
FT                   /translation="MNRRAWLAVTALLALTAACGPAEGPGVDDTVPGDDAVHYVALGDS
FT                   YTAAPGTGEPVGTPRGCGRSDNNYPRLLADRLAPESFTDVSCGGATTEHLTAPQRTPDG
FT                   TNPPQLDAVTPKTTLVTVGIGGNDVGFVELANRCASAAEESLRCSDAVAGGDGTLNAKV
FT                   EAVATKVSGVLDAIEAKAPDARVVVVGYPTILPEDPTVCDELLIDPADLSSLREGLELL
FT                   NHVLQQQASAHGAEFADTATGTEEHHVCAAEDSRWIEALESTTGAAPLHPTARGEQAMA
FT                   DAVLAVLRGR"
FT   gene            complement(355740..356723)
FT                   /locus_tag="Svir_03580"
FT   CDS_pept        complement(355740..356723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95436"
FT                   /db_xref="GOA:C7MTG6"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG6"
FT                   /protein_id="ACU95436.1"
FT                   /translation="MRKNKLRILLATLGVPAVVFTVALLLRDAWAARLPTEVASHWGTG
FT                   GVDDGIALDTLATWTLSAGAVLAVASTVLLLMLLRRGYGTHRPYVLVSTLLTMLPMAAL
FT                   ISSMAVTLDAASWREAGGAGAALAVLAAVLVPATTVAVLIAPSVPPTTGVPDTPGDATV
FT                   GLAAGQRATWNGAATNVALASGCVLAPLLALFLVDLLTENSLSWSGYAVPIAVGVLAML
FT                   GVSRVRVIVDSTGVTIRMGVLGFPTKHIPLSDIASAAATTTTLFRGGGLGIRTTPTGDT
FT                   LFKVRGGPTLELVLTSGRRVLANVDHPDQAAGLVNDLLREALRQHD"
FT   gene            complement(356720..357070)
FT                   /locus_tag="Svir_03590"
FT   CDS_pept        complement(356720..357070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03590"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95437"
FT                   /db_xref="GOA:C7MTG7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG7"
FT                   /protein_id="ACU95437.1"
FT                   /translation="MLVRIDPSSTVPLYEQVAASIRGELAHQRLGPGDHLPAARELAES
FT                   LRINVHTVLRAYAKLRDEGLIELRRRRGAVVTGHASDHARLAALVDDLIAEARRVGVGP
FT                   DELVTIVRGKYQ"
FT   gene            complement(357171..358406)
FT                   /locus_tag="Svir_03600"
FT   CDS_pept        complement(357171..358406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03600"
FT                   /product="L-aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95438"
FT                   /db_xref="GOA:C7MTG8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG8"
FT                   /protein_id="ACU95438.1"
FT                   /translation="MATSDSTATGPRRRVSARIAGITPSATLAVDAKARALKAEGRPVI
FT                   GFGAGQPDFPTPEHVVEAAAAAVRDRSNHGYTAAAGLPELREAIAAKTLRDSGFSCDAS
FT                   QVLVTNGGKQAVYSAFATLLDPGDEVLLLAPYWTTYPESITLAGGVPVQVTADESTGYR
FT                   VTVEQLEAARTDRTKVLLFNSPSNPTGAVYSRDQVEAIGKWAAEHGIWVVTDEIYEHLV
FT                   YDGVKAESLPVVVPEIADRTLILNGVAKTYSMTGWRVGWMIGPRDVIKAAASYQSHLCG
FT                   NVANVSQRAALAAVSGPMDVVEEMRAAFDVRRKKIVSMLSEIPNVECPTPEGAFYAYPS
FT                   VKAVLGKKIRGQRPTDTLELADLILREAEVAVVPGEAFGTPGYFRFSYALAEEDLVEGV
FT                   TRVANLLSEAKD"
FT   gene            358766..358838
FT                   /locus_tag="Svir_03610"
FT   tRNA            358766..358838
FT                   /locus_tag="Svir_03610"
FT                   /product="tRNA-Trp"
FT   gene            358874..359329
FT                   /locus_tag="Svir_03620"
FT   CDS_pept        358874..359329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03620"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="PFAM: SecE/Sec61-gamma subunits of protein
FT                   translocation complex; TIGRFAM: preprotein translocase,
FT                   SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95439"
FT                   /db_xref="GOA:C7MTG9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTG9"
FT                   /protein_id="ACU95439.1"
FT                   /translation="MSEDGEKDKEGVAKRPSRPDTAAARRARRASADRAGTPAKADSGA
FT                   RTRKGGESAKRPAPKGKASEKTAKPEGKGGPTPKRNRKDAKKGSLFSRIGRFIREVWGE
FT                   LRKVIWPTRKQMVTYTTVVLLFLVFMVALVAGLDFVFLEGVDVVFGE"
FT   gene            359411..360214
FT                   /locus_tag="Svir_03630"
FT   CDS_pept        359411..360214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03630"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="PFAM: Transcription termination factor nusG; KOW
FT                   motif; TIGRFAM: transcription termination/antitermination
FT                   factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95440"
FT                   /db_xref="GOA:C7MTH0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH0"
FT                   /protein_id="ACU95440.1"
FT                   /translation="MTSENGSGAGQDMTGLSEEQALAATGDADSDVAEAAAAPEQAAEA
FT                   AESPEADSAAADEQADEDEDPVAKLRAELESLPGDWYVVHSYAGYENRVKSNIETRRQT
FT                   LDVEDYIFQVEVPTEEVTEIKNGQRKIVQRKVLPGYILVRMEMNDASWSAVRNTPGVTG
FT                   FVGATSRPSPLSLDEVVKFLAPKVEKAAPAKAKGEPAAEEQVAAGPVEVDFEVGESVTV
FT                   MDGPFATLPATISEVNVDAQKLKVLVSIFGRETPVELSFNQVSKI"
FT   gene            360296..360727
FT                   /locus_tag="Svir_03640"
FT   CDS_pept        360296..360727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03640"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: Ribosomal protein L11, RNA binding domain;
FT                   Ribosomal protein L11, N-terminal domain; TIGRFAM: 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95441"
FT                   /db_xref="GOA:C7MTH1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH1"
FT                   /protein_id="ACU95441.1"
FT                   /translation="MPPKKKKLAAIIKLQIQAGAANPAPPVGPALGQHGVNIMEFCKAY
FT                   NAATESQRGNVVPVEISVYEDRSFDFKLKTPPAAKLLLKAAGVEKGSGEPHKNKVGKVS
FT                   WDQIREIAETKKADLNAVDLDQATKIIAGTARSMGITIE"
FT   gene            360828..361547
FT                   /locus_tag="Svir_03650"
FT   CDS_pept        360828..361547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03650"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: Ribosomal protein L1p/L10e family; TIGRFAM:
FT                   ribosomal protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95442"
FT                   /db_xref="GOA:C7MTH2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH2"
FT                   /protein_id="ACU95442.1"
FT                   /translation="MAKRSKAYRQAAELIDRERLYTPLEAARLAKETSKVKMDATVEVA
FT                   MRLGVDPRKADQMVRGTVNLPHGTGKTVRVIVFATGEKAAEAEAAGADAVGSDELIERI
FT                   QGGWLEFDAAIATPDQMAKVGRVARILGPRGLMPNPKSGTVTQDIGKAVSDIKGGKISF
FT                   RIDKQANLHLVIGKVSFDAEKLVENYAAALDEVLRAKPAASKGRYLKKVTFSTTMGPGI
FT                   PVDPSRTRDLLAEEVNA"
FT   gene            complement(361656..362582)
FT                   /locus_tag="Svir_03660"
FT   CDS_pept        complement(361656..362582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95443"
FT                   /db_xref="GOA:C7MTH3"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH3"
FT                   /protein_id="ACU95443.1"
FT                   /translation="MGDVVEQRPDGDPGQHRDSGAAGEPEIVPDVVPADPNRPGAELTP
FT                   AGPTPPATTQPDPEQLRQFREFQQFQQFQQFLRFQEAQGQLGQQGQGQPGQLSTTADTA
FT                   LVPRRQPQAEPITRKVPGWLQWLGKKILGWLVFFLLLAIFATWAFNELFGSNDDNSTEA
FT                   AARMGGGTYHTEELLAKEPYEAVRKVYHHIAQGRVDFACGRFDNDNGIQQRFAENTGDH
FT                   PDCRHAVIALHEQVTHVNDYAESIFPRWYDPDATTVRIDSCDFDIQGGPALGVFTVTKV
FT                   EMGQWLITDHEPGPSVCEANPTGPTGN"
FT   gene            362928..363473
FT                   /locus_tag="Svir_03670"
FT   CDS_pept        362928..363473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03670"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95444"
FT                   /db_xref="GOA:C7MTH4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH4"
FT                   /protein_id="ACU95444.1"
FT                   /translation="MAKPDKVAAVAEIADKFRNSSAAVVTQYSGLSVSQLNELRRALGN
FT                   TAKYRVAKNTLVKRAAAEAGVEGIDELFVGPTAIAFVEGEPVEAAKVLRDFAKDNSALV
FT                   IKGGYMDGAPLSVSEIEKIADLESREVLLAKAAGAMKAKLSQAAALFQAPASKVARLSA
FT                   ALEEKRKSEGGAEPAAES"
FT   gene            363522..363917
FT                   /locus_tag="Svir_03680"
FT   CDS_pept        363522..363917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03680"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="PFAM: Ribosomal protein L7/L12 C-terminal domain;
FT                   TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95445"
FT                   /db_xref="GOA:C7MTH5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH5"
FT                   /protein_id="ACU95445.1"
FT                   /translation="MAKLSTEELLDAFKEMTLLELSEFVKQFEETFDVTAAAPAAVMAA
FT                   PGAAAGGAAAPAEEEKDEFDVILESAGDKKIQVIKVVREVVSGLGLKEAKELVESAPKP
FT                   ILEKADKEAANAAKEKLEAAGAQVSLK"
FT   gene            364126..365262
FT                   /locus_tag="Svir_03690"
FT   CDS_pept        364126..365262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03690"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95446"
FT                   /db_xref="GOA:C7MTH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH6"
FT                   /protein_id="ACU95446.1"
FT                   /translation="MGAEVVIEGLSKSFGKHTIWRDVTLTLPPGEISVMLGPSGTGKSV
FT                   FLKSMIGLLKPDRGKCVINGVDIVRCSERKLYEIRKLFGVLFQDGALFGSMNLYDNVAF
FT                   PLREHTKKSETEIRRIVLEKLDMTGLSGAEKKLPGEISGGMRKRAGLARALVLDPEIIL
FT                   VDEPDSGLDPVRTTYISQLFIDVNAQIDATFLIVTHNINLARTVPDNLGMLYRKELVMF
FT                   GPREVLLTSEEPAVKQFLNGRMDGPIGMSEEKDSATLAAERAMFEAGHHAGGVEDVVGV
FT                   PPQMQPTPGLPERQGVRRRKDRVMRILHTLPEAARESIIASLSPEERRHYGVHSAGLVG
FT                   AQHGVLPAGDVATIPEASRTQPIEFGTDDVTRGHTPYE"
FT   gene            365313..366065
FT                   /locus_tag="Svir_03700"
FT   CDS_pept        365313..366065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03700"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, permease component"
FT                   /note="PFAM: Domain of unknown function DUF140; TIGRFAM:
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95447"
FT                   /db_xref="GOA:C7MTH7"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH7"
FT                   /protein_id="ACU95447.1"
FT                   /translation="MLRETGKLFALALDVARGVFRRPFQFREFIQQAWFIASVTILPTA
FT                   LVAIPFGAVISMQFGSLAKQLGAQSYTGAGSVLATVQQASPLVVALLVAGAGGSAICAD
FT                   IGARTIREEIDAMEVLGVSAVQRLVVPRVLACMFVALLLNGMVSVIGVLGGYFFNVVLQ
FT                   DGTPGAYLASFSALAQLSDLWIGEIKALIFGFIAAVVAAYRGLNPPPGPKGVGDAVNQS
FT                   VVITFLLLFVVNTVLTLIYLQLVPSKLD"
FT   gene            366070..366909
FT                   /locus_tag="Svir_03710"
FT   CDS_pept        366070..366909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03710"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, permease component"
FT                   /note="PFAM: Domain of unknown function DUF140; TIGRFAM:
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95448"
FT                   /db_xref="GOA:C7MTH8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH8"
FT                   /protein_id="ACU95448.1"
FT                   /translation="MARLMQNVKNLANRPLRTLDMLGDQMSFYLRALAWTPRAIRRYSK
FT                   EVLRLLAEVSFGSGSLAVIGGTVGVMVGLTLFTGVLVGLQGFSALDSIGTSAFTGFLTS
FT                   FFNTREIAPLVAGLALSATVGSGFTAQLGAMRISEEVDALEVMGVPSLPYLVTTRIIAG
FT                   FIAIIPLYIIGLLSSYLASRTVVVYLYGQSAGTYDHYFDMFLPPEDVFYSFVKVLIFSV
FT                   LIILTHCYYGYRATGGPAGVGVAVGKAVRLSIVTVAVVNFFIGFAIWGTDTTVRIAG"
FT   gene            366918..368234
FT                   /locus_tag="Svir_03720"
FT   CDS_pept        366918..368234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03720"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95449"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTH9"
FT                   /protein_id="ACU95449.1"
FT                   /translation="MATIRRRLLGLLLVAILVGGIALSIAVYNRAFTDHVTVRVQAGEI
FT                   GNQLAPNSDVKVRGLIVGRVHAVEPSPTGGAELVLHLDPGQASLVPANVSARFLPKTLF
FT                   GERYVDLTIPERPSTTGLADGTVIPQDRTEDAVRLEQALDNLLPVLQAVQPEKLSSTLT
FT                   AISNALEGKGEQLGETLSELGEYLGELNPHVPKLQENLRELAAFSGTLSDVAPDLVRTL
FT                   DNLTTTSRTIVEQSLNLDTLYRTVATASTDLDTFLEANAANLISLGETARPTAELLAKY
FT                   APSYPCFLGQMAELVPRIDESFGKGTNKPGLHITLEITVDRGPYKPGQDEPEYNDKRGP
FT                   RCYDMEEMPDPFPQHPPDGPVQDGTVHPESADSAGRGLNNSAAAGGAAPMGNPANTGGE
FT                   HALVAQLTGPRVGMDPSEVPAWGSLLVAPLYRGAEVTVE"
FT   gene            368305..369336
FT                   /locus_tag="Svir_03730"
FT   CDS_pept        368305..369336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03730"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95450"
FT                   /db_xref="GOA:C7MTI0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI0"
FT                   /protein_id="ACU95450.1"
FT                   /translation="MRGLLAPLTKLTVFVVVTVVFTTILGLSIANVNLGGTHTYTARFT
FT                   DATSVLPGDDVRIAGVMVGKVSDVRIVDRRIAEVEFELDRNRTLPDNTVAAIKFRNLIG
FT                   QRYLSLERGEGEPQGVLEPGDTIPLERTRPAVDLTELFNGFKPLFQALSPEDVNTLSYQ
FT                   IIQVLQGEGGTVESLLAHTASLTTTLAEKDQVIGEVIDNLNSVLHTLNERTPQLSQLIS
FT                   RLQRFVSGLASDREPIGEAISSIGDLADTTAGLLEEARGPLREDIEALGDLAGNLNDHE
FT                   AVVEEFIQYLPEKTNRLASAADYGSWLNFFLCEAKGNISITGLGDAPLSLPLLPANRER
FT                   CLS"
FT   gene            369333..370319
FT                   /locus_tag="Svir_03740"
FT   CDS_pept        369333..370319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03740"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95451"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI1"
FT                   /protein_id="ACU95451.1"
FT                   /translation="MTSFSNRNPIPIAIVGITLLFLGTLAALNSDDLPLIGGGTTYRAE
FT                   FSEAAGLETDDEVRIAGVKVGEVTDIDLDGAKVLVSFKVSDAWIGDETTAAIKIKTLLG
FT                   RKYLALDPSGDEPLDPNTTIPLERTTAPYDVLEAFRGLSRTVDDIDVNQLARSFDVLSR
FT                   TFANTPEDVRGALEGLSELSDTIASRDQQLSELLEGTRRISQTLADRDAELAVLLEDGN
FT                   ELLEELSAREEAISAMLTGTRKLSEQLRGLVDDNEEQLQPVLEKLDQLTDMLQRNQESL
FT                   AEGIENFAPFVRVFNNTIGSGRWFDSYICGLLLPSIGPLNEEGCNAR"
FT   gene            370316..371500
FT                   /locus_tag="Svir_03750"
FT   CDS_pept        370316..371500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03750"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95452"
FT                   /db_xref="GOA:C7MTI2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI2"
FT                   /protein_id="ACU95452.1"
FT                   /translation="MTDTRFGQRLARGLAMACVLGLVIATGLWWTLKDTNRKHVTAYFT
FT                   QAIGLYAGNSVRILGVEVGEVTSVRPEGDRVRVEMTYDRRFTVPADAKALIVAPALVSD
FT                   RYVQLAPAYTGGDQLDDGAVIPLSRTSVPLEIDELSESLSRVSEALGPDGANADGALSD
FT                   LLDTAAENLDGNGRALHEAITRLGDAAGTLSGSSDDLFGTVENLAKLSNTLAASDDDMR
FT                   EFEERLADVSDFLERERHNLAATVTELGTTLQLVDDFINDNRERVKSNVDKLAEITQVL
FT                   VDQRAALAETLDIAPLALGNLVNTYNAASGTLDTRPNMNELTEPPLLMVCNLLKQTPRA
FT                   LDALGKLCADAAGVLDGVVQLPSLAQTVNALNKGKLPPLPLPVLGQITGSGGER"
FT   gene            371497..372693
FT                   /locus_tag="Svir_03760"
FT   CDS_pept        371497..372693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03760"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95453"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI3"
FT                   /protein_id="ACU95453.1"
FT                   /translation="MRRFRTTLAAAGAVILVAAGGCSDFEGVYDIPLPGGADLGDNPYT
FT                   VRVHFPDVLDLVPQAGVRVKEVPVGTVQDVRLAEDGWTAEVVLAINGDVELPANAIANL
FT                   RQSSLLGEKYVELAAPSESEGFPGEKLSDGDLIPVERTNRSVEVEEVLGALSMLLNGGG
FT                   VEQLNTITKELNAALEGNAPDVKALLRNAEELVEALDEQSSDITTALDQLNRLSSTLNA
FT                   QRDKIAVAVEDLGPGLEVLERQRDQLVAMLGALEGLSDVAVETVNAGQEDLVANLEALL
FT                   PTLRKLSEAGADLPNALELLLTYPFTDAAAEGVKGDYMNLYIDLDLDLQEILANLGRSR
FT                   QNPLQNLPIVGDLTNPRETDPDDTSSVLPLPGDTGGGAAPGGQGGLDGILDSMVGGGR"
FT   gene            372693..373955
FT                   /locus_tag="Svir_03770"
FT   CDS_pept        372693..373955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03770"
FT                   /product="virulence factor Mce family protein"
FT                   /note="PFAM: mce related protein; TIGRFAM: virulence factor
FT                   Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95454"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI4"
FT                   /protein_id="ACU95454.1"
FT                   /translation="MLVRKTKIQLVAFLVVSVLAVAYALVRFTDVEKTFGAGGYTVHLH
FT                   LTSSGGIFTGAEVTYRGYNIGEVGRLSLTEDGLAAELLIEPDTPRVPRELDVTIANRSA
FT                   VGEQYVDLRPVTDEGPYLADGDVIGPERVSTPVPAEDLITDLDSLASSVPTESLRTIVD
FT                   ESYEAFHGTGEHLQRLMDTTSEFTRVAKEYLPQTVELLDKGSTVLRTQNDLSTYMRSFS
FT                   EDLAALSQTLKDSDGDIRNLIDVAPDAATTVSGVLAESGPGLSNVVANLLTTSNVLITR
FT                   LDGVEQALVSYPLVAAGAYSVTPGDGTAHLGLVLNLFDPPACTKGYRPPETYRPGNDTT
FT                   PREPYKDAYCAEPPGSPIAVRGSQNAPYNGVPSLPTPAQVEANRNRDSEQLEYLRRIAS
FT                   DLAKEDGRSISSLRELVGLPD"
FT   gene            374019..374825
FT                   /locus_tag="Svir_03780"
FT   CDS_pept        374019..374825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95455"
FT                   /db_xref="GOA:C7MTI5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI5"
FT                   /protein_id="ACU95455.1"
FT                   /translation="MSSEDQRPEPDDAEDRPATEPDIDTADESSAEGRWADGSGADGPD
FT                   APDDSDASENGENEGSEEDAETAKNPKGDKTGSSKDTEGERRPTRSGPPRPLLFTVAAL
FT                   ASAALVVAIVFGVMWRNAAGSDELKIAEARDEVTATANRAAAVFLEFDHTRSDELLAER
FT                   KKLSTDEMSEEIDETEQEWRDSIEEAQLKTVATVQDVAVEELNVHEGKARALAVVQIEV
FT                   TNKQGSFTNVERLQLELEREQQGDESDGDRQWKVSALANVQYGASG"
FT   gene            374969..376072
FT                   /locus_tag="Svir_03790"
FT   CDS_pept        374969..376072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95456"
FT                   /db_xref="GOA:C7MTI6"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI6"
FT                   /protein_id="ACU95456.1"
FT                   /translation="MPRSTVSDEAGRGVGGTEPAPKESRSARPEAGPGSPSESPKPSDP
FT                   TEERSAEEGGVTDSAEPPESPDPAESPKRSGEDTETAEDGKAAESAEDSPADGAEDVVA
FT                   PETAAKARSAPAKVGRPSPRPKRRDRGVSRPMKPEQVELADADEERSDAAEAGVAGGAA
FT                   EGGRERRAGYPVLAALVAATLVLSGLAVFFKLRHSEATELTSNAALVDVATTAEVKQAM
FT                   SDAAERLFSIDYNDMAKTERAAEQLLGSEEVKSTYDTLMGEYRGQAGEQKIVVTTTAVR
FT                   SAVVLLDGDRARVMVYVDQTATRAGDEQTVGGPAAMWFETERKDGEWKVMNMDVYGAGQ
FT                   SSGARSELSPNGPKPSSSQAEESTEGN"
FT   gene            376383..379895
FT                   /locus_tag="Svir_03800"
FT   CDS_pept        376383..379895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03800"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 7; RNA polymerase
FT                   Rpb2, domain 6; RNA polymerase Rpb2, domain 3; RNA
FT                   polymerase beta subunit external 1 domain; RNA polymerase
FT                   Rpb2, domain 2; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95457"
FT                   /db_xref="GOA:C7MTI7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI7"
FT                   /protein_id="ACU95457.1"
FT                   /translation="MSPEGRILAVSPANQASAATNSNRPSTGIPGAPKRVSFGEIREPL
FT                   GIPNLLDVQIQSFEWFTGSEAWYERAVNEGEENPVGGLEEVLNEISPIEDFSGSMSLSF
FT                   SDPRFDEVKASVEECKDKDMTYAAPLFVTAEFVNHNTGEIKSQTVFMGDFPVMTDKGTF
FT                   IINGTERVVVSQLVRSPGVYFDQSIDKSTDKDVFSVKIIPSRGAWLEFDVDKRDTVGVR
FT                   IDRKRRQPVTVLLKALGWTNEQIRERFSFSETLLATLEKDPTTTQDEALLDIHRKLRPG
FT                   EPPTKESAQALVENLFFKEKRYDLAKVGRYKVNKKLGLNIPYDVGTLTEEDIVATIEYL
FT                   VRLHAGEETMKVGDVEVPVEVDDIDHFGNRRVRTVGELIQNQIRVGLSRMERVVRERMT
FT                   TQDVEAITPQTLINIRPVVAAIREFFGTSQLSQFMDQNNPLSGLTHKRRLNALGPGGLS
FT                   RERAGMDVRDVHPSHYGRMCPIETPEGPNIGLIGSLASHARVNPFGFIETPYRKVVNGR
FT                   VTDEVHYLTADEEDRFVKAQANAPLTEDGYFAEEKVLGRRKGGEVELLDPMEIDYMDVS
FT                   PRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPLVGTGVELPAAVDAGDV
FT                   VVAEESGVVEELSADMITIMQDDGTRRSYGLYKFRRTNAGTCFNHRPIVNEGDRVERGQ
FT                   VIADGPSTDKGEMALGKNLLVAIMPWEGHNYEDAIVISQRLVQDDVLTSIHIEEYEIDA
FT                   RDTKLGAEEITRDIPNVSEDVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEE
FT                   RLLRAIFGEKAREVRDTSLKVPHGETGKVIGVRVFSREEDDELPPGVNELVRVYVAKKS
FT                   KIQDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDVVLNTHGVPRRMNIGQIMELHL
FT                   GWLASQGWKVEGNPEWAKNLTEELRDVEPGTNTATPVFDGAREEEITGLLGCTKPNRDG
FT                   QRLVGPDGKATLFDGRTGEPFPYPVAVGYMYILKLHHMVDEKIHARSTGPYSMITQQPL
FT                   GGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENMPSPG
FT                   IPESFKVLLKELQSLCLNVEVLSSDGASIEMRDSDDEDLERAAANLGINLSRNESPSVD
FT                   DVVQ"
FT   gene            380014..383925
FT                   /locus_tag="Svir_03810"
FT   CDS_pept        380014..383925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03810"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="PFAM: RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 3; RNA polymerase Rpb1, domain 4; RNA
FT                   polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain 2;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit,
FT                   predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95458"
FT                   /db_xref="GOA:C7MTI8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI8"
FT                   /protein_id="ACU95458.1"
FT                   /translation="MLDVNFFDELRIGLATADDIRQWSYGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVNTELRQNDLPTLENEINVERKNIE
FT                   NKRDAEIEQRAQKLEADLAELEAEGAKADVRRKVKESGEREMRQIRDRAQRELDRLEEV
FT                   WTTFTKLEPRQLIVDEQLYRELYDRYGEYFTGGMGAEAIQKLASEFDVDAEAEALRETI
FT                   RTGKGQKKLRALKRLKVVAAFQSTGNDPRGMVLDAIPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHQCGLPKDMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERARPQVWDVLEEVINGHPVLLNRAPTLHRLGIQAFEPQLV
FT                   EGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSANNILSPASGRPLAM
FT                   PRLDMVTGLFHLTRLDENAKGAGAAYSSPAEAIMAYDRGQLALHAPVKIRIHDRQPPKS
FT                   EEAALREKGWEPGKPWLAETTLGRVLFNDLLPEDYPFVNEVLPKKRQAAIVNDLAERYS
FT                   MTQVAQTLDGLKDAGFHWATRSGVTISITDVVVPPQKQELLEQYEAKAAQVEKRYQRGQ
FT                   LSHAERNNELVKVWSQATEDVAKAMEENLPDDNPIAMIVKSGAAGNMTQVRSLAGMRGL
FT                   VSNPKGEYIPRPIKANFREGLTVAEYFIATHGARKGLADTALRTADSGYLTRRLVDVSQ
FT                   DVIVRETDCGTSRGITRTIADELPDGRLVRAEHVETSVYARNLAADAVDEQGNVILNAG
FT                   EDLSDPAIERLIQAGISKVKVRSVLTCESAMGVCATCYGRSMATGKLVDVGEAVGIVAA
FT                   QSIGEPGTQLTMRTFHQGGVAGDDITTGLPRVTELFEARVPKGKAPIADVDGRVRIEES
FT                   ERFWKITLIPDDGSEEIVFDKLSKRQRLAIGPNGPLADGDHVKVGQPLLEGTPDPHEVL
FT                   RVMGPREAQMHLVEEVQKVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGELP
FT                   ERSKFEQVNRKAVAEGGEPASGRPVLMGITKASLTTDSWLSAASFQETTRVLTDAAING
FT                   RSDALIGLKENVIIGKLIPAGTGINRYRNIQVQPTEEARVAAYAIPSYDDGYYTPDVFG
FT                   TGTGAAVPLDDYDFGRDFR"
FT   gene            complement(384012..384812)
FT                   /locus_tag="Svir_03820"
FT   CDS_pept        complement(384012..384812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95459"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTI9"
FT                   /protein_id="ACU95459.1"
FT                   /translation="MELWLRLSPLLGCMAAGLGLLFWSQWRSARKEQREHVEALTALAA
FT                   RLGGTMVSDPEKATAWSAELLRPFKNYTGGFINWLATVRRPRFEIALDFVRGPWRLRVT
FT                   EVSMERRGSTGGVTHHEHRIEVITAPLPPVKLARRLYTDFLGRPLKPGHVLSEGTAVIS
FT                   EPPVTVARQQGEWQRLRLPGHYDSQYAVFANDLGAANRMLNRDVLEYLVENASVLPFVL
FT                   TFEDGFFYATMPYRIGPNTLPKTLEAVLGLLERVPGAAPTHAQR"
FT   gene            complement(384816..385940)
FT                   /locus_tag="Svir_03830"
FT   CDS_pept        complement(384816..385940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95460"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ0"
FT                   /protein_id="ACU95460.1"
FT                   /translation="MAEEKITAGGVTITTGEKTVGQKAQEAIPFYGNYLKTKEAADKLS
FT                   DGADGSEVSGLASEGTAFIGSLGTSALGIATDPIGWLIGQGLNFLISVVQPIEDAIHIV
FT                   SGDGPALSQAAENFNAIGEGVAKLSQQFEEELKTTIQTWGGPASEVAGTKLGEFANGID
FT                   GVAGQAGEIARLLQISSMIMTIVEDFVKAILTELITWLIMIWIPALAAAAPSFGASTAA
FT                   AGAATTARVASTGSRVSQIVAKLRTLLDKFLAFLRNLAGRLGNVRTAFQRSMVQKEVGS
FT                   LFADMSKNLDDKSPLTKLWSKDGMLGERLQKGFVSSMGTAMSDTAVSQLGLGKNTNAGV
FT                   DKPLRNISNYQKAGEYDDTGADQPLQETKDYLDI"
FT   gene            complement(385953..386273)
FT                   /locus_tag="Svir_03840"
FT   CDS_pept        complement(385953..386273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95461"
FT                   /db_xref="GOA:C7MTJ1"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ1"
FT                   /protein_id="ACU95461.1"
FT                   /translation="MSGFTVDSDELRRYGDKLAGHKDTAGQIASLLDQADVGDKSWGVV
FT                   GLIVKEQYTELLSDLRETFTMLQEGLQSGSDKFKAAADGYQQNEEAMKQLLDGLKIEID
FT                   RG"
FT   gene            complement(386586..387734)
FT                   /locus_tag="Svir_03850"
FT   CDS_pept        complement(386586..387734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95462"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ2"
FT                   /protein_id="ACU95462.1"
FT                   /translation="MTEVSDIAGSIELNADNEDSFLDKAKSLAEQVPGAKQAIKGYDTV
FT                   TNIWQGMPEDPDAADIMLHAGGVITDAASFTAECAMEAGMAVLDPVGWLVDNGISIVLH
FT                   LVTPLQDLLHMVSGDGPALSDASDDFAAIGNGLVEYAGEFVRVADETLADWEGAASDAA
FT                   RNALADFAKGIEGVATSAGGVAQILKMSSMIMTVVEEVIKAIITEFVTWLIWIWVPALA
FT                   SSVVSFGSSVAAAMSASVAKAASTFSRVTSKMGKLGKLLEKILEFFKKFGSKMVKLGEK
FT                   LGVEPKNYGDNVKEVVEQVGRSGAMKTAVTESLKKGGGAVFNSTIGIDPTSTVDTAGEA
FT                   GKTVLDHYGKLVDQTTDLKDIGDKGDIGSGTDVEETRDLLDM"
FT   gene            complement(387752..388102)
FT                   /locus_tag="Svir_03860"
FT   CDS_pept        complement(387752..388102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95463"
FT                   /db_xref="GOA:C7MTJ3"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ3"
FT                   /protein_id="ACU95463.1"
FT                   /translation="MPDGGFKVEVEALRRYRDTLEDFKSQADTFSDLVDRADVGDESWG
FT                   LVGLATKSSYTEALGQLRDLLDRMKQGLTNTGEKFTKAAELYASNDDQGAIQLGNYEIE
FT                   VDKVDEVRPAGA"
FT   gene            complement(388171..388926)
FT                   /locus_tag="Svir_03870"
FT   CDS_pept        complement(388171..388926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95464"
FT                   /db_xref="GOA:C7MTJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ4"
FT                   /protein_id="ACU95464.1"
FT                   /translation="MVYWQRQHHLKTPKAALMDNPGLLLFALLFILPVLLIPLIVGSRN
FT                   KKTNELRSRLHEFARQVGGIEYAKHQPARPSFGYFPHNPEIYPNAPFDYAVEFKHRGHD
FT                   VLAFELERHGHTVGVNSHAINYDAIIEIPIAPCPFLWIGNETNANYDLNLRKYIIPELT
FT                   VGRHHRRIVVVAHDEEFARSVVDLELLTWIAERIGDYFLRPIILEKGVIRTEVMKSSRL
FT                   DPDKIIPTVDAILELLDRLPPEIRATHSR"
FT   gene            complement(389062..389901)
FT                   /locus_tag="Svir_03880"
FT   CDS_pept        complement(389062..389901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95465"
FT                   /db_xref="GOA:C7MTJ5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ5"
FT                   /protein_id="ACU95465.1"
FT                   /translation="MPLSWFAVILFTLHILCMLWPRWSSQRRVSKRAEDFRRYAMMTRG
FT                   HVFQGQNQARSWTNGLHPPLVSFLRGNFFQRLRVFSNVRYEHAAEFFRYGRRVRISEAS
FT                   IFIRRPGNTLFQEWIEHRVEVQALKAPTMRVLLRTNTDWDESLHPVPLPEPYASQMSIR
FT                   SDAPGYVANALPAIEVLARRTKHLPYSFDVERGILHYSTSGPATEETVTLTVDALVAFL
FT                   DRLCGPAAGQHQFAAALATLPQREYPDPSRFARGMEFSSYVLWLVSLVFSVVSTITG"
FT   gene            complement(390016..391128)
FT                   /locus_tag="Svir_03890"
FT   CDS_pept        complement(390016..391128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ6"
FT                   /protein_id="ACU95466.1"
FT                   /translation="MSNPLESIELSSEQSYGEKVMQAIPHQGLFSEAKGLFEQTFNAAS
FT                   DGDLSHDEIFNLAVSGQDFISSCSGVASGIMQDPIGSMLTGGLEFLISICQPLQDLVHM
FT                   VSGDGPALENAATNFAAIGEGIEEFSSYFAQEAVEALVEWEGESAQAAAQRLAEFAKGI
FT                   KAVAGEAGNIAELLQISSIVMKVIEDFIMALLTELIMWLVMIWVPALASSVVTFGGSTA
FT                   AAASATGVRVAQTTTRASQQVSRLSKLLDKIKNILVRVKEWLAKQGKTFREAMDSTRTR
FT                   VDNATKRVKNAEDTGAKTSWSDRLNSDQGAIGSRVSTGFGKSMRDTAGQNIAEQMGNWE
FT                   DHLESYNTAQEYDSIGEEQPKYKTSDQLNF"
FT   gene            complement(391160..391501)
FT                   /locus_tag="Svir_03900"
FT   CDS_pept        complement(391160..391501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95467"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ7"
FT                   /protein_id="ACU95467.1"
FT                   /translation="MSKFFINPEVLEKYSQKLAEHKSSVNHVRDLVAQADVSDESWGIV
FT                   GLFVKQSYTEMLGDFKDLLKDMSDGLDSASDKMMSATRAYREIEEENRRILVEITRRIN
FT                   AAKIKNITS"
FT   gene            complement(391498..392427)
FT                   /locus_tag="Svir_03910"
FT   CDS_pept        complement(391498..392427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95468"
FT                   /db_xref="GOA:C7MTJ8"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ8"
FT                   /protein_id="ACU95468.1"
FT                   /translation="MTFGDILPAFIVVGYLAVVGLGTLGSKLRRNAGVPDPNDPDTVPT
FT                   QPLSLAAIAAAQARSGPTPETQHRIGTTCVALAWVLGIATTLTWGVAAVGWGGLLTILL
FT                   MLVIGPAVLIFLFTLLGRLRRQRAGGRVKAVWPWMLLGAFGVCALVGSAHLVFNGASHY
FT                   LGYAKEVDLYVTESGERIYRTNPRTGGVHPRSRHQKQDVVSGTYTEDGETHYIENARWF
FT                   ESPLPAEGETVRISIAPLWPNPVIAGNTDAMMLLIPGAVTGVLGGVLMWMAARERNGGN
FT                   GSGRAPVHAPNYPMNRNYPTKQNWGTYS"
FT   gene            complement(392515..393102)
FT                   /locus_tag="Svir_03920"
FT   CDS_pept        complement(392515..393102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95469"
FT                   /db_xref="GOA:C7MTJ9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTJ9"
FT                   /protein_id="ACU95469.1"
FT                   /translation="MSAEFERLLAQFERFQSKIKKVDDQLANVERMQSEIAELEATASN
FT                   ADRSITIVAGPGGAIKDIQLTDKALSQQPQALSAALMSTIQEAVAEAARKQAAIVDDHM
FT                   GGQLNVTDQVLETQAQLFGTSPQELRERMEQERPIRQTPLRPEEEYHEDYSHQDFLGSD
FT                   QEQQSPPPPPAPSGGSAGDEFLQNLFNNDDHR"
FT   gene            393509..393883
FT                   /locus_tag="Svir_03930"
FT   CDS_pept        393509..393883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03930"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="PFAM: Ribosomal protein S12; TIGRFAM: ribosomal
FT                   protein S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95470"
FT                   /db_xref="GOA:C7MTK0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK0"
FT                   /protein_id="ACU95470.1"
FT                   /translation="MPTIQQLVRKGRQDKAAKQKTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLSNGIEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDT
FT                   QGVKNRKQARSRYGAKKEKS"
FT   gene            393883..394353
FT                   /locus_tag="Svir_03940"
FT   CDS_pept        393883..394353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03940"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: Ribosomal protein S7p/S5e; TIGRFAM: ribosomal
FT                   protein S7, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95471"
FT                   /db_xref="GOA:C7MTK1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK1"
FT                   /protein_id="ACU95471.1"
FT                   /translation="MPRKGPAPKRPLTADPVYQSPLVTQLVNKVLKDGKRSLAERIVYG
FT                   ALEGAREKTGTDPVVTLKRALDNVRPTLEVKSRRVGGATYQVPIEVKPGRSTTLALRWI
FT                   VTYARQRREKTMIERLQNELLDASNGLGASVKRREDVHKMAESNKAFAHYRW"
FT   gene            394448..396544
FT                   /locus_tag="Svir_03950"
FT   CDS_pept        394448..396544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03950"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor Tu GTP binding domain; Elongation factor G, domain
FT                   IV; Elongation factor G C-terminus; TIGRFAM: small
FT                   GTP-binding protein domain; translation elongation factor
FT                   EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95472"
FT                   /db_xref="GOA:C7MTK2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK2"
FT                   /protein_id="ACU95472.1"
FT                   /translation="MARDVLTDLNKVRNIGIMAHIDAGKTTTTERILFYTGINYKLGET
FT                   HEGSATMDWMEEEQKRGITITSAATTTFWNDYQINIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGKEGVEPQSEQVWRQADKYEVPRICFVNKMDKLGADFYYTVGTIEERLGARPLV
FT                   VQLPIGAESDFQGVVDLVRMKALTWRGETKKGEDYEVEEIPADLADKAAEYREKLVEAA
FT                   AEADDELMEKYLGGEELTEDEIKSAIRKLTIAREAFPVLAGSAFKNKGVQPMLDAVLDY
FT                   LPSPLDVPPVEGTLPDGTPASRPSSVDEPFSALVSKVAVHPFFGKLTYIRVYSGKVASG
FT                   TQVINATKERKERIGKIFQMHSNKENPVDEAQAGHIYAVQGLKDTTTGDTLADLQNPII
FT                   LESMTFPEPVIKVAIEPKTKADQEKLSAAIQKLAEEDPTFRVSQDEETGQTIIEGMGEL
FT                   HLDVLVNRMKTDFKVEANIGKPQVSYRETIRKTVDKLEYTHKKQTGGSGQFARVVIRLE
FT                   PLETADGALYEFDNQITGGRIPKEYIPSVDEGAQDAMQYGVLAGYPLVGLKVTLLDGAY
FT                   HEVDSSEMAFKIAGSMALKEAARKANPTLLEPMMAVEVTTPEEYMGDVIGDLNSRRGQI
FT                   QAMEERSGTRVVKALVPLSEMFGYVGDLRSKTQGRANYTMVFDSYAEVPSNVAKEIIAK
FT                   ATGE"
FT   gene            396822..398015
FT                   /locus_tag="Svir_03960"
FT   CDS_pept        396822..398015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03960"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor Tu GTP binding domain; Elongation factor Tu
FT                   C-terminal domain; TIGRFAM: small GTP-binding protein
FT                   domain; translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95473"
FT                   /db_xref="GOA:C7MTK3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK3"
FT                   /protein_id="ACU95473.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITKVLHDRYPELNQ
FT                   SRAFDTIDNAPEERQRGITINISHVEYQTEKRHYAHVDAPGHADYVKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYIVVALNKADMVDDEEILELVEMEVRELLNSQ
FT                   EFPGDDAPVIRVSGLKALEGDEKWADSIMELMNAVDENVPDPVREIDKPFLMPIEDVFT
FT                   ITGRGTVVTGRIERGEIQLNEEVEIVGIRPESRKTTVTSIEMFNKMLDSGQAGDNAALL
FT                   LRGIKREDVERGQVVTKPGTTTPHTEFEASVYILSKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVVTLPEGTEMVMPGDNTTITVQLIQPIAMDEGLRFAIREGGRTVGAGQVTKIIK"
FT   gene            398442..398747
FT                   /locus_tag="Svir_03970"
FT   CDS_pept        398442..398747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03970"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: Ribosomal protein S10p/S20e; TIGRFAM:
FT                   ribosomal protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95474"
FT                   /db_xref="GOA:C7MTK4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK4"
FT                   /protein_id="ACU95474.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
FT   gene            398793..399434
FT                   /locus_tag="Svir_03980"
FT   CDS_pept        398793..399434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03980"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95475"
FT                   /db_xref="GOA:C7MTK5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK5"
FT                   /protein_id="ACU95475.1"
FT                   /translation="MKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTQVRSKEKDGY
FT                   SAVQLAFGNIDPRRVNKPQAGHFEKAGVTPRRYLAELRTSDADSYEVGQEITADVFSDG
FT                   AVVDVTGTSKGKGFAGVMKRHGFAGQGASHGNQATHRAPGSIGGAATPGRVFKGKRMAG
FT                   RAGNKRVTTQGLTIHSVRAEEGLLLIKGAVPGPKGGLVFVRSAAKGGVTK"
FT   gene            399431..400117
FT                   /locus_tag="Svir_03990"
FT   CDS_pept        399431..400117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_03990"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95476"
FT                   /db_xref="GOA:C7MTK6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK6"
FT                   /protein_id="ACU95476.1"
FT                   /translation="MTATVELKTPTGEAQGTVELPSEIFDVQANIPLMHQVVVAQMAAA
FT                   RQGTHDTKTRGEVRGGGRKPYRQKGTGRARQGSIRAPQFVGGGTVHGPTPRDYTQRTPK
FT                   KMKAAALRGALSDRARAGQVHIITELVTGEKPSTKAAKAALAAVTQAKRILVVLHRDDE
FT                   LGRLSARNLPYVHLLTPDQLNTYDVLVNDDVVFTKAAFDAFLAGPVKGKRAAAVSSSEA
FT                   EGSEEQ"
FT   gene            400114..400425
FT                   /locus_tag="Svir_04000"
FT   CDS_pept        400114..400425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04000"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95477"
FT                   /db_xref="GOA:C7MTK7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK7"
FT                   /protein_id="ACU95477.1"
FT                   /translation="MSSVAIPDPRDVLIAPVISEKSYGLLDDHKYTFLVRPDANKTEIK
FT                   IAVEKIFGVKVISVNTLNRPGKRKRTRHGFGKRKDTKRAIVTLSAESKPIEIFGGPAA"
FT   gene            400440..401273
FT                   /locus_tag="Svir_04010"
FT   CDS_pept        400440..401273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04010"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: Ribosomal Proteins L2, RNA binding domain;
FT                   Ribosomal Proteins L2, C-terminal domain; TIGRFAM:
FT                   ribosomal protein L2, bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95478"
FT                   /db_xref="GOA:C7MTK8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK8"
FT                   /protein_id="ACU95478.1"
FT                   /translation="MGIRKYKPTTPGRRGSSVADFAELTRSEPEKSLVRPLHGRGGRNS
FT                   GGRITTRHKGGGHKRAYRIIDFRRNDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   IIAPDKLKQGDKVESGPRADIKPGNNLPLRNIPVGTMIHAIELRPGGGAKIARSAGVSV
FT                   QLVAKEGPYAQLRMPSGEIRNVDVRNRATVGEVGNSEHANINWGKAGRSRWRGKRPAVR
FT                   GVVMNPVDHPHGGGEGRTSGGRHPVNPNGKPEGRTRRRKPSDKLIVRRRRTGKKR"
FT   gene            401292..401573
FT                   /locus_tag="Svir_04020"
FT   CDS_pept        401292..401573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04020"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="PFAM: Ribosomal protein S19; TIGRFAM: ribosomal
FT                   protein S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95479"
FT                   /db_xref="GOA:C7MTK9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTK9"
FT                   /protein_id="ACU95479.1"
FT                   /translation="MPRSLKKGPFVDDHLLKKVDALNESGKKTVIKTWSRRSTIIPDML
FT                   GHTIAVHDGRKHVPVFITEAMVGHKLGEFAPTRTFKGHVKEDRKSRRR"
FT   gene            401600..402028
FT                   /locus_tag="Svir_04030"
FT   CDS_pept        401600..402028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04030"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="PFAM: Ribosomal protein L22p/L17e; TIGRFAM:
FT                   ribosomal protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95480"
FT                   /db_xref="GOA:C7MTL0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTL0"
FT                   /protein_id="ACU95480.1"
FT                   /translation="MNARNDAVAEAEELPTAVARARFVRDSPTKVRRVIELIKGRNANE
FT                   ALTVLRFAPQAASDQVAKVLASAMANAENNLDLDPDTLWVKNAYADEGPTLKRIRPRAQ
FT                   GRAYRIRKRTSHITVVVESRPAGRGNAKSKSKKKAGGR"
FT   gene            402028..402888
FT                   /locus_tag="Svir_04040"
FT   CDS_pept        402028..402888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04040"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="PFAM: Ribosomal protein S3, C-terminal domain; KH
FT                   domain; Ribosomal protein S3, N-terminal domain; TIGRFAM:
FT                   ribosomal protein S3, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95481"
FT                   /db_xref="GOA:C7MTL1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTL1"
FT                   /protein_id="ACU95481.1"
FT                   /translation="MGQKINPHGFRLGITTDWKSRWYADKQYSEYVAEDVKIRKLLSTG
FT                   MERAGISKVEIERTRERVRVDIHTARPGIVIGRRGAEADRIRGALEKLTGKQVQLNILE
FT                   VKNPEADAQLVAQGIAEQLSNRVAFRRAMRKAIQTSMRSPQVKGIRVQCSGRLGGAEMS
FT                   RSEHYRDGRVPLHTLRADIDYGFFEARTTFGRIGVKVWIYKGDLIGGLKAKQEREAAAA
FT                   AERAPRRERSSRRRSGASGNTSSSTESSRATASQGQGGAQSDADTATSQAPQVAATDAT
FT                   EKTEG"
FT   gene            402892..403311
FT                   /locus_tag="Svir_04050"
FT   CDS_pept        402892..403311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04050"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: Ribosomal protein L16p/L10e; TIGRFAM:
FT                   ribosomal protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95482"
FT                   /db_xref="GOA:C7MTL2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTL2"
FT                   /protein_id="ACU95482.1"
FT                   /translation="MLIPRKVKYRKQHAPRRSGAAKGGTKVHFGDFGIQALEHGYVTNR
FT                   QIESARIAMTRHIKRGGKIWINVFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVVF
FT                   EMSFPNEAVAREAMRRAIHKLPMKCRIVTREGGEF"
FT   gene            403311..403562
FT                   /locus_tag="Svir_04060"
FT   CDS_pept        403311..403562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04060"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: Ribosomal L29 protein; TIGRFAM: ribosomal
FT                   protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95483"
FT                   /db_xref="GOA:C7MTL3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTL3"
FT                   /protein_id="ACU95483.1"
FT                   /translation="MAKAGGVAASELRELTAEELVLRLKESKEELFNLRFQMATGQLDN
FT                   NRRLRTVRADIARIYTVMRERELGLSVSPEENESEGAA"
FT   gene            403559..403840
FT                   /locus_tag="Svir_04070"
FT   CDS_pept        403559..403840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04070"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95484"
FT                   /db_xref="GOA:C7MTL4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTL4"
FT                   /protein_id="ACU95484.1"
FT                   /translation="MTEAVQKKESGRNYRKVREGLVVSDKMDKTIVVELEDRKKHPLYG
FT                   KVMRTTKKVKAHDEQNTAGVGDRVLLMETRPLSATKRWRLVEIREKAK"
FT   gene            403918..404286
FT                   /locus_tag="Svir_04080"
FT   CDS_pept        403918..404286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04080"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="PFAM: Ribosomal protein L14p/L23e; TIGRFAM:
FT                   ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95485"
FT                   /db_xref="GOA:C7MTV7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTV7"
FT                   /protein_id="ACU95485.1"
FT                   /translation="MIQQESRLRVADNTGAKEILTIRVLGGSGRRYAGIGDIIVATVKD
FT                   AIPGANVKRGDIVRAVIVRTAKEKRRPDGSYIRFDENAAVLIKNDNEPRGTRIFGPVGR
FT                   ELRDRKFMKIISLAPEVL"
FT   gene            404287..404601
FT                   /locus_tag="Svir_04090"
FT   CDS_pept        404287..404601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04090"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="PFAM: KOW motif; TIGRFAM: ribosomal protein L24,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95486"
FT                   /db_xref="GOA:C7MTV8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTV8"
FT                   /protein_id="ACU95486.1"
FT                   /translation="MKVKKGDTVLVIAGKDKGAKGKVIKAYPARQRVLVEGVNRIKKHT
FT                   RITQTQRGAQSGGIVTQEAPIHVSNVMVVDSDGKPTRVGYRIGEDGKKVRISRRTGKDI
FT                   "
FT   gene            404601..405170
FT                   /locus_tag="Svir_04100"
FT   CDS_pept        404601..405170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04100"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: Ribosomal protein L5; ribosomal L5P family
FT                   C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95487"
FT                   /db_xref="GOA:C7MTV9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTV9"
FT                   /protein_id="ACU95487.1"
FT                   /translation="MTTAEKTYPTPRLKTRYREEIVGQLREEFGYTNPHQVPGVVKVVV
FT                   NMGVGDAARDSKLIEGAIRDLATITGQKPEVRRARKSIAQFKLRQGQPIGARVTLRGDR
FT                   MWEFLDRLLTIALPRIRDFRGLSDRQFDGNGNYTFGLNEQSMFHEISPDSIDRPRGMDV
FT                   TVVTSANSDEEGRALLRKLGFPFKEA"
FT   gene            405175..405360
FT                   /locus_tag="Svir_04110"
FT   CDS_pept        405175..405360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04110"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95488"
FT                   /db_xref="GOA:C7MTW0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW0"
FT                   /protein_id="ACU95488.1"
FT                   /translation="MARKALIAKAARKPKYKVRAYTRCQRCGRPRSVFRKFGLCRICVR
FT                   EMAHAGQLPGVSKASW"
FT   gene            405458..405856
FT                   /locus_tag="Svir_04120"
FT   CDS_pept        405458..405856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04120"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95489"
FT                   /db_xref="GOA:C7MTW1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW1"
FT                   /protein_id="ACU95489.1"
FT                   /translation="MTMTDPIADFLTRLRNANSAYHDTVVLPHSKIKANIAEILKREGY
FT                   IADYRVEPGEKHKNLVVELKYGPNRERSIAGLRRVSKPGLRVYAKSTNLPSVLGGLGVA
FT                   IISTSSGLQTDRQCKRNGVGGEVLAYVW"
FT   gene            405872..406411
FT                   /locus_tag="Svir_04130"
FT   CDS_pept        405872..406411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04130"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: Ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95490"
FT                   /db_xref="GOA:C7MTW2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW2"
FT                   /protein_id="ACU95490.1"
FT                   /translation="MSRIGKLPINVPSGVDVTIDGQRVTVKGPKGTLEHTVPEPITVER
FT                   DDNGALLVKRPDDERETRALHGLTRTLVNNLVVGVTQGYEKRMEIHGVGYRVQAKGSDL
FT                   EFALGYSHPVLVKAPEGITFKVESPTKFSVSGIDKQQVGQTAAVIRRLRRPDPYKGKGV
FT                   LYEGERIRRKVGKTGK"
FT   gene            406408..406812
FT                   /locus_tag="Svir_04140"
FT   CDS_pept        406408..406812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04140"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal
FT                   protein L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95491"
FT                   /db_xref="GOA:C7MTW3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW3"
FT                   /protein_id="ACU95491.1"
FT                   /translation="MIMSETVTKRKLVGKDVSTRRRAGRVRRHNRLRKKISGTPQRPRM
FT                   SVKRSSRHIFVQLIDDVAGHTLASASSLEADVQAVEGDKKAKAAKVGELVAARAKEAGI
FT                   AKVVFDRGGNAYHGRIAALADAAREGGLEF"
FT   gene            406849..407478
FT                   /locus_tag="Svir_04150"
FT   CDS_pept        406849..407478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04150"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="PFAM: Ribosomal protein S5, N-terminal domain;
FT                   Ribosomal protein S5, C-terminal domain; TIGRFAM: ribosomal
FT                   protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95492"
FT                   /db_xref="GOA:C7MTW4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW4"
FT                   /protein_id="ACU95492.1"
FT                   /translation="MPGRTRQSGGQGGPGDRERGGRDRRDRRDGGRGGAAQDKTPHLER
FT                   VVAINRVAKVVKGGRRFSFTALVVVGDGDGQVGVGYGKAKEVPAAIAKGVEEAKKNFFR
FT                   VPRIGGTIPHPVQGEEAAGVVLLRPASPGTGVIAGGAVRAVLECAGIQDVLSKSLGSDN
FT                   AINIVHATVKALKDLQRPEAVAARRGLPLEDVAPARMLRQRAGQGV"
FT   gene            407481..407663
FT                   /locus_tag="Svir_04160"
FT   CDS_pept        407481..407663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04160"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: Ribosomal protein L30p/L7e; TIGRFAM: ribosomal
FT                   protein L30, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95493"
FT                   /db_xref="GOA:C7MTW5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW5"
FT                   /protein_id="ACU95493.1"
FT                   /translation="MAQLKITQTRSTIGTKQAHRASLRTLGLRKIRQSVVREDTPQVRG
FT                   LLHAVRHLVTVEEVK"
FT   gene            407663..408109
FT                   /locus_tag="Svir_04170"
FT   CDS_pept        407663..408109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04170"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: Ribosomal protein L15 amino terminal region;
FT                   Ribosomal protein L15; TIGRFAM: ribosomal protein L15,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95494"
FT                   /db_xref="GOA:C7MTW6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW6"
FT                   /protein_id="ACU95494.1"
FT                   /translation="MAIKIHHLKPAPGAKREKIRVGRGEASKGGKTAGRGTKGTKARKN
FT                   VPVGFEGGQMPIHMRLPKLRGFNNRFRTEYQAVNVGDLARVFPEGGKIGKDELVARGIV
FT                   HKGELVKVLGDGDVSGVKFELTVDAFSKSAKEKIEAAGGSITTP"
FT   gene            408482..409789
FT                   /locus_tag="Svir_04180"
FT   CDS_pept        408482..409789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04180"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="PFAM: eubacterial secY protein; TIGRFAM: preprotein
FT                   translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95495"
FT                   /db_xref="GOA:C7MTW7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW7"
FT                   /protein_id="ACU95495.1"
FT                   /translation="MLSAFRSALATPDLRKKILFTLMIVAIYRIGAVTPAPGVSYPNVQ
FT                   ACQAQVEDQNIFSLLNLFSGGALLQLSVFATGIMPYITASIIVQLLTVVIPRFEELKRE
FT                   GQAGQGKLTQYTRYLTIALAVLQATGVVALADRGQLFANCDQPVLPDNSVYSLTLTVLT
FT                   MTAGTAVMMWLGELITERGVGNGMSLLIFLNIAAQIPTEGANILSSQGGLTFFFICLLA
FT                   LAIIASVIFVEQGQRRIPVQYAKRMIGRRMYGGTSTYLPIKVNQAGVIPVIFASSLLYL
FT                   PDLIGQLVGDPNQASGWQRFLQNYVSDQSHWVHITLYFAMIMFFTYFYITITFNVDDRA
FT                   EEMKKFGGFIPGIRPGRPTAEYLGFVLNRITLPGSIYLGIVAILPNFFLSVTGEGNNQN
FT                   FPFGGTAVLIMVGVGLDTVKQIESQLMQRNYEGFLR"
FT   gene            409786..410340
FT                   /locus_tag="Svir_04190"
FT   CDS_pept        409786..410340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04190"
FT                   /product="Adenylate kinase"
FT                   /note="PFAM: Adenylate kinase; TIGRFAM: adenylate kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95496"
FT                   /db_xref="GOA:C7MTW8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW8"
FT                   /protein_id="ACU95496.1"
FT                   /translation="MTRVVLVGPPGAGKGTQAATLSQRLGVPHISTGDLFRKHVGEGTP
FT                   LGREAKRYLDSGELVPDTVTNEMVRERLAEPDAQSGFLLDGFPRNTKQADVLGEILEEN
FT                   GHSLDAVIELKVPEDELVKRLLGRGRADDTEEVIRRRQQVYRSETAPLLEYYSDILVTV
FT                   DGIGDVDEVSARVLDALGKRS"
FT   gene            410382..411161
FT                   /locus_tag="Svir_04200"
FT   CDS_pept        410382..411161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04200"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="PFAM: metallopeptidase family M24; TIGRFAM:
FT                   methionine aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95497"
FT                   /db_xref="GOA:C7MTW9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTW9"
FT                   /protein_id="ACU95497.1"
FT                   /translation="MIEIKTPGELDAMRAAGLVVARTLRRVAEAARPGVSTAELDQLAE
FT                   ETIREAGAVPSFKGYHGFPASICASVNEQIVHGIPAKKTVLAEGDLLSVDCGAILDGWH
FT                   GDSAMTIEIGEVSERDRALSAATRAAMVAGIEAAVPNARLTDISHAIESAARRASSEDG
FT                   IEYGMVAEYGGHGIGREMHMEPFLPNVGKPGKGPKLAVGMTLAIEPMLTAGSGETVELD
FT                   DGWTVITADGSRAAHWEHTVAITEDGPWVLTAPEDDV"
FT   gene            411417..411638
FT                   /locus_tag="Svir_04210"
FT   CDS_pept        411417..411638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04210"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95498"
FT                   /db_xref="GOA:C7MTX0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX0"
FT                   /protein_id="ACU95498.1"
FT                   /translation="MAKKDGAIEVEGRVIEPLPNAMFRVELENGHKVLAHISGKMRQHY
FT                   IRILPEDRVVVELSPYDLSRGRIVYRYK"
FT   gene            411715..411828
FT                   /locus_tag="Svir_04220"
FT   CDS_pept        411715..411828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04220"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: Ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95499"
FT                   /db_xref="GOA:C7MTX1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX1"
FT                   /protein_id="ACU95499.1"
FT                   /translation="MKVKPSVKRICDKCQVVRRHGRIMVICENLRHKQRQG"
FT   gene            412032..412412
FT                   /locus_tag="Svir_04230"
FT   CDS_pept        412032..412412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04230"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: Ribosomal protein S13/S18"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95500"
FT                   /db_xref="GOA:C7MTX2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX2"
FT                   /protein_id="ACU95500.1"
FT                   /translation="MARLAGVDLPREKRLEIALTYIYGIGRTRSKDIIAATQLNPDVRV
FT                   KDLGDDDLAKLREFIEENYKVEGDLRREVNADIRRKIEIGCYEGLRWRRGLPVRGQRTK
FT                   TNARTRKGPKKTVAGKKKAGKK"
FT   gene            412514..412552
FT                   /pseudo
FT                   /locus_tag="Svir_04240"
FT   gene            412614..413021
FT                   /locus_tag="Svir_04250"
FT   CDS_pept        412614..413021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04250"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95501"
FT                   /db_xref="GOA:C7MTX3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX3"
FT                   /protein_id="ACU95501.1"
FT                   /translation="MPPKSRTTTGTKKVRRKEKKNVVHGHAHIKSTFNNTIVSITDPNG
FT                   AVISWASSGHVGFKGSRKSTPFAAQMAAENAARKAAEHGMKKVDVFVKGPGSGRETAIR
FT                   SLQAAGLEVGTIQDVTPQPHNGCRPPKRRRV"
FT   gene            413046..413654
FT                   /locus_tag="Svir_04260"
FT   CDS_pept        413046..413654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04260"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: S4 domain; Ribosomal protein S4/S9 N-terminal
FT                   domain; TIGRFAM: ribosomal protein S4, bacterial/organelle
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95502"
FT                   /db_xref="GOA:C7MTX4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX4"
FT                   /protein_id="ACU95502.1"
FT                   /translation="MARYTGPATRISRRLKVDLVGNDKAFERRPYPPGQHGRGRVKESE
FT                   YLLQLQEKQKARHTYGILERQFRRYYEEAARRPGKTGDNLLQLLESRLDNVVYRAGLAR
FT                   TRRQARQLVSHGHFLVNGEKVNIPSYRVSKFDIIDVRPKSLKTLPFVAAKESLGERPIP
FT                   AWLQVVPSNLRILVHQLPERAQIEVPVQEQLIVEFYSKK"
FT   gene            413769..414845
FT                   /locus_tag="Svir_04270"
FT   CDS_pept        413769..414845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04270"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="PFAM: RNA polymerase Rpb3/RpoA insert domain;
FT                   Bacterial RNA polymerase, alpha chain C terminal domain;
FT                   TIGRFAM: DNA-directed RNA polymerase, alpha subunit,
FT                   bacterial and chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95503"
FT                   /db_xref="GOA:C7MTX5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX5"
FT                   /protein_id="ACU95503.1"
FT                   /translation="MLISQRPTLSEETVNETRSRFTIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSIRIDGVLHEFSTVPGVKEDVTEIILNLKELVVSSEEDEPVTMYLRKQGPGE
FT                   VTAADIVPPSGVTVHNPDLHIASLNGKGKLEIELVVERGRGYVPALQNKQAGAEIGRIP
FT                   IDSIYSPVLKVTYKVEATRVEQRTDFDKLVLDVETKPSITPRDAVASAGKTLVELFGLA
FT                   RELNVDAEGIEIGPSPQEADTIAAYAMPIEDLDLTVRSYNCLKREGIHTVGELVSRSEA
FT                   DLLDIRNFGAKSIDEVKMKLAGLGLTLKDSPPGFDPTAAASTYGGAGTSQTWGAQPSTG
FT                   LPDTGHDDGQDYAETEQL"
FT   gene            414883..415452
FT                   /locus_tag="Svir_04280"
FT   CDS_pept        414883..415452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04280"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: Ribosomal protein L17; TIGRFAM: ribosomal
FT                   protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95504"
FT                   /db_xref="GOA:C7MTX6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX6"
FT                   /protein_id="ACU95504.1"
FT                   /translation="MPTPTKGTRLGGSPAHERLMLANLATSLFEHGKITTTEAKAKRVR
FT                   PLAERLITKAKKGDLHNRRQIMRVIRNKDVVHKLIAEIGPFFSDRNGGYVRITKTLPRK
FT                   GDNAAMAVLELVSEKTVTAEAEAARKTKFAKDATAEAKAEESKADEAKAEAEAAAVADQ
FT                   DAEAPESATKDAADEPAEGSDKKDES"
FT   gene            415464..416366
FT                   /locus_tag="Svir_04290"
FT   CDS_pept        415464..416366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04290"
FT                   /product="pseudouridylate synthase I"
FT                   /note="PFAM: tRNA pseudouridine synthase; TIGRFAM:
FT                   pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95505"
FT                   /db_xref="GOA:C7MTX7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX7"
FT                   /protein_id="ACU95505.1"
FT                   /translation="MQDGPATSNGEGGPVRLRIDLSYDGTDFSGWARQPGRRTVQGVLE
FT                   DALAKQPPGASIAGPVVVAGRTDAGVHAIGQVVHVDVTRLAGETRSRMPISSDGLPDLD
FT                   WARYRLNRVLPADVRVLSIRRAPAGFDARFSAVKRHYRYQVSDAPWGVSPLRRRDTLAW
FT                   PRPLSVDAMNEAASSLLGLHDFAAFCKRREGATTIRELMELRWCRVDEYELHLSVSADA
FT                   FCHSMVRSLVGALLWVGDGRRDVGWPLEVLRSRQRSSVVAPAHGLTLVKVDYPPDDELA
FT                   SRAEKTRNIRDESESFQSD"
FT   gene            complement(416282..417241)
FT                   /locus_tag="Svir_04300"
FT   CDS_pept        complement(416282..417241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95506"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX8"
FT                   /protein_id="ACU95506.1"
FT                   /translation="MNTTVNLNDVFRGSAARAAGYVTEAELRGPRFRRLFQDVYAPAHL
FT                   PVTHELRCRGAALIVPKQAVLTGRSAATVLGVELAKPYDPVEFVVPEQYRFGPIQGIHV
FT                   RRTAIRTTESRPWNGIRIARPWRAALDLILRLSPRTYSWVRRLRIAVPDVDAFIRAGLV
FT                   TPQRLRCALRGRRNRGIRLARAALSMIDPRAESLPESELRVVLKSGGFEPIPQYPIMKN
FT                   GREVARLDLVLPETKTAIEYDGKWHRKRKQARLDKARRKKLMGEGWYFVIVTAEKLAGD
FT                   YTKILREVREAQSLWKDSDSSRMLRVFSARDASSSSGG"
FT   gene            complement(417432..418154)
FT                   /locus_tag="Svir_04310"
FT   CDS_pept        complement(417432..418154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95507"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTX9"
FT                   /protein_id="ACU95507.1"
FT                   /translation="MSARVHDVNKALGVAPEFVVDPALLDAISPSGDRGGIVLGSGLQG
FT                   EPLTVSALRATPTRIVLVGGLYLSRQVAMRAMAVGAWVVISTGRPTAWHVLSNAAGQQP
FT                   NGQPSPLVQIRRLSPVELPRPSEDAPLLVVLDGGPTPQDLFPPRSPWQTTVYVLPYLHP
FT                   QAAALANAADLVLMQRLPQGQAELAARIWRLPPQMMRQLTTLKDDQIVALGRNLWRPLR
FT                   LVTTPKEKQILGPIRRGD"
FT   gene            complement(418151..419311)
FT                   /locus_tag="Svir_04320"
FT   CDS_pept        complement(418151..419311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95508"
FT                   /db_xref="GOA:C7MTY0"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY0"
FT                   /protein_id="ACU95508.1"
FT                   /translation="MGLAIGLVLIAINDSLVYVAIGVTAIALVLAFLRWGGQWFTQWAG
FT                   LTARYTLRSHDRVVVPPAPTSVEALAAQDDDKVIGPDDARVSLLRLAVPDLVVAQGKDH
FT                   EHQEVGFAHHDGTWTAVLLVEPTPALITQAGGAPNLPLSALAPCLEDRGVVLDSIQITW
FT                   HSYPGSAALPADSPALASYMEVLGPLPAAARRTTWVSVRLDPKRCPTAVRERGGGVTGA
FT                   HRALIGALSRVRNALESHGVPTRPLSPDELLRAGISAAELTGVAGSNTRVRMQERWSGV
FT                   TAAGIGHASYAITGWPKGKITTGLNALTSVRALSATVTMSISPSEEENRIGLRGVVRIS
FT                   ARNPRELDASDQRLASISERIGVTLTPLRGRQAAGYAATLPIGGTV"
FT   gene            419341..419637
FT                   /locus_tag="Svir_04330"
FT   CDS_pept        419341..419637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95509"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY1"
FT                   /protein_id="ACU95509.1"
FT                   /translation="MVRSWRQTYGVEPEVRSVVPTLEVSAVSGRLRNPRGRGRQAPLGH
FT                   RGHPDHPDHPDHPDHPDHRGHPDHPDHPDHRGHPDHRGHPDHPDHPDHRGRQV"
FT   gene            419641..419892
FT                   /locus_tag="Svir_04340"
FT   CDS_pept        419641..419892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95510"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY2"
FT                   /protein_id="ACU95510.1"
FT                   /translation="MRSDHRAYQVHVGRQRALADHEDGQGRQVHHRAREACPAARVGLD
FT                   LHRGPQELPVVPAFAVGPVDAPKEAGTPAVGPADVEEW"
FT   gene            420115..421674
FT                   /locus_tag="Svir_04350"
FT   CDS_pept        420115..421674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04350"
FT                   /product="Protein of unknown function (DUF690)"
FT                   /note="PFAM: Protein of unknown function (DUF690)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95511"
FT                   /db_xref="GOA:C7MTY3"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY3"
FT                   /protein_id="ACU95511.1"
FT                   /translation="MQSALVRKDAVMLHDPMRTHSRATIVGVVLSCLGMLAFIIVGFFK
FT                   PDPKPPASGIVIGEQSGSVYVVADDQRKLIPTFNLASARLILMAQNQGEGEGGGQGGAP
FT                   AVVEPEVVSDEQLKDIPKGRLQGIPGGPDLLPSEDQLISPYWAVCDQIIVDRSLNDQVA
FT                   RDKAVTESTVVAGVKDLRNELAQDQALLVSAEDGKYYLVYRQKTDANIQNANTVRAEVN
FT                   LENAAVASALNLEKRMARRISMGLLNAIPSVGSLEVPDIPGWGQQPDGFAVEDLPIGSV
FT                   AKTQLADRTEFHVITQGGVQRISQAVADILIYEHTTAGDSGVAVVTPDVLRTLPTVGPG
FT                   DEGYLDVSHYPDIVPTVLDPLNHPVACLGWSLKGEGEQRDAFTSVYVSSELPVPKDENG
FT                   EPQVVKIGTPSPDNMKIDNFYMRPGFAAAVQSATTKETFGRGNIQLISDRGVRYSIPSK
FT                   EIAQGLGLTKLDPAPESIIKLLPAGASLNPQDAQRTYDAVHVNEQEGVVIQPEDQAVSA
FT                   GN"
FT   gene            complement(422063..423658)
FT                   /locus_tag="Svir_04360"
FT   CDS_pept        complement(422063..423658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04360"
FT                   /product="subtilisin-like serine protease"
FT                   /note="PFAM: Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95512"
FT                   /db_xref="GOA:C7MTY4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY4"
FT                   /protein_id="ACU95512.1"
FT                   /translation="MRSARTMKRHSALALVAAIGVAGPILLPLPALAQGDTAAEDSGGY
FT                   YATPPPIDPGPPPNDTRKPDKNYQPRVTCVQRNLEYNEDIQNAPWGQQYLRIDEVHNLM
FT                   RAETGHVGISVKDKKPVRVAVIDTGVTPHPYFGNRLKSGGDYVRPNGDGLHDCDGHGTQ
FT                   VAGIIAADTPDHIGFTGVAPDAEIVSIRQSSQNYSPDEEGSSPAGGSGGDSDEAGGAGD
FT                   GNDGANGGESLRGTNPAQDSRTQGSEGAGTLKTLAQAIVNAANAGVDVMNISINHCRPA
FT                   NGGITQDEQNMWAAIRYAVRQKDVVIVSAAGNVAEANNCKQNDQALAEKPTTIVTPPWF
FT                   SEDVLSVAAIDETGGLADFSMHGPWVSVAAPGTGIISLDPAEGSDGLANMMIDNGEARE
FT                   IKGTSFAAPYVAGLAALVRAKYPDLNAYEVMHRIKFTAQHPPAPGGRDNFVGYGVIDPM
FT                   AALTATVPSEENIPPALAENLPSDMPPPNNRDWTPVTVALIGSGGALAALGITLFVVHT
FT                   IRRNRKDDTEPARA"
FT   gene            complement(423699..425093)
FT                   /locus_tag="Svir_04370"
FT   CDS_pept        complement(423699..425093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04370"
FT                   /product="secretion protein snm4"
FT                   /note="PFAM: Protein of unknown function (DUF571); TIGRFAM:
FT                   secretion protein snm4"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95513"
FT                   /db_xref="GOA:C7MTY5"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY5"
FT                   /protein_id="ACU95513.1"
FT                   /translation="MATGTTVFSRVTVVAPRTRIDVALPADVAVADLMPMLLEMAKEVS
FT                   PDGGARHGGWALAKLGDAPLDPSRTLASLGIVDGELLQLRKRNENPPPPLYDDVVDAIA
FT                   EAEPDSFRPWTKETAQRIGHVAGGLALFCAALALFFGGPLYGGNGLAVAITAGVAALAC
FT                   VAVGATLAKAYNAPATGVVIAAAGGLPLAFVSGFYIVPDGTIRANLLLASALVVVVAAA
FT                   CILLMGAGITTFIAAATAGVFGVIAFLIATLIAHPAPGIAAGVAAAALAGISMLPRATI
FT                   WLAKLPLPHVPSTAEELKEDTGYPDYSSIERKTKAAHNYMTGLLIGSGSVTAVAAMITA
FT                   TSGDIWGILTAVVATLVLLLRARTYANGSQAVALLTTGMASAAGILLGWMWTEEANDRV
FT                   LWVFGTILLLGAAALVLGVVFPNQRFTPPMRRAVEIFEAACIAAVLPLALAVMGLYSTL
FT                   RHLDIG"
FT   gene            425317..429321
FT                   /locus_tag="Svir_04380"
FT   CDS_pept        425317..429321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04380"
FT                   /product="DNA segregation ATPase, FtsK/SpoIIIE family"
FT                   /note="PFAM: FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95514"
FT                   /db_xref="GOA:C7MTY6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY6"
FT                   /protein_id="ACU95514.1"
FT                   /translation="MSTLQFKRSPRLAAPRPPGGEVHLEPPPEIPRTIPGNIVMKLMPV
FT                   VMVVAMLGMVVFMFTAGAMRSPFMLMMPLMMMMSMVGMFAGGGRGGQQKKAEMNEDRKD
FT                   YLRYLGQMRDRAREAMIEQRASLEWVHPDPEALWSMVSTRRMWERRQSDQDFLHLRVGR
FT                   SSHRLATRLVPPQTGPVDELEPIATLALRRFVRAHSIVPDLPTQITLRGFAAVGLQGDK
FT                   KLTRGLARAMLAQLATFHSPDDVLIAVATTGRAKEEWEWAKWLPHVQHPTMSDGIGQMR
FT                   MMTGSLAQIEHWLEEELRDRQRFSRNATPPPDQPHVVIVLDEAEVTGDEQILLEEGLVG
FT                   VTLIDLSDSIGNLAARRGLRLVVEEERLGARSAGGVEWFGRPDKLSTVEVEALARKLSP
FT                   YRMSTGATEDSEEQPLLSNPSLLELLGIPGDPMTFDVQQAWRPRPIRDRYRVPFGVGEY
FT                   GQPVELDIKEAAMEGMGPHGLCIGATGSGKSEFLRTLVLGLLATHSSTTLNFVLVDFKG
FT                   GATFLGLEKAPHVSAVITNLADEVTLVDRMKDALAGEMNRRQEALKNGGNFKNVWEYEK
FT                   ARENGADLDPLPALFIVVDEFSELLAAKPDFIDLFVAIGRLGRSLQMHMLLASQRLEEG
FT                   KLRGLDSHLSYRIGLKTFSAAESRAAIGVPDAFELPSVPGGGYLKYDTSTLVRFKAAYV
FT                   SGPYRPAGIKTAAPGAKVVRADKRPQLFVPDFVELPKEPEPEPEPVEQQQPESEEAVEP
FT                   SELDVIVSRLVGQGPPAHEVWLPPLKEPNSLDTLLPNLNPTEDRGLSPVGFFGNGRLQV
FT                   PLGIVDRPYEQRRDPLWADFSGGAGHGAVVGGPQSGKSTMLRTLIMSMALTHTPEEAQF
FT                   YCIDLGGGTLAALEGLPHVGGVAVARREPDKARRIVAELTTLINEREERFGALGVDSMN
FT                   DFRNRKRRGEITAEQDPFGDAFLIVDGWRALRDDFDELEPQITKLAVQGLTYGVHVIIS
FT                   SNRWADIRPAIKDLLGTRFELRLGDPSESDIDRRVAVNVPPGRPGRGLTRDKLHFLSGL
FT                   PRIDGSSDDADLGDGVADAVKKISAAWKGRHAPQVRLLPDLMPYEELLLQDKYRDTKLI
FT                   PIGVDEDELAPVYLDFDSDPHFLAYADGESGKTNLLRQIVRGITERYTKKEAVIILVDY
FT                   RRTMLGFVEGDQLLGYAVSANQLEGMMKEVAQSMAKRLPGPDVTPQQLKDRSWWNGPEL
FT                   FVVVDDYDLVATSTNNPLRPLAEYLAQAKDVGLHVVVARRTGGAARTGMDPIIGKLKEL
FT                   AMPGLVMNGSKDEGQLLGNVKAGPMPPGRGYFVSRKVGKKLMQVSWIAPE"
FT   gene            429443..431440
FT                   /locus_tag="Svir_04390"
FT   CDS_pept        429443..431440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04390"
FT                   /product="molecular chaperone"
FT                   /note="PFAM: Hsp70 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95515"
FT                   /db_xref="GOA:C7MTY7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR023840"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY7"
FT                   /protein_id="ACU95515.1"
FT                   /translation="MTLRVAVDFGTSSTCVVASVNGREPQVVVVDGQPIMPSAVYAARD
FT                   GTLFVGQEAERQAAVDPSRFEPHPKRRIDEGELLLGDTVLTVVDAMRAVLQRAVSEARR
FT                   LAGNAEVSLLVLTHPADWGAVRTRLLRQAAGQLAYEVALVPEPVAAAVFHAATFTPNDL
FT                   NQERTVEFSGNPGDTVAVLDLGGGTIDVSVVRRSQAGERAEYEVLATRGDPGFGGADID
FT                   QALLEHVGSLVSKADPEAWEQLVQGRELADRRRRRVLWQDVRGAKETLSRHAYTDVPMP
FT                   PPFADAHVTREDLEQLIRTPLGRAAELTKVTVEAAGLRPRQLTAIFLVGGSSRIPLVSR
FT                   LVHERTGVVPTTLDQPETVVARGALRAVELLPDRTGVLPGTMGARLAGKSMSLPADHRT
FT                   EVVTRPKPSTPRGTGPWGAGQMSMPAPGAQRALGGNRPPVYPVSHGMPSPQRGFPVSPS
FT                   PSGQPYTPSPMAASQHPDHSGRPQRSGARIRMVLIAVAVVVLVAAVAAVTLFISSDGDK
FT                   VETQGHLYAQYSYKFVAPKDWVQTGDNVEARQVVVKPREAQASTDDDLVVVQEFVLSYD
FT                   GGVHRERLADELREQTSANPDVYTDFSEHYEYAGHDVVHYRENKPAATVHWYVLAHGTA
FT                   QVSVGCQEAKLRERVRAACEQIVRTLEFTN"
FT   gene            431637..431954
FT                   /locus_tag="Svir_04400"
FT   CDS_pept        431637..431954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04400"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Proteins of 100 residues with WXG"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95516"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY8"
FT                   /protein_id="ACU95516.1"
FT                   /translation="MAGGFTGTPEQFQQAYQDVDAIKASMDQNLNQLRSNIEATQAGWQ
FT                   GEAAKAFQNVMAAFDEKTRKLNEALGNIGELLQQSGVKYQQAEEEQNAAISSIGNALNG
FT                   L"
FT   gene            432006..432293
FT                   /locus_tag="Svir_04410"
FT   CDS_pept        432006..432293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04410"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Proteins of 100 residues with WXG"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95517"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR020167"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTY9"
FT                   /protein_id="ACU95517.1"
FT                   /translation="MPNGIVVDYATIHTAAEDCQRTGGELEALFEDLKARLAPLVDSWS
FT                   GEAMEAWMQCQNEWNQSLDEMKQVLAQIATALPQIADGYQATDKSIQGMF"
FT   gene            complement(432363..432779)
FT                   /locus_tag="Svir_04420"
FT   CDS_pept        complement(432363..432779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95518"
FT                   /db_xref="GOA:C7MTZ0"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ0"
FT                   /protein_id="ACU95518.1"
FT                   /translation="MTPPQPTGTGFGGSFSSEYGGFGAFDDDSPAKRGKSRKPWIISAV
FT                   VVVVLAAAGGAAAWFSGMFTDEVLDQESLHEGVATVLQDSYGEHDVSNVSCPADQKIAA
FT                   GHTFNCTVDIAGESKTVKIRILNNEPEYEVGAPH"
FT   gene            complement(432909..433721)
FT                   /locus_tag="Svir_04430"
FT   CDS_pept        complement(432909..433721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95519"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ1"
FT                   /protein_id="ACU95519.1"
FT                   /translation="MGKPIPNGDDVAKYVGAKFSSTLERVADDLDNDEPHKSTLRSFMR
FT                   VGELKSDTTVTAIQVGNPPTRFFKNHSNRYSSDYRDYLLPAGSDVEYVLLGPEYAELAP
FT                   TPWVSLPYTGEGLDICFWGGYATVCKILNAVNSSMKNDEMDKTAKSLADGSTELTIDVS
FT                   LRTFLEERIIVLPDWLLEEISESLLDQVIDTRIVLDPEGDLKEIEMNGLLAADGNEVEI
FT                   KQHYQVHEPPTEHEIPAVPSSDEVTELTTEEEVDAFYEGMAEITSERK"
FT   gene            433984..434436
FT                   /locus_tag="Svir_04440"
FT   CDS_pept        433984..434436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04440"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: Ribosomal protein L13; TIGRFAM: ribosomal
FT                   protein L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95520"
FT                   /db_xref="GOA:C7MTZ2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ2"
FT                   /protein_id="ACU95520.1"
FT                   /translation="MPTYSPKPGDVTRAWHVIDAENVVLGRLATEVATLLRGKHKPIYA
FT                   PHVDTGDFVIIVNADKVALTGNKREQKLAYRHSGYPGGLRKRSYGELLETRPERLVEKV
FT                   VKGMLPKNKLGRAQAKKLKVYAGPDHPHAAQKPQPHEITKIAQVSQ"
FT   gene            434433..434921
FT                   /locus_tag="Svir_04450"
FT   CDS_pept        434433..434921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04450"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: Ribosomal protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95521"
FT                   /db_xref="GOA:C7MTZ3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ3"
FT                   /protein_id="ACU95521.1"
FT                   /translation="MSEEQSVTSTETEAAYDAVVTSETPAAPAPSRAAGGTAQTVGRRK
FT                   EAVVRVRMVPGTGEFRLNGKSLEQYFPNKVHQQLIREPLVTVEKAESFDVHARLHGGGI
FT                   SGQAGALRLAIARALAEIDSDDRPALKKAGFLTRDARATERKKYGLKKARKAPQYSKR"
FT   gene            435191..436525
FT                   /locus_tag="Svir_04460"
FT   CDS_pept        435191..436525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04460"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95522"
FT                   /db_xref="GOA:C7MTZ4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ4"
FT                   /protein_id="ACU95522.1"
FT                   /translation="MARLFGTDGVRGLANDELTPELALALAASAARVLAAHDRSQRPVA
FT                   VVGRDSRASGEMLEAAVVAGLTSAGADVLRVGVLPTPGVAHLVTELGANLGVMISASHN
FT                   PMPDNGIKLFGEGGHKLPDGIEDEIERGLNAQGARPTGPQIGRVSDVDDAVDRYVAHLL
FT                   EAVPVSLGGLRIVVDCANGASSLAAPDAYRKAGAEVIALHAEPDGVNINDGCGSTCPED
FT                   LQAAVVEHGADLGIAHDGDADRCLAVDADGNLVDGDQIMAILAVAMAESGELADNTLVA
FT                   TVMSNLGLHLAMKKRGIAVRTTAVGDRYVLEELRAGGFSLGGEQSGHVVLPDYATTGDG
FT                   LLTALRLMGRVAQTGRPLRELAAVMHRLPQVLVNVPVTDKAAVAAAPVVRDAVADVEAE
FT                   LGDEGRVLLRPSGTEQLIRVMVEAPDADTAQAAADRLAGVVASIG"
FT   gene            436701..437021
FT                   /locus_tag="Svir_04470"
FT   CDS_pept        436701..437021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95523"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ5"
FT                   /protein_id="ACU95523.1"
FT                   /translation="MSAPEGYRAETGTMARESQKIHDEAESAQGEVKDLEAAEVSETDF
FT                   GKAHTEWGADFTTAIAEIAKGASGMCASLKSLAAAIGSAGKQYEAAEAEQSSTVTQSGS
FT                   GL"
FT   gene            437018..439198
FT                   /locus_tag="Svir_04480"
FT   CDS_pept        437018..439198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95524"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ6"
FT                   /protein_id="ACU95524.1"
FT                   /translation="MSERTWEETKEILDDPYVSAETKQTVLGAYARSGDGNEAAEEYYE
FT                   KYGVNPRWDLFGPPRFIDDDKIYEEAKAEAEREGYRERQVSDRLEENSAALAEAQAPGS
FT                   SGGVQNSDELFDLGETALEVFKQFVPVDDEAPGDCKHIDGPIIFDSDIVERFDEQRDID
FT                   FQKFLEQAQKLRDAHATLQELHDTTESNLNSLYKDWTGPAANASYQKYSEDIAPNSDEL
FT                   LEYLKGGAEVIEAAVQTVYEVCKSKIEQIDDLYTPTVGAAVPDMARKVMKIARGEVEDQ
FT                   SQILEIAAWVDAETGSNIESTIRADDCGLNDGNKEMTVDQCREWVQTSWNPDLYDHLCK
FT                   SFTAVCDDTKEQVDSAWEELNDYFKDYTSEFPEGGDLGLADPSQDGLQDPGSQNPGSDG
FT                   GTSPSGGGSTPSAPSIPEPEILGQDQGKNPVTGDELEVDPETGEPYPIDPETGEAVTDV
FT                   GDDRDTLTVEKGDRTFEMTEPDEDGEMEISVDDGSGEPKEYKLDFGDGENDEGGQSESG
FT                   DFGPTGAGGGAEEEVHRPGEDGKIHIEDGDLKITAERPEGPDGPTRVTVDDGTPPPTTY
FT                   TSERRRTRNPVPRVGPVWGQAREVARTGEVPEPCPLRARTRSKTTRKPTPTRASRQSDP
FT                   AEAWVAPRLRAVGRSPTAVPWPEAPAGPPVKAAVEEQPAAQPAQTRKFSRAVAPPEPAP
FT                   EAPKPPPPPRPVRRRREEVFDDEDFSNNSWMQ"
FT   gene            439195..439458
FT                   /locus_tag="Svir_04490"
FT   CDS_pept        439195..439458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04490"
FT                   /product="acyl carrier protein"
FT                   /note="PFAM: Phosphopantetheine attachment site; TIGRFAM:
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95525"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ7"
FT                   /protein_id="ACU95525.1"
FT                   /translation="MNTASHPVVAKRADDIRCLVCRVLEVDADRVEDTDLFVETLGADS
FT                   MKLIELLAHLEIEFDVEVDEDEIERLVNIEGVFAVLSAALGG"
FT   gene            439462..440663
FT                   /pseudo
FT                   /locus_tag="Svir_04500"
FT   gene            440669..441670
FT                   /locus_tag="Svir_04510"
FT   CDS_pept        440669..441670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04510"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95526"
FT                   /db_xref="GOA:C7MTZ8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ8"
FT                   /protein_id="ACU95526.1"
FT                   /translation="MLGVVTAWAAISVCGVGDVPLTPTSPTALSEEWPDAEAYLATEFD
FT                   VEERLGSKGTASMDRSSALAVGVTAELLAEMGITGSIGVVLGTTSGSSQTQYEFTRDSL
FT                   TRRKPYFVNPAMMPFALMNSAASQCAIWHGMTGPNTTIAGGRLSGLNVLRYGGRLLAQS
FT                   RADAVVCGAVEEHSPTRAWLQRHREGDRVLGEGAAVVLLEKPGTPRRTLAEVHRVDTRV
FT                   AVDGDRRAALAACVRRTLDGANLRARDVAAVAVSAPGADAAEVERVALDDVLGESGEAL
FT                   PVIDPQDAVGDVGAAIGPFQLAAALDTPGWVLLTALDEGGTAGSGLIKVAPP"
FT   gene            441974..442279
FT                   /locus_tag="Svir_04520"
FT   CDS_pept        441974..442279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95527"
FT                   /db_xref="GOA:C7MTZ9"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MTZ9"
FT                   /protein_id="ACU95527.1"
FT                   /translation="MAGGQTVDPGKLDAAGTTYSQEGGELTSAGSRIETGVSSAQVGKA
FT                   WSHVASTYADIIGKYRDCVTTYGQKATDLGGKLTQAAKAYEDGEAVSRDMIASKGV"
FT   gene            442286..444970
FT                   /locus_tag="Svir_04530"
FT   CDS_pept        442286..444970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95528"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU00"
FT                   /protein_id="ACU95528.1"
FT                   /translation="MAYVGQEEQREFVDKEFTSQDLDEMQELLADPSVDVQDRKNFLYA
FT                   LKNAGRLDGQELLDYAREVGADPVDLMKGGNAVHENMDHARNSLNGKRFSERLKNAGDV
FT                   QRAQENLNGGGFSTSDEIIDEAEPALKLFDEFYPRYQEASGLIESAPMPAEAQSYDVVT
FT                   VDTSSIGGSGGSAVASAGATYSHSGIDPKSIRDGLDEFRGIDFGAFHADADMLRKAHSS
FT                   VRDGMDALERAWGSNTSDWTGDAKAAAEQVNNNLVKGSGDLSQALKTAPDNLGAGVDAV
FT                   QQNVVNFVHRVLEVYGSGTVAELSPHQVDDLINAAKELPGVIADLHAKIEEIESKGFWD
FT                   HFVEFFSNPLKWGFSAINPIASIIGYIVTEEITEDNIREETQKMESALAEVKTKLGEFC
FT                   ADYQQKASSIHSHAAEFVAGIDAAYMETMQLLGEGLEPDPFADPGGGKDGLGDTEGISG
FT                   SIGAGGGVGAGGGIGAGGGGGISTGGGGGVPIGGGAGIDLPGDEAAGTNPVTGEPLEVD
FT                   PETGDPYPIDPETGEPIKNVDDLEKLTVEHGDNTLTLTEPTEDGEMAITIDDGSGEPSE
FT                   YQLDFSEEDGEAEGAEESRREETEFGPQGSDAVTEKVYRPGPDGKIHIEDGDLKIVAEQ
FT                   PEGPDGPTVVTVDNGDGEPVTYTLGETEGQEAGPRGLGPQPSATESAPTSRQAGQSAPD
FT                   AGVVGGEGGGAPGPSADASAPTGGEAFAASSSPEFHGSSEGTVDPGIDVSADNTVNESM
FT                   ESSGDSSSSSTTHPQAVSGGSGGTAFGGGGGGSDLGSFSDSESRGQSTPSGANLGTAPG
FT                   GDIPAGMSQGGGAGSSSASGMGMMGGMGAMGGGAGGGQGGDQERTSSAYRVEGNIFETF
FT                   SNTVRISGTIGDNTADVPVRFTR"
FT   gene            complement(445066..445341)
FT                   /locus_tag="Svir_04540"
FT   CDS_pept        complement(445066..445341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95529"
FT                   /db_xref="GOA:C7MU01"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU01"
FT                   /protein_id="ACU95529.1"
FT                   /translation="MRRLRRRSRSCRRLRRGFRLGLLSFAELEGGVFRFTPLKPLILGV
FT                   GVVFFLATLLRLSVQFSTALFVGLSPLLGTFGHLLRTLAYAFGNGR"
FT   gene            complement(445431..446267)
FT                   /locus_tag="Svir_04550"
FT   CDS_pept        complement(445431..446267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04550"
FT                   /product="dienelactone hydrolase-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95530"
FT                   /db_xref="GOA:C7MU02"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU02"
FT                   /protein_id="ACU95530.1"
FT                   /translation="MASTAKRLLEQLSRPGPYDVLRGDLALVGLPGVVFTPSTGFNLPA
FT                   VAFGHGWLQPPGRYHGLLRHLASWGIVAAAPATHGGPLPSHRLFAADLRSTLDLVTTLR
FT                   LGPDGISVDPTKLGLAGHSIGGGAAILAAAPGEGAGDDARQVKAVATVAATQTMPPATT
FT                   AARKITAVGLHLAGDDDLLAPAKGNAEVITKEWAGPAQLRVIPKMTHLGVTEGTHWSRL
FT                   LLQGKPQHTVQRRVRALFTAFFLTTLAGDDTYRELLDTDLKAARIEYDNRAALTNA"
FT   gene            446460..448322
FT                   /locus_tag="Svir_04560"
FT   CDS_pept        446460..448322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04560"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: Glutamine amidotransferases class-II; SIS
FT                   domain; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95531"
FT                   /db_xref="GOA:C7MU03"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU03"
FT                   /protein_id="ACU95531.1"
FT                   /translation="MCGIVGYVGHRQALDVVLGGLRRMEYRGYDSAGVAVLADDKKLVV
FT                   ERKAGRIANLEAALDATGRDTFTGTAGMGHTRWATHGAPVDRNSHPHRDSTGRVAVVHN
FT                   GIIENFAALRTELEDSGIELSSDTDTEVTAHLIARAYDHGDTAGDLPASVRAVCRRLEG
FT                   AFTLVVTHADRPDLIVAARRSSPLVVGVGKDEAFVASDVAAFIEHTREAVELGQDQLVV
FT                   ISRDGYEITDFHGVPAEGKPFTVDWDLSAAEKGGHEYFMFKEIEEQPDALANTLRGHFE
FT                   SGRIVLDEQRLSDQDLRDVDKVFVVACGSAYHSGLVAKYAIEHWTRLPVEVELASEFRY
FT                   RDPVLDRDTLVVAVSQSGETADTLEAVRHAREQKARVLAVCNTNGAQIPRESDAVLYTH
FT                   AGPEIGVASTKAFLAQVAANYLVGLALAQARGTKYPDEVAREFAELEAMPSAVKSVLAT
FT                   VDQVRDLGRRMADARAVLFLGRHVGFPVALEGALKLKELAYMHAEGFAAGELKHGPIAL
FT                   IEEGLPVVVVMPSPKGRAVLHSKMVSNISEIQARGARTIVIAEEGDERVRPFADELVEI
FT                   PAVPTLLQPLVSTVPLQVLAAEIARTRGYDVDKPRNLAKSVTVE"
FT   gene            448330..449775
FT                   /locus_tag="Svir_04570"
FT   CDS_pept        448330..449775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04570"
FT                   /product="yjeF-like protein, hydroxyethylthiazole
FT                   kinase-related"
FT                   /note="PFAM: Carbohydrate kinase; YjeF-related protein
FT                   N-terminus; TIGRFAM: yjeF C-terminal region,
FT                   hydroxyethylthiazole kinase-related; yjeF N-terminal
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95532"
FT                   /db_xref="GOA:C7MU04"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU04"
FT                   /protein_id="ACU95532.1"
FT                   /translation="MRGVWTTEHVRSAEERLLAVTPEGALMRRAAYGVSVRAAKLLAEH
FT                   TGRVVGTRAVLVVGAGNNGGDALWAGYFLRRRGVAVAAVLLRPEKAHPAGLAALRRAGG
FT                   RVYSPETAAEVIDSADVVIDGVVGLSARGPLRPDAAAVFERVTAPVLAVDLPSGVDPDT
FT                   GAVDGPAVRATCTVTFGAYKPVHVLNPQHCGDITLVDIGLSGELGEPDLLQLDAADVAA
FT                   AWPLPKPEDNKYTQGVTGVAAGSSTYPGAAVLTAAAAVRATAGMVRYAGPVADVVRSHW
FT                   PEVVATGSIFDAGRVQAWVVGPGIGTGRQSKEVLAEALGQGVPVCADADAITLIAEQPD
FT                   VLDARDPDTPLLLTPHDGEFERLTGSAPGADRVGAAREAARRFRAVVLLKGHCTVIAAP
FT                   DGRVLVNRPRGSWLATAGSGDVLAGMIGALLASGLDPWLAAGVAADVHARAGQIAAGGV
FT                   PTSASGILAAIPDAVRQARSLTP"
FT   gene            449983..451392
FT                   /locus_tag="Svir_04580"
FT   CDS_pept        449983..451392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04580"
FT                   /product="D-xylulose kinase"
FT                   /note="PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: D-xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95533"
FT                   /db_xref="GOA:C7MU05"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU05"
FT                   /protein_id="ACU95533.1"
FT                   /translation="MTDNDVLVAGVDSSTQSTKVVVCDARTGAVVRSGRAEHPDATEVD
FT                   PAEWWTAFTAATDGLLDGVSAIGVAGQQHGMVTVDEDGDVVRPALLWNDTRSAQAATDL
FT                   VRELGGPQAWADAVGSVPVASFTVTKLRWLAEHEPDKADRVAKVMLPHDWLTWRLVGGE
FT                   PVTDRGDASGTGYFSPAEGAYRTDILTRAFGGRAPELPRVLAPSEPAGRTSDGMLVSAG
FT                   TGDNMAAALALGAGDGDVVVSLGTSGTVFGVSEIPAADPTGSVAGFADATGRFLPLACT
FT                   LNAARVLTSTAQFLGVELSEFDRLALSAAPGAGGLTLLPYLDGERTPNLPDAAGSLFGL
FT                   RRTNMTPENLARAAVEGMLCGLAAGLDAVREYGISVRRVLLIGGAAQSESVRAVAPIVL
FT                   GVPVVIPQPREHVAVGAARQAAWALADTAEPPMWGTDIAVRLPEPSDDVAAEGERIRQR
FT                   HAEVRRRVHDV"
FT   gene            451489..452625
FT                   /locus_tag="Svir_04590"
FT   CDS_pept        451489..452625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04590"
FT                   /product="alanine racemase"
FT                   /note="PFAM: Alanine racemase, N-terminal domain; Alanine
FT                   racemase, C-terminal domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95534"
FT                   /db_xref="GOA:C7MU06"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU06"
FT                   /protein_id="ACU95534.1"
FT                   /translation="MSGMSLPRAEVVVDLEAIRHNVRLLASRAAASGAETMAVVKADGY
FT                   GHGAVPVARAAVEAGATWLGVASLDEALALRNAGLTTRLMSWLDTPDVDFAPAVERDID
FT                   VSVSSTGELARAVDAAARVGRRARVHLKIDTGLSRNGCPAELWPTLVKAAAAEDGVEVV
FT                   GMWSHLACADEPGHPATEAQAERFAAAYAVAREAGLSPLRHLANSAATLTRPDLHFDLV
FT                   RPGIAVYGLNPVSQPEDLRPAMTFRSSVVLTKRIRAGESVSYGQTWTASADTTVALVPV
FT                   GYADGVPRTLSGRLSVWLNGTRRPVVGRVCMDQLVVDCGDDEPELGAEVVLFGTGEGGM
FT                   PTATEWAEKIGTIDYEIVTGMYRPRVRRRYVGTERDRS"
FT   gene            452622..453614
FT                   /locus_tag="Svir_04600"
FT   CDS_pept        452622..453614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04600"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95535"
FT                   /db_xref="GOA:C7MU07"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU07"
FT                   /protein_id="ACU95535.1"
FT                   /translation="MMSYPGEGSTFDEPFAGSRTERTSTVAADDGTPLAVEEIEPRDGG
FT                   EAELTVVGVHGFALSRRSWFVQRRDFAELARPRVRQVYYDHRGHGQSAPSDAAHSTIEQ
FT                   LAGDLHAVLRAVTPDGPVVLLGHSMGGMVIMELAQICPELFIERIRGVALIATAAGEIG
FT                   AHGLPRSLLSKYNPLTRRVGELAEWRPGLVEFIRAAGGQLTKAAVRRLAFGSRDVDPRL
FT                   VDFMIDMLRETPVRQLAHFVDTLGTHNRYAALAGLKYTDVVVIGGDADRLTPFVHAERI
FT                   AAELPGARLVRVEGAGHMVHLEEPELVNRHLVDLVVRCGGGDGTRRRDE"
FT   gene            453611..454084
FT                   /locus_tag="Svir_04610"
FT   CDS_pept        453611..454084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04610"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /note="PFAM: Uncharacterised P-loop hydrolase UPF0079;
FT                   TIGRFAM: conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95536"
FT                   /db_xref="GOA:C7MU08"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU08"
FT                   /protein_id="ACU95536.1"
FT                   /translation="MRQVSAELPTPDDAMRFGRALGELLRPGDLVLLSGPLGAGKTTMT
FT                   RGIAEGMGVSGRVSSPTFVLARVHPAGESGVPLVHVDAYRLGGDLAQLEDLDLDTELDR
FT                   AALVVEWGEGMAEQLSEDYLVVRLDRRPDDVRVVTLEPHGAWVTRLAEARLAG"
FT   gene            454233..454889
FT                   /locus_tag="Svir_04620"
FT   CDS_pept        454233..454889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04620"
FT                   /product="acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95537"
FT                   /db_xref="GOA:C7MU09"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU09"
FT                   /protein_id="ACU95537.1"
FT                   /translation="MPPEPTVVHPLPDHDRVVFLKPLVGSPKIVVGEYTYYDDPEHATE
FT                   FETRNVLYSYGPERLVIGKYCAIASGTTFIMAGAEHPTMGVSTFPFTMFGGEWAARTMD
FT                   IVTSMPSRGDTVVGNDVWFGYRATVLPGVRIGDGAIVAAGAVVTADVPPYTIVGGNPAR
FT                   PIRARFDDADVERLLRAAWWDWPVELVTEHARTIMSGTPADIARIAADHGLEKSL"
FT   gene            455147..455770
FT                   /locus_tag="Svir_04630"
FT   CDS_pept        455147..455770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04630"
FT                   /product="putative molecular chaperone, inactive
FT                   metal-dependent protease like protein"
FT                   /note="PFAM: Glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95538"
FT                   /db_xref="GOA:C7MU10"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU10"
FT                   /protein_id="ACU95538.1"
FT                   /translation="MLVLAIDTATPAVTAGVVELEQQSTTVLAERVTQDARAHGELLTP
FT                   HVLDAVSRSGITLRDLTAVVCGVGPGPFTGLRAGIVTAAALAHSLDIPAYPVCSLDAIA
FT                   ADSVAGPDSAGPFLVVTDARRKEVYWAAYDAAGRRTHGPDVAKPADLDSTVRRVEHAHP
FT                   SPAGLVRVAAAAVLGGGKPGPLTPLYLRRPDAKVPGERKRVTTP"
FT   gene            455767..456240
FT                   /locus_tag="Svir_04640"
FT   CDS_pept        455767..456240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04640"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95539"
FT                   /db_xref="GOA:C7MU11"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU11"
FT                   /protein_id="ACU95539.1"
FT                   /translation="MRLEPLRHSHIDACVRIERLLFAGDSPWSHGAFRAELDAGGYYLA
FT                   ALDDQDRLVGYAGLAVVGRPGAWETAVHTIAVHPDHQGQGIGTALLRALLARADELQAP
FT                   VVLEVRTDNDTAIALYERHGFEQVGLRRRYYQPSGADAYTMVRPARRTQEVAG"
FT   gene            456240..457286
FT                   /locus_tag="Svir_04650"
FT   CDS_pept        456240..457286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04650"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="PFAM: Glycoprotease family; TIGRFAM:
FT                   metalloendopeptidase, putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95540"
FT                   /db_xref="GOA:C7MU12"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU12"
FT                   /protein_id="ACU95540.1"
FT                   /translation="MSSIVMGIESSCDETGVGLVRLRDDGGVELLADEVASSVEEHARF
FT                   GGVVPEVASRAHLEAMVPTVRRAFDTAGLRMSDVDAIAVTAGPGLAGALLVGVSAAKAY
FT                   AAALDVPLYGVNHLAGHIAVDTLQHGPLPTPSLALLVSGGHTQLLRVDDIACKITEIGS
FT                   TVDDAAGEAYDKVARVLGLPYPGGPPIDRAAREGDPNAIAFPRGMTGPRDAPFDFSFSG
FT                   LKTAVARWVEGAQARGENIPVADVAASFQEAVADVLTAKAVRAATELGIGTLVISGGVA
FT                   ANSRLASLAAERCADAGVELRVPRPRLCTDNGAMIAALGAHLVAAGCPPSPLDLSADPS
FT                   LPVSTVCL"
FT   gene            457872..458165
FT                   /locus_tag="Svir_04660"
FT   CDS_pept        457872..458165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04660"
FT                   /product="Co-chaperonin GroES"
FT                   /note="PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95541"
FT                   /db_xref="GOA:C7MU13"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU13"
FT                   /protein_id="ACU95541.1"
FT                   /translation="MSVNIKPLEDRIVVQTSEAEETTASGLVIPDTAKEKPQEGKVLAV
FT                   GPGRIDDKGNRIPLDVKVGDVVIYSKYGGTEVKYNGEEYLILSARDVLAVVN"
FT   gene            458251..459855
FT                   /locus_tag="Svir_04670"
FT   CDS_pept        458251..459855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04670"
FT                   /product="chaperonin GroL"
FT                   /note="PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95542"
FT                   /db_xref="GOA:C7MU14"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU14"
FT                   /protein_id="ACU95542.1"
FT                   /translation="MPKQINFDEVARRSLERGVNKLADAVKVTLGPSGRHVVLDKKFGG
FT                   PTVTLDGVTVAREVELEDPFENLGAQLAKNVATQTNDVAGDGTTTATVLAQALVKVGLR
FT                   NVAAGANPTALGRGIQAAADKVVELLKSRATPVKGRDNIAQVGTVTSRDPDIGAMLGEA
FT                   VEKIGEDGVITVEESSTLATELDITEGVQFDKGFISAHFATNAEEQRAILEDAYVLLHR
FT                   EKISALADLLPLLEKVAEAKKPLLIIAEDVEGEALSTLVVNALRKTLTTVAVKAPFFGD
FT                   RRKAFMDDLAVVTGAQVVSSEVGLKLSEVGLDVLGKARRIEVTKDTTTIVDGAGTKEDI
FT                   NARIAQIRQEIETTDSDWDREKLQERLAKLGGGVAVIRVGAATETELNERKHRIEDAVA
FT                   STKAAVEEGIVPGGGSALAHIAKELDDLGYTGDEATGVRIVREALTAPLYWIATNSGHE
FT                   GAVLVAKVQEREWGEGLNAATGEITDLLKAGIIDPVKVTRSAVANAASIASLVLTTESS
FT                   VVEKPEEENEAGHGHAH"
FT   gene            complement(460027..460329)
FT                   /locus_tag="Svir_04680"
FT   CDS_pept        complement(460027..460329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04680"
FT                   /product="Transcription factor WhiB"
FT                   /note="PFAM: Transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95543"
FT                   /db_xref="GOA:C7MU15"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU15"
FT                   /protein_id="ACU95543.1"
FT                   /translation="MADTRRLPGPNADVWDWQLEGACRGMDSGSFFHPDGERGPARARR
FT                   EARAKAICHTCPVLEMCREHALTVHEPYGIWGGLSESERETIIRSQKRALTLTSR"
FT   gene            460626..461519
FT                   /locus_tag="Svir_04690"
FT   CDS_pept        460626..461519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95544"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU16"
FT                   /protein_id="ACU95544.1"
FT                   /translation="MASVENALRIAAFGEPEVVDERCSLRFLASAAGSGPRCRWLAAVV
FT                   LGACGRYAAATTLLEPLIRDRDVVVASLAASTLASHRRQLGGHALALSLDGLAVRKAVE
FT                   ALSGRWDGDGDPDGLDVYGALVDGLVGLAADNLGLGRLATAEVLLARAARVAAVGGCWR
FT                   AEARLGWVRAELALASGGVADSVSPAKRAREVARERGSVRHVVKSELILGAALGAMGEQ
FT                   ENGKQATKLVTNALTTARRYGWRSLIWPAQLLLFDLDVSLADWKGSKVTNELKELLGFT
FT                   DPVGSRLAQASPWVPI"
FT   gene            461660..462256
FT                   /locus_tag="Svir_04700"
FT   CDS_pept        461660..462256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04700"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95545"
FT                   /db_xref="GOA:C7MU17"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU17"
FT                   /protein_id="ACU95545.1"
FT                   /translation="MTTVLICDDRRSVREGLTRVMSAVPGVSRIDCVAHGDELLARYSR
FT                   QPVDVVLVGTQRAVPTGVEATRRLVSANPQANVIVFGAPDDAGSIAAAIAGGARGYLRW
FT                   DASRPELVAALAHTLASTSVPAPRQPSDPGVQLTERELQVLRGMSQGKSNGQIGRELYL
FT                   SEDTVKTHARRLFRKLGVRDRAQAVAHGFRRGLVA"
FT   gene            462615..463187
FT                   /locus_tag="Svir_04710"
FT   CDS_pept        462615..463187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04710"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95546"
FT                   /db_xref="GOA:C7MU18"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU18"
FT                   /protein_id="ACU95546.1"
FT                   /translation="MTNVGDGLDESVAAAVEGDPQAVERLLAAIRPLVVRYCRARVGRQ
FT                   ERSFTSADDVAQEVCLAVLTALPSYRDQGRPFLAFVYGIAQHKVADAHRAASRNRAEPV
FT                   ADIPDEIEGDIGPEQRALRGELNERMSQLLQVLPEKQREIVVLRVVVGLSAEETAEAVG
FT                   STPGAVRVAQHRALARLRKALAAEEVV"
FT   gene            463187..464185
FT                   /locus_tag="Svir_04720"
FT   CDS_pept        463187..464185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95547"
FT                   /db_xref="GOA:C7MU19"
FT                   /db_xref="InterPro:IPR031928"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU19"
FT                   /protein_id="ACU95547.1"
FT                   /translation="MTERDGVGGDNHETEFETDALGTDETPADSADSADPVHRAQSSAF
FT                   AGDDAGMVDLSAIQADDALLDALGAADSRVDDELGNQELSALLLAWRRDVDSEAIPELV
FT                   DTQSAVTTVKTAVAARNGRGRGRRRMLVPVAAAAAVLAIGFTGTALAARSAEPGDTLWG
FT                   LSKVLYSDHARSVEAAASVRTDLDAAHLAIAQERYGDARRALEEAEAALSEVTGEDELA
FT                   RLRARHMELMAQLEEPGQSEPEHTSPASSSSSSSSSGSRTSTTPGKPHESSQDDVPPEL
FT                   DETSSIPTTEPSTSPTDSTTPSTPPEESPTEDGSDSRSDTSRTEETSGLIG"
FT   gene            complement(464245..464625)
FT                   /locus_tag="Svir_04730"
FT   CDS_pept        complement(464245..464625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95548"
FT                   /db_xref="InterPro:IPR035165"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU20"
FT                   /protein_id="ACU95548.1"
FT                   /translation="MLPPDPFADDPNDPAKEFAAFDEPPAEPLSPEERSELLTDLSDLT
FT                   VYQALLEPRGIRGIVVDCMECEQPHYHDWHLLRASLEQLLTDGQMRPHEPAYDPNPAAY
FT                   VTWEYCRGFADGITATENENAR"
FT   gene            464748..466292
FT                   /locus_tag="Svir_04740"
FT   CDS_pept        464748..466292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04740"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /note="PFAM: IMP dehydrogenase / GMP reductase domain;
FT                   TIGRFAM: inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95549"
FT                   /db_xref="GOA:C7MU21"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU21"
FT                   /protein_id="ACU95549.1"
FT                   /translation="MTSDTVHTGLSPSEQGEAGGAPDKFAMLGLTFDDVLLLPAESDVI
FT                   PSGVDTSTNLTRNIRLNIPLVSAAMDTVTEARMAIAMARQGGLGVLQRNLPIEEQAQAV
FT                   EVVKRSESGMVTDPVTCSPDDTLAEVDELCARFRISGVPVTDASGTLVGIITNRDMRFE
FT                   VDYSKPVREVMTKAPLVTAQVGVTADAALGLLRRHKVEKLPIVDGDGKLRGLITVKDFV
FT                   KTEQYPLATKDPDGRLLVGAAVGVGEDGHQRAMALVDAGVDVLMVDTAHGHSRAVVEMV
FT                   ARLKKELGDTVDVVGGNVATRAGAQALVDAGADAVKVGVGPGSICTTRVVAGVGVPQIS
FT                   AIYEADKACRPAGVPVIGDGGIQYSGDIAKAIAAGASSVMLGSLLAGTEESPGELILVN
FT                   GKQYKTYRGMGSLGAMRSRGGGRSYSKDRYAQDDVLSEDKLVPEGIEGRIPFRGPLAGV
FT                   VHQLVGGLRSGMGYAGAATIAELQKAQLVRITSAGLKESHPHDVTMTVESPNYTTR"
FT   gene            466422..467555
FT                   /locus_tag="Svir_04750"
FT   CDS_pept        466422..467555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04750"
FT                   /product="IMP dehydrogenase family protein"
FT                   /note="PFAM: IMP dehydrogenase / GMP reductase domain;
FT                   TIGRFAM: IMP dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95550"
FT                   /db_xref="GOA:C7MU22"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU22"
FT                   /protein_id="ACU95550.1"
FT                   /translation="MRDLVEIGMGRTARRAYDFDDIDIVPSRRTRSSKVVSTAWQIDAY
FT                   RFDLPLVTHPTDAVVSPDTAVSIGRLGGLGVLNAEGLWARHADAEQALARVVDLARKGA
FT                   DWAELGALLQELHAAPIQPELLTEAIRTVRDSGVTVAARVSPQHAAELTPILLSAGVEV
FT                   LMVQGTIVSAEHVARDDDPLNLKEFISNLDVPVIAGGVSDYRTAMHLMRTGAAGVIVGH
FT                   GHTPGVTSTDRVLGIGVPMATAVIDAAAARRDYLDETGGRYVHVLADGGMTCSGDIAKA
FT                   IACGADAVLLGAPLAATREAPGKGLYWTAAAAHPSLPRSRVAPGPNRDVDLKTLLHGPS
FT                   SDPEGVVNLFGALRRAMAKTGYSDLKEFQKVELTVRA"
FT   gene            467652..469340
FT                   /locus_tag="Svir_04760"
FT   CDS_pept        467652..469340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04760"
FT                   /product="choline dehydrogenase-like flavoprotein"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95551"
FT                   /db_xref="GOA:C7MU23"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU23"
FT                   /protein_id="ACU95551.1"
FT                   /translation="MDYDVVVVGSGFGGSVAALRLTEKGYRVAVIEAGRRFADDEFAKT
FT                   SWDLRRYLWAPRLGCFGIQRVHLLKDVMVLAGAGVGGGSLVYANTLYRPLKPFYTDRQW
FT                   AHITDWEAELAPYYDQASRMLGVVTNPTVTPSDEVMRKVAADMGVEDTYHPTPVGVYFG
FT                   EPGRTVSDPYFGGIGPERTGCTECGACMTGCRVGAKNTLVKNYLYLAERNGAKVIPLTT
FT                   VTAVRPRGDGTFEVDIRKTGTSSRRFRHTLTAGHVVLAAGTWGTQRLLHDMRDKGVLPR
FT                   LSARLGELTRTNSEAIVGAGRPTVDPENDYSRGVAITSSIHPDENTHIEPVRYGKGSNA
FT                   MSLLQTIATDGSSPVPRWKQALRFVCKHPIQTLRLLNGYRWSERTVILLVMQSLDNSIT
FT                   TYTKRGWFGRRKYTSKQGHGKPNPTFIPAGHKANQLTAKHIDGVAGGTWGEIFNIPLTA
FT                   HFIGGAPIGTDPDNGVIDPYHRVFNYPNLHVVDGAAITANLGVNPSLTIAAQAERAFSF
FT                   WPNKGEADPRPDQREGYKRIAPVAPKNPVVPADAPGALRLPITPK"
FT   gene            469455..470999
FT                   /locus_tag="Svir_04770"
FT   CDS_pept        469455..470999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04770"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /note="PFAM: tRNA methyl transferase; GMP synthase C
FT                   terminal domain; Glutamine amidotransferase class-I;
FT                   TIGRFAM: GMP synthase (glutamine-hydrolyzing), N-terminal
FT                   domain or A subunit; GMP synthase (glutamine-hydrolyzing),
FT                   C-terminal domain or B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95552"
FT                   /db_xref="GOA:C7MU24"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU24"
FT                   /protein_id="ACU95552.1"
FT                   /translation="MADGPVLVVDYGAQYAQLIARRVREAQVYSEVVPHTTPVAEILER
FT                   DPAAIILSGGPASVYADGAPGVDPVLFDAGVPVFGICYGFQVMAKALGGTVEHTGTREF
FT                   GRTELEVVGGTLHEGLPTRHPVWMSHGDCVTEAPEGFEVTASSDGAPVAGFENLERRLA
FT                   GVQYHPEVAHSPHGQEVLRRFLHDIAGVRPNWTTASIVDEQVERIRAQIGDGHAICGLS
FT                   GGVDSAVAAALVQRAIGDRLTCVFVDHGLLRAGERAQVERDFVAATGVKLVTVDASERF
FT                   LSALAGVTDPEQKRKIIGREFIRVFEQAARDVKAAGDVEFLVQGTLYPDVVESGGGAGT
FT                   SNIKSHHNVGGLPDDLQFTLVEPLRMLFKDEVRRVGLELGLPETIVHRQPFPGPGLGIR
FT                   IIGEVTAERLEILRAADAIAREEMSAAELDSDIWQCPVVLLANVRSVGVQGDSRTYGHP
FT                   VVLRPVSSEDAMTADWARLPYDVLERISTRITNEVADVNRVVLDVTSKPPGTIEWE"
FT   gene            471028..471810
FT                   /locus_tag="Svir_04780"
FT   CDS_pept        471028..471810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95553"
FT                   /db_xref="GOA:C7MU25"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU25"
FT                   /protein_id="ACU95553.1"
FT                   /translation="MWIVGVVLLIVAVVAFFYMKHTRSELHAMIGTETLSIPQLEQYRQ
FT                   ASDEVGGRGAFRKTAEVVGAAHPGPHGPLKAELSKTECVWYRYRIDRHYEVIEYRDGKR
FT                   HRRKRTERVAEHTSAQNYAVIDEEGRTIGVDPNGTKPDSVEQTVSRFEPHRGNSQSIEL
FT                   FGFKLPTMLGRGDSTIGYDYKEWVIRPGQRLYILGEVHDRFGPLMIGKPAQGGHFIIST
FT                   RTEEELRASRVKRHKLLAITVITSFVLGWVLLIADLLR"
FT   gene            complement(471827..472051)
FT                   /locus_tag="Svir_04790"
FT   CDS_pept        complement(471827..472051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95554"
FT                   /db_xref="GOA:C7MU26"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU26"
FT                   /protein_id="ACU95554.1"
FT                   /translation="MSDHNDPQSRKPSRTVDVPTLLLGVATLLVSVYLLTDADVWLAHV
FT                   DLRWVLAGAAVAVGLLMLVMSMRPRKDKS"
FT   gene            complement(472044..473300)
FT                   /locus_tag="Svir_04800"
FT   CDS_pept        complement(472044..473300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04800"
FT                   /product="putative stress-responsive transcriptional
FT                   regulator"
FT                   /note="PFAM: PspC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95555"
FT                   /db_xref="GOA:C7MU27"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU27"
FT                   /protein_id="ACU95555.1"
FT                   /translation="MLFGMNTTSNTSKQLEGFEETVKDFWVSRPRRPAHGRKLAGVAAG
FT                   IGNRYGVDPTVIRVLFVVLAVFNGIGLPLYLLGWLFFAEEDDEVSGVESLFGQGRSSMS
FT                   KGFALFLCIALIPASGWAFEGSWIDGSALIGAALVAAGLYLLHRSRGQFRRPVPTIPTA
FT                   MRSTSAGTNGGTGVWGPSVSQVSPTWDALGADPLGWRLPDPVTPAPPPPPAPPRRNSKV
FT                   GFATTGVALAVGGAGTALAVTGVPWFTPVHVVGLVLAVLALGMLVGSFFGGGRGLAWLA
FT                   TPLALVGIAASVVPVNYVGGGVGELTATPRSVEQVQPVYERTVGEVELDLTELTGTDPV
FT                   ETTVRTGVGNVIVRVPADAEVTYRCETSAGTMSCFDQVQSGIDVPEITGVHRGTGGEDG
FT                   LKITVTAHAVVGNVEVFHE"
FT   gene            473430..474875
FT                   /locus_tag="Svir_04810"
FT   CDS_pept        473430..474875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04810"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: PspC domain; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95556"
FT                   /db_xref="GOA:C7MU28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU28"
FT                   /protein_id="ACU95556.1"
FT                   /translation="MEEQRTDEHAPRTKVMSAEGADAFADPSSTQAKAAADPGTGVSSG
FT                   ASRSGDSGAMGEPDDQPKMYRRRTGRVLAGVAGGLADHLGVNVLWVRATFAVLSAFGGM
FT                   GVVIYGMLWAFVPQRSGDEATAPESAKERQQAYGLIALGIGLTFAGGALTGVFGGWVGV
FT                   PLAAALVGAAVVWREADESQRSRWRDGARSGVTGLFGDGGVRAVVRVLAGSALVITGIG
FT                   VVVFRGGSFDQVQFALIAVVATLVGVAVLTVPFWLRMVRDLGEERRARIRTEERAEIAA
FT                   HLHDSVLQTLALIQKQADSPREVARLARSQERQLRQWLYGPSGYGVSRSGADTSGTETQ
FT                   HRARTLSETLAEACGEVEDAFAISVQHVVVGGEVEVDERLTALVQAAREAIVNAAKHAG
FT                   VDEVSVYAEVEPESVTVFVRDRGKGFDPDAVPADRHGLADSIRGRMERNGGRCRLRTAP
FT                   GEGTEVQLEVPRRAADRSAQGAT"
FT   gene            474872..475561
FT                   /locus_tag="Svir_04820"
FT   CDS_pept        474872..475561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04820"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain protein and an HTH DNA-binding domain
FT                   protein"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95557"
FT                   /db_xref="GOA:C7MU29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU29"
FT                   /protein_id="ACU95557.1"
FT                   /translation="MTTSEQKDEQQGRKPVTVFLVDDHALFRAGARTELESVSDEVRVV
FT                   GEAGSVAEAVAGIRRTRPQVVLLDVHMPDGGGAEVLRRVRPELPDVVFLALSVSDAAED
FT                   VIAVIRAGARGYVTKTISSRELVSAVMRVADGDAVFSPRLAGFVLDAFADRPGSEPIND
FT                   PDLDLLTPRERDVLRLLARGYAYKEIASELFISIKTVETHVSSVLRKTQLSNRYELSRW
FT                   ASDRRLV"
FT   gene            complement(475644..476594)
FT                   /locus_tag="Svir_04830"
FT   CDS_pept        complement(475644..476594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04830"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95558"
FT                   /db_xref="GOA:C7MU30"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU30"
FT                   /protein_id="ACU95558.1"
FT                   /translation="MKDTEGALVGERYRLDQPIGRGRAGLVWLAFDTMLHRTVAAKRAY
FT                   LNPERDPEQARQETLAAAKRAMKVVHPSAVTMYDALRQDDDVWLIMEYVPSRNMAEFLY
FT                   EYGTLTPEQAGYLGAALGAALASAHNSGVIHGAVEPGNVLLADDGGVKLTDIGVHGGAT
FT                   EPAYLAPELKRGGAPTEQSDAYALGAVLFRAVEGIPPFGQEGNDAPVVPTRTGPLTGAL
FT                   EKLLRTDPDLRPTLADTVNALRAVSKGRQTGFVPPTAPAMPTVPVMPRPPRVVPASATP
FT                   GSAGAASASSSKRLLPWALAALALLVLAVLVVVVL"
FT   gene            complement(476648..478375)
FT                   /locus_tag="Svir_04840"
FT   CDS_pept        complement(476648..478375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04840"
FT                   /product="protein kinase family protein"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95559"
FT                   /db_xref="GOA:C7MU31"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU31"
FT                   /protein_id="ACU95559.1"
FT                   /translation="MSDEGRLVAGRYRIIRRVGTGAMGAVWQAHDEVLHRTVAIKQLLL
FT                   QPGLDEHEAEDARQRTMREGRIAARLHHPNAITVFDVVTDDNGQPCLIMEYLPSTSLAQ
FT                   ELQRHKTLPPVEVARIGAQVASALKEAHAVGIVHRDIKPGNILLADNGVVKITDFGISR
FT                   ATDDVTVTKTGMIAGTPAYLAPEVAVGGTPGPESDVFSLGSTLYAASEGEPPFGLSENT
FT                   LGLLHAVAAGQINPPRRSGPLTSVLAVMLHPDVNHRPTAQECEELLAAVARGETPLGGP
FT                   SDGADGGSTTAVLGTAGAVGGAAAAHRSEGHAGHLDDGYDDYDEYDRYDDEYDRYDDGY
FT                   YDEDPPTSRQPHDTYDRYEGPDPTAVAPSPAATRAMPMGDAAHDRYDDYDRYDDYSDYD
FT                   DYDEVYDGRAHKDHGGHDDRPPAVSTAPDDEEKGNWKLPAVIGAAVVVGMVAFVIWVFG
FT                   SSGGGDGSSEVPADQPQTTESSSTTTSETSTTTTTEEVVETTEFIPPNPDQGGPAPNDP
FT                   LPSDPGSDSSSTRDTTTDTPPTTTDTSEEPTDTDGPSETSTTPPEDPPSDPGGGGGTP"
FT   gene            complement(478544..479425)
FT                   /locus_tag="Svir_04850"
FT   CDS_pept        complement(478544..479425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95560"
FT                   /db_xref="GOA:C7MU32"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU32"
FT                   /protein_id="ACU95560.1"
FT                   /translation="MHDRHQSGQEPTVVVDNPSDAGLPFEALVEDTSSDDLGAYGCEST
FT                   ETDPDEFDEKSPVDEPENAFARRAKLIALLVATAALVVSVVVASIITSSADEAAPPIQE
FT                   HRITGVAALGGFALPSSTDQRETGSDAAPTADLVEDPPSSDPTTRHTDPAGESVSAVPV
FT                   STDSGPRSAPGTRGPDVAALESETTAAHRTDHTEMVRDFYSRVAAAPETALELVTSDLV
FT                   ADQREYLLSAWRSMTDIVVKHVRQVSEDSVHVVVTVKTAHGNPVRITQLLSFSDGPQPF
FT                   INHAALLSIRAL"
FT   gene            complement(479685..480872)
FT                   /locus_tag="Svir_04860"
FT   CDS_pept        complement(479685..480872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95561"
FT                   /db_xref="GOA:C7MU33"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU33"
FT                   /protein_id="ACU95561.1"
FT                   /translation="MGTNDTSDASRHTGEPSDIGDHGGTGDSEPDTRPISVVSPRAVSR
FT                   HRPAPGRWTPSARGGYASHARTEPIPPVSQLSGSIEVEFTASQGVLSVPDDEAEEVTRE
FT                   PVVRRTKVVLTAPSDKPRTPRDEDTRVYAAPPGGLGKFDLGSVPASVTPPRTWRRAAWF
FT                   SGAASGAAVVAMLLAGTALVSDPAEDAQALDRWPDHHSAPPSVMPDHGGNGATRTDEND
FT                   DRSVGRGENGERGAESTGPTITSSSSGTTSVSAAGRTVDTGPGTTDNGIAASSTRPQKP
FT                   PITPATTDAARVALWAPHDTDTLAQRSQDYFNTVTEDPEAAHAMTTGELAAAGPEGLAD
FT                   KYADVAYFEVREVYVDASEGYTLNTVDVTYVDGSREQQTRKLVFGTDDRIEADVV"
FT   gene            complement(481183..481494)
FT                   /locus_tag="Svir_04870"
FT   CDS_pept        complement(481183..481494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95562"
FT                   /db_xref="GOA:C7MU34"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU34"
FT                   /protein_id="ACU95562.1"
FT                   /translation="MDIINIIAVVIAIASLLATLAHVGYLAMLNSAANKRAGGGPIAEY
FT                   VRSRWPIAGGSTAGAVLALLFTAGGTGMDILAILIAAVSGTVGMKALQSTQARYRSGS"
FT   gene            complement(481635..481922)
FT                   /locus_tag="Svir_04880"
FT   CDS_pept        complement(481635..481922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04880"
FT                   /product="monofunctional chorismate mutase"
FT                   /note="PFAM: Chorismate mutase type II; TIGRFAM:
FT                   monofunctional chorismate mutase, high GC gram positive
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95563"
FT                   /db_xref="GOA:C7MU35"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010958"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU35"
FT                   /protein_id="ACU95563.1"
FT                   /translation="MNAQAHSTDSPGPTTTENIDELRKEIDWLDSEILRLVKRRAEVSQ
FT                   TIGRVRMAAGGPRIVYNREMDVLARYRELGPEGRQLAMALLNLGRGRLGR"
FT   gene            482137..484590
FT                   /locus_tag="Svir_04890"
FT   CDS_pept        482137..484590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04890"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="PFAM: UvrD/REP helicase; TIGRFAM: ATP-dependent DNA
FT                   helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95564"
FT                   /db_xref="GOA:C7MU36"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU36"
FT                   /protein_id="ACU95564.1"
FT                   /translation="MSTLFDLPPESAGGGVSHGPLLDDLNPAQRAAVEHQGRPLLIVAG
FT                   AGSGKTRVLTRRIAYLLAARGVHPGQIMAITFTNKAAAEMRDRVVDLVGGRAGAMWVST
FT                   FHSMCVRLLRREAKTLELTSNFSIYDADDSRRLMALVGRDLELDPKRYSARALANHVSN
FT                   LKNELIDPDAAADAAANDFERRAAEAYREYQNRLAQANALDFDDLIARTVELFQAFPDV
FT                   AEHYRRRFRHVLVDEYQDTNHAQYTLIRELVGTGPTESGLPPSELCVVGDADQSIYAFR
FT                   GATIRNIEEFERDFPDARTILLEQNYRSTQTILSAANAVISRNPGRREKRLWTDAGQGE
FT                   RIVGYVADSEHDEAAFVAEEIDALVDRGEAKYSDVAVFYRTNNQSRVFEEIFIRLGLPY
FT                   RVVGGVRFYERKEVKDALAYLRVLANPEDTVSLRRILNVPKRGIGERAEAVVATHAERE
FT                   RISFASALRDAVAGRIPLLNPRSQKAITAFVELIDGLRELVDEGTDVADVLEAVLDRTG
FT                   YRAELEGSDDPQDASRLENLDELVTVAREFTEFARSVGEDTGTSEDTDVATDFEDADVA
FT                   EPGSLSAFLERVSLVADADSVPSPDGEGADEADEDGVVTLMTVHTAKGLEYPVVFCTGW
FT                   EDGVFPHLRALGEPKELAEERRLAYVAITRAQRRLYVSRALVRNAWGQPMSNPASRFLD
FT                   EIPAELVDWRRLAPSGTQRETGTPRAVTTWGRGVGTGVTSSGVRTTSFQAASRGARSSR
FT                   PNESWKNKVPLKLDVGDRVNHDKYGLGTVVATEGVGPRTTATIDFGSAGTVRLMLIGNV
FT                   PMVKL"
FT   gene            complement(484870..485577)
FT                   /locus_tag="Svir_04900"
FT   CDS_pept        complement(484870..485577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04900"
FT                   /product="metalloendopeptidase-like membrane protein"
FT                   /note="PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95565"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU37"
FT                   /protein_id="ACU95565.1"
FT                   /translation="MVAAVAAGAFAAAAAGQTLQTPNNSPQQRHTDVTPLANASDASAS
FT                   LNSGGASGVGGDAPAGSPVLLQVSHSVDASAEAQKLTESAEVTEKRLEREAEERRRAEE
FT                   EAKRPKFVAPAQGVFTSGYGARWGGTHYGIDIANSIGTPIVAAADGTVIEAGPASGFGL
FT                   WVRIQLDDGTIHVYGHMESFSVQVGQRVKAGEQIAIIGNRGQSTGPHLHFEVHENGQKV
FT                   DPQAWLAARGVYI"
FT   gene            486169..488031
FT                   /locus_tag="Svir_04910"
FT   CDS_pept        486169..488031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95566"
FT                   /db_xref="GOA:C7MU38"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU38"
FT                   /protein_id="ACU95566.1"
FT                   /translation="MTTASTQVDSPRTEAITRRQPLLAALVVAALGAVMSVVGAVAPAL
FT                   DGASRGFPSAPLLAVLAVVPVAVAFLLLLRSRFGMAAGVLMGAATLAPAAVVLDLQLLV
FT                   DPSAASRPELYFPRDLSLPSPSIGLWALLAGHGFALVAGVVALAVSRQEPGSAFDDTGA
FT                   RGIEGDSGGSDDSAAWRRRSVLLAFLIAVVGACGLLMAPFHSSDLYLLARNAFEGPAVE
FT                   LVGRVLSAATLSAGAVLLVVVPREVTVAGGGLLGLALALAAWGVPPLAAALSMTSLDIA
FT                   VGPCLVVAAVLGLLFVATRHATDVTVSSTSPKGTRLPGGRKLELATGVFASVTGASAVL
FT                   GAVLPQLTAIGSADAPESPARWLLLAAGGVIGLLGLAMFVTRVATAVRPVLSVAWVGVP
FT                   LAATAVLDTALTTGYTSTTFSPTQYGSPVDGLDSLGFGPFSSGPGAVWAWLAMVGAVVT
FT                   ACCSVVAGVVEREDAEDAAADEVSGEDGNGIPDGVTTVGLRMLIPLTAAAVLAIAAFGT
FT                   PLVTAPEYVEPGLWSDVGTPTWGLAAAVLVIVGACVLATRSRPARAAALLAGVACVVGL
FT                   RAATAPLVGGEIDGSAAGLGLWFSLAALAALAGAGAVAMTGRRA"
FT   gene            488239..489408
FT                   /locus_tag="Svir_04920"
FT   CDS_pept        488239..489408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04920"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="PFAM: CoA-ligase; ATP-grasp domain; TIGRFAM:
FT                   succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95567"
FT                   /db_xref="GOA:C7MU39"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU39"
FT                   /protein_id="ACU95567.1"
FT                   /translation="MDLYEYQAKELFAAHGVPVLPGTVVSEAEEARRAAEEIGGQVVVK
FT                   AQVKTGGRGKAGGVKLAADPDEAAEKARAILGLDIKGHVTRRVLVTEASEIAEEYYFSF
FT                   LLDRANRTFLAMASAEGGMEIEQLAAERPEALAKVPIDPLTGVDLDKAREIVTKANFPE
FT                   VVREKAAEVIVKLWETFVSEDATLVEVNPLVRDPKDEIIALDGKVTLDDNAAFRQPKHA
FT                   DLVDVEAEDPLEAKAKAKGLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVRPA
FT                   NFLDIGGGASAEVMAAGLEVILGDPDVKSVFVNVFGGITACDAVANGIVEALKILGDNA
FT                   TKPLVVRLDGNNVEEGRRILTEAAHPLVTLVDTMDSAADKAAELAAAGA"
FT   gene            489414..490301
FT                   /locus_tag="Svir_04930"
FT   CDS_pept        489414..490301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04930"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="PFAM: CoA binding domain; CoA-ligase; TIGRFAM:
FT                   succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95568"
FT                   /db_xref="GOA:C7MU40"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU40"
FT                   /protein_id="ACU95568.1"
FT                   /translation="MSIFLNSESKIIVQGLTGSEGSKHAAKMLAAGSNIVGGVNARKAG
FT                   QTVTIGGKDLTVFGTVEEAMKETGANVSVIFVPPKFAKDAVIEAIDAEIPLAVVITEGI
FT                   PVHDSAAFWAHACAKGNKTRIIGPNCPGIISPGQSNAGIIPADITGPGKIGLVSKSGTL
FT                   TYQMMYELRDIGISTAVGIGGDPIIGTTHIDALEAFQADPETELIVMIGEIGGDAEERA
FT                   AEYIKANVTKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAQAKKEALEAAGVKVGKTP
FT                   TETAELARELYKAL"
FT   gene            490521..491324
FT                   /locus_tag="Svir_04940"
FT   CDS_pept        490521..491324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95569"
FT                   /db_xref="GOA:C7MU41"
FT                   /db_xref="InterPro:IPR035166"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU41"
FT                   /protein_id="ACU95569.1"
FT                   /translation="MTFPSSTPGGFPAQGPQQPHQPYPGAPSTGRPSLSLPQILLLATG
FT                   GLGVLNLFLGFANRTFDVSFYEGSFGWVPALLFIAGLTAVFGFLPGEQKPGPWPAVLSV
FT                   GVMLPYLFSVFQGDSLKAGGILVLVFGILQMGAAVAAYLFEAGIVKAPAPQAQSPYGQS
FT                   PYGQQPYQYGQQQPQSQYGQQSAGFGQPQSQPQPQSQPQSQYGQQSSSESSGGFAAQPA
FT                   NFSQPMQQPTQYAPQQGQFFQQPSTDSEQSEQKSDQQNTSGQSGN"
FT   gene            491459..492667
FT                   /locus_tag="Svir_04950"
FT   CDS_pept        491459..492667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95570"
FT                   /db_xref="GOA:C7MU42"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU42"
FT                   /protein_id="ACU95570.1"
FT                   /translation="MGRFTAFMSGLTVREGDAMRSGRARVLFGAALGPIVTGYAAVASL
FT                   LVVVATLASRSEFSAGGVLAAACPGWLAAYQVPLDIGGAPLGVLPMLPTLGVLLLVFRT
FT                   AASATRRLDEVTGDRSGRLSSAVSVVGTVVGAHALFAALAFGVSAGLVAEGQFPAAIVT
FT                   PTVLAGGAAALGAASASSAGWLERLDPVAVRGMRAGLIGFGVLFVVGTLVFVVATVAAW
FT                   PTVGELVSAYSPESGSAVGMSLLSLGYVPNMSVLAASVLTGGGFSIGEVSVSAFAMTSG
FT                   PVPAVPVLAGLPPEYGAWWPLLLVVPASIGAGVGWSLRAVDGRVNARLRAVLVAGIVCG
FT                   FCAVVVSAFAGGALGGGPYDPVVVRAEVFSVTTFAFVVVPGGVVAWLTGPGRQPRRTPR
FT                   RRR"
FT   gene            492757..493374
FT                   /locus_tag="Svir_04960"
FT   CDS_pept        492757..493374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04960"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95571"
FT                   /db_xref="GOA:C7MU43"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU43"
FT                   /protein_id="ACU95571.1"
FT                   /translation="MQLPVPVKLVVLASGSGTLLQAVLDAVGDDGFPAEVVAVGADREK
FT                   IQALERAERAGVPTFIVKTGDYPDRAAWDKALTEAVAAHRPDLVVSAGFLKILGPEFLA
FT                   RFPNRVINTHPALLPAFPGIRAVADALELGAKVTGSTVHFVDAGVDTGPIIAQEAVVVE
FT                   PEDDEETLHERIKAVERRLLVDVIAKLARVGCTVDGRKVRFS"
FT   gene            493371..494978
FT                   /locus_tag="Svir_04970"
FT   CDS_pept        493371..494978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04970"
FT                   /product="IMP cyclohydrolase
FT                   /phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /note="PFAM: AICARFT/IMPCHase bienzyme; MGS-like domain;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95572"
FT                   /db_xref="GOA:C7MU44"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU44"
FT                   /protein_id="ACU95572.1"
FT                   /translation="MSERTPVPGQRPVRRALIGVSDKSGLLELATGLHAAGVEIVSTGG
FT                   TAKVIADAGVPVTPVEEVTGFPESFDGRVKTLHPRVHAGLLADTTREDHVEQLRSLDIA
FT                   PFDLLVVNLYPFASTVASGATPEECVENIDIGGPAMVRAAAKNHASVAVVVDPSRYDWV
FT                   LQRVREGGFGLAERKRLAAEAYAHTAAYDVAVASWFASSYAPADEVDTTEGATAVEFPD
FT                   FLGSTWQRHAVLRYGENPHQRAALYRDSTPSGLAHAEQLHGKEMSYNNYVDTDAARRAA
FT                   FDFSEPAVAIIKHANPCGIAVGVDVAEAHRKAHACDPLSAFGGVIAVNRPVTLELAEQI
FT                   AEVFTEVVLAPDFDAEALEVLRQKKNIRLLRLPEQAHAHTDAKELRPISGGVLVQTVDR
FT                   IDAEGDDPANWTLATGDPVDADTLADLAFAWRAVRSVKSNAILLAHQQATVGIGMGQVN
FT                   RVDAARLAVNRAGDRAKHAVAASDAFFPFPDGLQVLLAAGVRAVVQPGGSVRDAEVLAA
FT                   AEAVGATVYHTGTRHFTH"
FT   gene            complement(495376..497886)
FT                   /locus_tag="Svir_04980"
FT   CDS_pept        complement(495376..497886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95573"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="InterPro:IPR036170"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU45"
FT                   /protein_id="ACU95573.1"
FT                   /translation="MAQPTQLNATEQDTLVKQIGLSLLRAAPRDWRRVTVEYRAVGKYH
FT                   ELTGEVALADGTTQEWTATHDIASLFGRLRTGMYREGRGTWFNARYQLDHPSSYNLEYD
FT                   REEPNWDLAPPPQAYADELRMFPRTEENVPDWLMRRMAGLGPERPGPRFRMARVFDGVG
FT                   AGGHPVVNRPELDVEEQDKLLDYLDGAPVVVPGRGLDLDRLANPPESAVPIAFHSDGTW
FT                   IWPAAVNYYLRKYGVAPEPELVQHIRANGFTIPDVPDAVRQAAAAHVSRGGPPPPLPQR
FT                   PVPPAPGQERAPEQPEPTPPAPVEHAQEPQRPYEEEPPESDAERTRLAAPVSAPPQDYE
FT                   PERRGEPHDAQHFGESDAERTRIAAPPQFAEDERHAEDARYDEQEYAEEPYEEDYRDER
FT                   YEGDRYERQDQEGYEHRPYRDEAYEHREYEERGYEDDRSDGPPHSEHPADAATTYTPVA
FT                   ALHDGPPTTITPPPQPATAPPTPEGPDRGQSPDRRPEPAEQPEPARAQDGRDDGHDDGG
FT                   PPTEYSPGPLVYDEPVLEDLQDRLDELGVPEWSYRIGEPAEQGWALEEVGEGWRVGRYD
FT                   DKQLTSPAVFGDVEDAAAFMLGKLLLTSEHDTTRPQGSLVPPPQTGDLPQRQLPPQQER
FT                   PVPPQHVTATLSSDVATGTRPPTPPEPMGEQRVPSPHEEQGVHSPQPPQGGPAPVPPPP
FT                   PRRDVPRPAEPATQSRNGQAGKGSQQWPIQPLPGEPPLTLFRGKEMRDLPVGSELDRFG
FT                   SPSGNLTYAAGTPFEERSLVPEWVNRPYHVYRVQRPLRVLAGVAIPWFNQPGGGAAYLL
FT                   PASIEELLAEGDLIELEPGEPPID"
FT   gene            498131..499087
FT                   /locus_tag="Svir_04990"
FT   CDS_pept        498131..499087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_04990"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function, DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95574"
FT                   /db_xref="GOA:C7MU46"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU46"
FT                   /protein_id="ACU95574.1"
FT                   /translation="MAGLVIAVIAGLGMAIQSRVNGELSTRLGDVVLAAVISFGTGLLL
FT                   LLLLLACSSRMRSGLSHVVPALRAGLLRPWHFLGGLAGATYVLGQAGTVALIGVALFTV
FT                   GVVAGQTVSGLAVDKFGLGPAGRRAVTWPRTLGAVLMVGAVGVAVGGDLVDAELGRVWV
FT                   LVLPVLAGMGMAVQQAFNGRIGAVVDSPLTAALVNFTAGTTALVVAWLVSLVAFGATAP
FT                   TALPEDPVLYLGGVIGIVFITVAAVLVSWTGVLLFGLASVAGQLLGSVVVDHVVPATEE
FT                   GVGTSTLLGCAVALVAVVVAAMGGRRGGGRALEESPS"
FT   gene            499084..499938
FT                   /locus_tag="Svir_05000"
FT   CDS_pept        499084..499938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05000"
FT                   /product="methenyltetrahydrofolate cyclohydrolase
FT                   /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   catalytic domain; Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95575"
FT                   /db_xref="GOA:C7MU47"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU47"
FT                   /protein_id="ACU95575.1"
FT                   /translation="MTATILDGRATKDAIFAELTPRVSALTEQGRTPGLATVLVGDDPG
FT                   SHAYVKMKHADCAKVGINSIRRDLPSDISQEELFAVVDELNADPACSGYIVQLPLPKHL
FT                   DENAVLQRIDPAKDVDGLAPLSLGNLVLNEPGFRPCTPAGIIELLRRYEVPLNGAQVTV
FT                   VGRGLTVGRTLGLLLTRRDVNATVTLCHTGTRDLAAEVRRADVVIAAAGSPGLITPDMV
FT                   RPGAAVLDVGVSRVDGKLTGDVAPEVAEVAGFLAPNPGGVGPMTRAMLVSNVVEAAERT
FT                   VRR"
FT   gene            499935..500255
FT                   /locus_tag="Svir_05010"
FT   CDS_pept        499935..500255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95576"
FT                   /db_xref="GOA:C7MU48"
FT                   /db_xref="InterPro:IPR021385"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU48"
FT                   /protein_id="ACU95576.1"
FT                   /translation="MSGAVTTQDPRKPGRHRDSVLVHLPFAAVLALVAFGMLRIAMYHW
FT                   REGAVLIGGALLVAAVLRAALSHERTGLLAIRTRTVDVLSYAGLGLLILFTALTITGGP
FT                   LR"
FT   gene            500278..500793
FT                   /locus_tag="Svir_05020"
FT   CDS_pept        500278..500793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05020"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95577"
FT                   /db_xref="GOA:C7MU49"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU49"
FT                   /protein_id="ACU95577.1"
FT                   /translation="MSVLAAVAARLPGVSRVLTGKNHELLKFATVGAITFVIDNAVWYL
FT                   LKLTVLEDHPTTAKGVGILVATIASYVLNREWSFRTRGGRERPHEAALFFLVSAAALVV
FT                   NVTPLYVSRYVLGLHRPHVDLFTQEVADFFSGSVLGVGLAMVWRFWAFRRWVFPEDVSE
FT                   SPTGVPRP"
FT   gene            complement(500840..502132)
FT                   /locus_tag="Svir_05030"
FT   CDS_pept        complement(500840..502132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05030"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95578"
FT                   /db_xref="GOA:C7MU50"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU50"
FT                   /protein_id="ACU95578.1"
FT                   /translation="MPIALLALAIGAFGIGTTEFVLMGVLPEIAHDLGISISEAGNFIT
FT                   AYALGVVVGAPLLTAVAVRLARKTMLLSMMGVFIASNALFAFAPTPEVGMLFRFAAGLP
FT                   HGAFFGAGAVVAATLVGAQRRAKAVSMMFLGLTLANVIGVPAGTFLSQQVGWRATFGVV
FT                   ALIGVVALVSIAKLIPHQRPTSNVSLRGELGAFRKPEVWFALAIVTFGLGGGFASLSYV
FT                   APVLTDVAGFDGTSVTLLLSLAGLGMTFGNVIGGRLADRFPLTGLYGALTALAVVLLLF
FT                   TVTANSKIGAAVMLFLVGMTSFMVGPMMQSRIMEKAGGAQSMVSAAVQSAFNIANSIGA
FT                   YLGGLAIAGGFGLVSPNVVGAMLALVGLTLTVSSAVFDRRRAARVASVDSPDGVDDVDN
FT                   PRVDDAVQDDSPLEQPGIEPRLESRPEPVAA"
FT   gene            complement(502495..502680)
FT                   /locus_tag="Svir_05040"
FT   CDS_pept        complement(502495..502680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05040"
FT                   /product="protein of unknown function (DUF1918)"
FT                   /note="PFAM: Domain of unknown function (DUF1918)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95579"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU51"
FT                   /protein_id="ACU95579.1"
FT                   /translation="MGDTIRVHGHTVGVDGQEGEIIEVRGEHGEPPYLVRFSDGRETLM
FT                   FPGPDAEILPAKEHTK"
FT   gene            502928..504151
FT                   /locus_tag="Svir_05050"
FT   CDS_pept        502928..504151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05050"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="PFAM: Isocitrate/isopropylmalate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent,
FT                   eukaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95580"
FT                   /db_xref="GOA:C7MU52"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU52"
FT                   /protein_id="ACU95580.1"
FT                   /translation="MAKIKVEGTVVELDGDEMTRIIWKFIKDKLIHPYLDINLEYYDLG
FT                   IEERDRTDDQITVDAAHAIAKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILG
FT                   GVVFREPIIISNIPRLVPGWTKPIIIGRHAHGDQYKASDFKVPGPGTVTITYTPDDGSE
FT                   PIEMEVAKFPEGGGVAMGMYNFRKSIEDFARASFNYGLDRGYPVYMSTKNTILKAYDGM
FT                   FKDVFQEIYDNEFKDKFEARGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTV
FT                   AQGFGSLGLMTSVLRTPDGRTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGL
FT                   EHRGKLDNNSELIGFANTLEKVVIETVESGKMTKDLALLVGGDTPYLTTEEFLATLDAN
FT                   LAAKIAQS"
FT   gene            504553..504750
FT                   /locus_tag="Svir_05060"
FT   CDS_pept        504553..504750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95581"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU53"
FT                   /protein_id="ACU95581.1"
FT                   /translation="MRLTAVPFLRKSLPLVGIESVELTWTRVWEDFSGIGYRFRGGGLV
FT                   GFGYRSGPAVKCPLRTDVSM"
FT   gene            504835..505455
FT                   /locus_tag="Svir_05070"
FT   CDS_pept        504835..505455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95582"
FT                   /db_xref="GOA:C7MU54"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU54"
FT                   /protein_id="ACU95582.1"
FT                   /translation="MSKTAWLGRRRLSAARPEQAGAVYGQPSAGALMPIETHYEAWVKP
FT                   PKWDIPGQTLSLFVSSFLATLVWLISDDSVGMLVVNIFFWVMCLACWVFYLARCRITVD
FT                   DDTLVLEVVPWFFRRRLPLTDILSVELTPTDPRQELGMAGCGYTRKGEDLVGYIFTGGP
FT                   AARVATRDGCTYVISAPDADRLVAVLRERAHLDSGGETAEDAA"
FT   gene            505725..506180
FT                   /locus_tag="Svir_05080"
FT   CDS_pept        505725..506180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95583"
FT                   /db_xref="GOA:C7MU55"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU55"
FT                   /protein_id="ACU95583.1"
FT                   /translation="MRPPKAMKVLLWVLFVESLVVAGVVWLLATGPMWIPALVTSLLMG
FT                   LAGSMLACRGVITVDDVALRLAVRPVFRKTIPRADVVSVEPTTVDPWKDFSGWGYRTRG
FT                   KKLVGFLFHSGPAVRLTVRSGRTYVITVPDVDRLVEVLRQPTNVGGA"
FT   gene            506394..506678
FT                   /pseudo
FT                   /locus_tag="Svir_05090"
FT   gene            506749..507546
FT                   /locus_tag="Svir_05100"
FT   CDS_pept        506749..507546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05100"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="PFAM: Endonuclease/Exonuclease/phosphatase family;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95584"
FT                   /db_xref="GOA:C7MU56"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU56"
FT                   /protein_id="ACU95584.1"
FT                   /translation="MLTVSTVNVNGLRAAAKKGFSEWFEATSADVVACQEVRADPGVLP
FT                   DALREPPGWHTVHAACATKGRNGVCLYSRIEPESVRVGFGEAEFEDSGRYVEMWLPRVV
FT                   VGSLYLPSGEVGTPRQEEKERFMDTFLPYLATLRDKASSEGKEVLVVGDWNIAHAEVDL
FT                   KNWKANRKNSGFLPEERAWLSRVFDELGYVDVQRHLDPEGPGPYTWWSYRGRAFDNDAG
FT                   WRIDYQIATPGLAQRCTSMVVERAESYDKRWSDHAPVTATYEI"
FT   gene            507580..507807
FT                   /locus_tag="Svir_05110"
FT   CDS_pept        507580..507807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95585"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU57"
FT                   /protein_id="ACU95585.1"
FT                   /translation="MGVSSTSGLRRLVLTVSVSCPWCCRGGCPRRGGASRTKSLDEALN
FT                   QLFEPAANSSLERRFLWLIGVPRRQESVGR"
FT   gene            508003..512229
FT                   /locus_tag="Svir_05120"
FT   CDS_pept        508003..512229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05120"
FT                   /product="nuclease-like protein"
FT                   /note="PFAM: Nuclease-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95586"
FT                   /db_xref="GOA:C7MU58"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU58"
FT                   /protein_id="ACU95586.1"
FT                   /translation="MMPQAEPYRAWATFSFTAASGRINECDLLIAVPGGLYLVELKGHT
FT                   GRVVNSGETWSFFREGEKRPRRFRNPLHLTDLKCKELKQRLEWAAKQIGYSGRIPWIEP
FT                   AIFLSAPGLVSELDEVQRTRVYGRDEQVEGLDWIWRDLLSRPPQREQQRVSPKFSQRLP
FT                   ELLKKIGIRASTAHLHFGDDWVLSDEVLDAGPTWEDRLAKHAGPVRDEGRVRIYLTEQQ
FT                   AVEERRQSVERAARREYQVLQGIIHRGIAQAMQFREHQSGPAILFRHNSSDLRLDSYLE
FT                   IHGERLSIETRLDLVRQLAEAVQYAHHRSLYHRALSARSVWVAAKEDGSDPVLRITDWQ
FT                   AAARDFDSTSTATVGKTSLTGEHLASSAEVYLAPEFAPHADPVDLDVFGLGAVSFLILT
FT                   GQPPATQRSGLIERLAESQGLHPYAVSDGISDALDALVFDATRTDLSQRLESADAFLKR
FT                   LDAAEWESLPESSVPVVDPLTVSAGQMVDEQWRVERVLGTGATARALLVRRVDTDDEQP
FT                   ERRVLKVALDEDKAQHLHAEARALALAGGGVVVKLLDGPRELGGRTVLDLEYAGGQDPQ
FT                   GYTLGELLRAEGKLSYHNLERYGRDLFTALDQLAGKGVRHRDLKPDNFGVYRRADRSTQ
FT                   LMLFDFSLAEASERDVTAGTRGYLDPFLGTNRRPAYDDHAERYAAAVTLHEMASGQRPV
FT                   WGDGVSDPRTTGDELPVLAVELFEPALRDGLTEFFQRALHRDVNRRFDTLRQMEDAWRE
FT                   VFTAADTAQPLTTPDTVGIEGKTLEEARDFYAEKATLDTQLDVAGLSPRAVSLAQSLGA
FT                   TTVRELLEQVRPYEISRARGAGKVVRNELNRRYKQWTRALSLQDEPDRPAPEATPGLST
FT                   VDDFVAWLVPQKARRGSRKADVVRLTLGLPEGDDDELLRWPTQTEVARRLEITQGTVSQ
FT                   HYRAAVKAWAAEPWLSRVRDELVELVAEAGRVMTAHELAAAVRAKYGVAEPEARERALA
FT                   RSLAVVRAAVDTEAWERQQDEDEDEEGPRFSALRRGDHVLIALESLPGTDAPSAPELAD
FT                   YAVALGARADELVAMDPLPGRGVVVRELRAVPAPEGLPSQADTRLVELAAVMSQRAAAS
FT                   ARAELYPRELDMVRALRMSQAAVGVRRETGITREALLAKVRARFPAVVVDDQTSEVQLE
FT                   EALRAAGTPLEWDTETKRFRPPEPKFSRSAVSSSTSRSGHGPLFSGGVDPREVLGGKLV
FT                   RAGEHGGFLALTLRGVYLPGVAEALASRYAVHPVHVDSEFVATFRELIAERGQDWELVR
FT                   RLDAGFGRTGLPKPGFREYVRKVWERLRDRLVAVGGERTVLLLHHAGLVGRYADLGGRE
FT                   FLTSLQQAARSASAKPHGLWVLCPGESAREAPQLDGLRVEALTESERVVLDKDFLRDLQ
FT                   VVDQAS"
FT   gene            512349..512807
FT                   /locus_tag="Svir_05130"
FT   CDS_pept        512349..512807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95587"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU59"
FT                   /protein_id="ACU95587.1"
FT                   /translation="MAETRGGAGAAQGGGFWEAITPLGFTMNSQTMDEVTRSADRMISS
FT                   AKSGGFTVTKEAADPIIKVLEDFITRIQEMKNELNVFNQIPPLGDHDYGKRVAHYMADA
FT                   ANDDRSARAAIDSLEIVLEKSREALLRASNQYQENEESTKDVFKSLGG"
FT   gene            513007..513210
FT                   /locus_tag="Svir_05140"
FT   CDS_pept        513007..513210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95588"
FT                   /db_xref="UniProtKB/TrEMBL:C7MU60"
FT                   /protein_id="ACU95588.1"
FT                   /translation="MSCFPKRILLKWENSIQNTGKAAGLVHATGGIASKMEAMGSLLLS
FT                   VCEMRKVLKQWLMVAGEFIGMK"
FT   gene            complement(513466..513753)
FT                   /locus_tag="Svir_05150"
FT   CDS_pept        complement(513466..513753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95589"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUM6"
FT                   /protein_id="ACU95589.1"
FT                   /translation="MTPKADVVEPFGSGVYRRARHIGARRAKHHPQHYTGNNDSAHPIN
FT                   HLQITQETTVQHHPLRLRTTAKHDDTNCYGIETAVARTYGLPGYRGQTES"
FT   gene            513756..514223
FT                   /locus_tag="Svir_05160"
FT   CDS_pept        513756..514223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95590"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUM7"
FT                   /protein_id="ACU95590.1"
FT                   /translation="MDGARDGAGAAQSGGLWEAITSLGFTMNSQTMDEVTRSADRMISS
FT                   AKSGGFTVTKEAADPIIKVLEHFIDEIKIMDRKLVAFEQAPPLGGHDYGLLVAEHMQEA
FT                   ANDDRSPRAALQQLQIVLERSRDALRVASGQYQEQEESVRDSLRGMGSEEV"
FT   gene            515352..515603
FT                   /locus_tag="Svir_05170"
FT   CDS_pept        515352..515603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95591"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUM8"
FT                   /protein_id="ACU95591.1"
FT                   /translation="MSLRDAQSVDTLNDLGAGVQRTEVNQRPAAVSKNAEFRSCTVAMK
FT                   LDDVSRVDVSVPRTEEDDACEIAEVIAGLVEPHLPEIP"
FT   gene            complement(515582..516043)
FT                   /locus_tag="Svir_05180"
FT   CDS_pept        complement(515582..516043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95592"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUM9"
FT                   /protein_id="ACU95592.1"
FT                   /translation="MNTATYVPPTREQVDTIRRVLVHERDIERAAILLAAATCPSVKIP
FT                   RLHAAEAATIRAQRPPAHHDLPAALLRITRAIDTETEGLYHHQDAGHPNATPALRAIAF
FT                   RLLELGFTIAEHAGLHIHDIETAVALVYDLPGYGDEAPQHRKDHGISGK"
FT   gene            complement(516158..516556)
FT                   /locus_tag="Svir_05190"
FT   CDS_pept        complement(516158..516556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95593"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN0"
FT                   /protein_id="ACU95593.1"
FT                   /translation="MVVELLHRQDGGELPAEGLCALADRLAGLAADLHIRAAEIDDAAL
FT                   STCCRNPTALPHWQWEALEEVLAEMCERTSGALKDLHDRGEASSKRAAPQATPASPCPK
FT                   ATRCDGVSSRPSARSPTSPTPPPTTRAL"
FT   gene            516722..516856
FT                   /locus_tag="Svir_05200"
FT   CDS_pept        516722..516856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95594"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN1"
FT                   /protein_id="ACU95594.1"
FT                   /translation="MYRVSDAVDIDAADATVESAFVTEDGSFTVMRNPVAVLAWGPDC"
FT   gene            517180..520809
FT                   /locus_tag="Svir_05210"
FT   CDS_pept        517180..520809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95595"
FT                   /db_xref="GOA:C7MUN2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN2"
FT                   /protein_id="ACU95595.1"
FT                   /translation="MRGADLGELVKDLRRQVTVLEDDLRARAQEVPEFHTPLRAEYDEA
FT                   YKRERTAATWESWLDQRVTQVAAAWVLGTVFVRFCEDNGLIQWPFIAGPGERLVDAEER
FT                   HEAYFREHPQDNDRDWIVAAFNHLSEAHPTAAGLFDARFNPLWEITPSFEAATELLQFW
FT                   RRRGDDGEIRYDFTDPEWDTRFLGDLYQDLSEHARKTYALLQTPEFVEEFILDLTLEPA
FT                   VEEFGLADLRTIDPACGSGHFLLGLFRRILTKWREVEPGTDQWELIQRTLASVHGCDKN
FT                   PFAVSIARFRMLVAVLREANAMRLDQAPQFPINIAVGDSLMHGRGAPGIQGELFALDEP
FT                   HTYTTEDVNEYVRSCDLLGKGSYHVVVGNPPYITVKDKQENKNYRDRYDACSGTYALSV
FT                   PFAQRLFQLAIRRDGSERDAGYVGQITANSFMKREFGKKLIEQFFKTVNLTHVIDTSGA
FT                   YIPGHGTPTVILVGRNHSYRQDEPVRAVLGVRGEPSQPEDPSKGLVWSAIVEQLCEPGS
FT                   ESEWVAVDDLERARFSVFPWSLSGGGAAPLFEDIDQHPVKLGDRVKSIGRTTATGADDV
FT                   FLLPERKVAERLGFSESVRTLIVGDSVRDFRVSGAVYVYSPYSDFSNESVVDADSSLVT
FT                   HLLWPFRHVLSRRVIFGKGLQESGSPWYVHLENYPSKLKVRCGIGFAFVATHNHFVLDR
FT                   QGFLFNRTAPVIKLPEEAGEDEHLELLGVLNSSTACFWLKQVCHNKGNGADSKGARTTA
FT                   VPWEDFYEFTGTKLQEFPLPAVLPLDLGRALDSLAQDLAAHEPSAVAEASTPTRARLDA
FT                   ARAEHTRIRGRMIALQEELDWTVYHSYGLLDDAERARLTAPDLDTVPEIRLGERAFEIV
FT                   LARKMAAGEAETAWFERHGSTPVTEIPAHWPDWYRQIVQARIDVIEKRRDIGLIERPEC
FT                   KRRWASETWERKEADALRTWLLDRCERRDLWFGLRDGFSQPRTLTVNQLADQFRDDADM
FT                   HAVAALYASDHLGKPDLPLARVLETIIADQHVPYLAALRYKDSGLRKRAQWEQVWEKQR
FT                   EEDRTGQRLDIPVPPKYTSADFRKTSYWTHRGKLDVPKERFISYPDASPDADPSLLLGW
FT                   AGWDHKDQAQALVNLINDRTADAGWETERLTPLLAGLAEVMPWVRQWHGEYDEEWEGVP
FT                   ADEYQAFLDEQRTKHQLTEDDLKNWRPAPTRRGRRGTAKETQQ"
FT   gene            520806..524663
FT                   /locus_tag="Svir_05220"
FT   CDS_pept        520806..524663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95596"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN3"
FT                   /protein_id="ACU95596.1"
FT                   /translation="MSTNEVYLRDVLDIPESVHAGDFKVELTGGFTQVEARVAEYVVTD
FT                   QLRQAFDKALSIVRAAVRDGTSHAAYLHGSFGSGKSHFLTVLHAVLNNHPAARAKPGLQ
FT                   PVIADHDDWLRGKKFLMVPYHLVGATDLDSAILGGYVNTVRSLHPDQPTPPVYRADAML
FT                   DDARRYREARGDDAFVDWLSIGATTPVPGTPDEDDDLDLDIPDDTGINDTGWTSEQLDR
FT                   AFTAPAGDPVRDRLVQALLSGPMSSYIRGASGDAEAFLPLENGLSIITKHARDLGYDGL
FT                   ILFLDELILWLQAHMSDRQFVNNQVSKLVKLIESGDAGRVLPIISFISRQRDLSKLVGE
FT                   DVTGAEVKELERQVEYLAGRFDTVPLEDSNLPAIIKERVLKPKPGGREILDAAFAGIES
FT                   AKQAVRDVLLDADGATGADWQDFRDVYPLSPALLNVLMALSGALQRERTGLKLLQEMLR
FT                   RRRDDMKVGELIPLGDLWDVLADGIGEAFTDRLRREAEAAQRFYTKARAWLVERHGGEH
FT                   TQQFRATDRLVKTLILAALAPQVSALTRLTGSRLAALNHGSLRARTVSAGSLAVTRLRE
FT                   LQAEFGELRHEGDEDPVFRLQLSDLDVEPYLDAVGEQDTPGARRIWIRKQLWSQLGVND
FT                   TDDFVSEKEIVWKGTRRTAEFVFANVRDERELPDVQFMPSTPGRIRFILDYPFDGSGDY
FT                   TPRHDAERIHRMRRDDITAATIVWLPHFFSAQKSAQLGRLLKIKYLLERDRLDDYVRNR
FT                   SADERVKIRHQLEAQCDTLENQLAAALRQLYGIAGGDDTTVGAPVGEDGHVMSLYPDHK
FT                   PRLAGGAGFEYNALTLADGLFDKLYPKHPNFDPTGNRKAITLGELRTVLDWITKAMEDG
FT                   SRRVVVDRNHLALVRKIVHPLELGEVSDGPLNVSAEWRRRIEQAATQHGVTGDLRVEDI
FT                   RSWIADLGYTGLDKPVVNLIIATYAMLADRTWTLHGSVLRQPPELDKIGPGHALRAQQL
FT                   PDAAEFATARDRAAVLFGIVVPDTLFARNVSRLAEGVRAKVAELETPVNGVRRMLERHA
FT                   DTLGLTHRPDAPRVVATRDAADLLARLSGAAEDTDLVNRLAKATYGTNDTVLAATMAAA
FT                   PRLLESLRDVEWSLVSSVQGFAGRGDLIGNRADALLDEVGHAAAEDEFAVSLAPVLEQL
FT                   QSKAVALVSDAARLTAVATPGPVSPVRTDTENTSSGQAAGADTVSLTDTGQPGISRHEP
FT                   EPSATPSHRAPRRLRASAAERDLAALLEGVRDEIRDYAREHPGAEIEILWRTVGGEDNA
FT                   E"
FT   gene            524660..527365
FT                   /locus_tag="Svir_05230"
FT   CDS_pept        524660..527365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05230"
FT                   /product="PglZ domain-containing protein"
FT                   /note="PFAM: PglZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95597"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN4"
FT                   /protein_id="ACU95597.1"
FT                   /translation="MNTAPEVDRRMLEALVEHWLPQAKGRRLLLVHGRYVDGDREFGVT
FT                   TKEHRCRVRVADQRSLLGVLEAWQDHQREYGADADTLLVVTTDVPDEQFGWDLLAYAVR
FT                   GRVLSVDRVQIIAGRFGARDIDPRIRQEPWLIDALLDAEPAEGWPRTGSVLTRDRAIQA
FT                   LIRVRLGHAALGEDAMDIGTLLDFSLDTAATTRFAALPAAERDGLAEWLTHAVGDAAGL
FT                   LLRLAAEGRAADAMPLGLVGTAAVGANASTAAALAFGGLLGGVRPEQLGAFTEAVEGAL
FT                   ERWISQAESGSRHSDSAREKVLAVTRRAEELATQAGLTTYLADNRFLPSAFTARLHTVA
FT                   TALIAALDGSGELSAAEDALSAVRAHHLARLQSDRVRAVDMAMRLTRWLTLPVPEPTSV
FT                   AEAIQRHNTEWAWVDRALTTLWAGDPAGDPVLGQAYQVVCRAVRERRTILDEAFAKHLV
FT                   NWTKHASIDDPGGCLLIEQVLDRVAAPLVKQKVPLIVVLDGMSGAVAVELAEQLTERAW
FT                   WEAAPEENRIAAVSAIPSVTRASRPSLLTGTLTTGDQTVEKDGFAAYWKRHSNGRHSGR
FT                   LFHKADIGGDAGHRLSDQLLEAMADESVVVAVVLNTIDAALDHGREGDRTGWQPRDITY
FT                   LPELLDAARNYGRPVILVSDHGHVLDRADGTPVPAEGVESARWRLGEPGTGELMLSGPR
FT                   VLFGEGSVVVPWREDIRYTSRKAGYHGGAALSEMAVPVLVLLPSPKILPSGWELLGDRV
FT                   APAWWHQRAEQPTPPAPAERKPKANRRAAKERSDEMPLFTMDDSAERPSLGQRVVAGEV
FT                   YAGQRVFIPKAPDKKVVAAVIDALVDSGNRLPLNTVAGIAGRARRPEFFATTLQRLLNV
FT                   DGYPVLSVDGGRWLTLDVDTLCLQFGVTRD"
FT   gene            527394..528716
FT                   /locus_tag="Svir_05240"
FT   CDS_pept        527394..528716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95598"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN5"
FT                   /protein_id="ACU95598.1"
FT                   /translation="MTGAVSQARRRDVINALRRGTVPQTGLDLLAVGLDRFTTAMDDDL
FT                   DTVARGGAAFHAVRGEYGSGKTFFARWLAERAKRRGLATSEIQISETETPLHRLETVYR
FT                   RLTERLTTATHQPSALRAVVDSWLYTLEEHVLDAGEATEDDEEAFTAAVDKLAEQRLAD
FT                   VARTTPAFAAALRGYRQALADDDATTAEALIAWLGGQKSVAASARRTAGVRGDLDHFGA
FT                   LGFLQGLLTVLRDCGHPGLLLILDETETLQRVRGDVREKGLNALRQLIDEIDAGRFPGL
FT                   FLVLTGTPAFFDGQQGVQRLPPLAQRLATDFSTDPRFDSPRAVQLRLPGFDLDRLSELG
FT                   RTVRELYAGVARNPERVREVVDDAYIAILAKALTGELGGKVGVAPRLFLRKLVADVLDR
FT                   VDDFADFDPRRDYPITVTDTELTDVERNAVASADDIDLELP"
FT   gene            528713..530821
FT                   /locus_tag="Svir_05250"
FT   CDS_pept        528713..530821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05250"
FT                   /product="Lhr-like helicase"
FT                   /note="PFAM: DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95599"
FT                   /db_xref="GOA:C7MUN6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN6"
FT                   /protein_id="ACU95599.1"
FT                   /translation="MSQALERLHSAVVHHLVNTLGWRSLRPLQQQAVAPVLDGHDALLL
FT                   APTAGGKTEAACFPVLTAMEQQRWTGLSVLYVCPLKALLNNLLPRLRDYAAWLGRRVEL
FT                   WHGDVPATARRHILRDPPDILLTTPESVEAMLVSANVEHQRLFGNLRAIVVDEVHAFAG
FT                   DDRGWHLLAVLERLTVLAQRPIQRIGLSATVGNPEQLLHWLQGSGRGHRPATVVAPGVH
FT                   APSATPQGDIELDYVGSVDNAATVISALHRGEKRLVFCDSRQLVEQLGAALRMRGVTTF
FT                   LSHASLSVDERRRAEAAFAEARDCVIVSTSTLELGIDVGDLDRVIQLDSPTTVASFLQR
FT                   LGRTGRRAGSTRNCLFLALSQESLLWAAALLELWGRGYVEPVKAPLEPRHIVAQQVLAL
FT                   CLQEHAVGGRLWTEAWNGLAPFDRSAEPIVRHLVEQGYLDRDGELLFIGPEAERRFGHR
FT                   NFMDMTAVFTAPPQFTVLAGRQEIGLIDPTLLTERSEGPRVLLLGGRSWKVTWVDWKRR
FT                   RCFVEETKLKGKARWHTPGATGRSAALARAARDVLLGATPPVKLTQRAVQTLTTLREKR
FT                   IPTVASEGLVITREGSTEADVRWWTWAGRKANATLAASLPEVVDGRFDDVSVRLRPDLT
FT                   PQLWRTATTDAAQKLCLPEIDDRALAGLKFSVALPPQLAVDTLASRMADLDTAATVLNE
FT                   PVRFTILG"
FT   gene            530961..531491
FT                   /locus_tag="Svir_05260"
FT   CDS_pept        530961..531491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95600"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN7"
FT                   /protein_id="ACU95600.1"
FT                   /translation="MSGGHSVIVVPVPELEDYITSRTAHYDASFLSTDPAFVHAHITLL
FT                   GPWLAEPSQADLDAVAAIMAAAEPFETTLSRIETFPDGLIYLRPEPDEPFRALTAALMN
FT                   AFPHCPPYEGRFPNPVPHLTLDRRAETITPESVEADLRHLLPVRLRVDRVDLQWWANHD
FT                   CHVRESWKLGKRR"
FT   gene            531662..532108
FT                   /locus_tag="Svir_05270"
FT   CDS_pept        531662..532108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95601"
FT                   /db_xref="GOA:C7MUN8"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN8"
FT                   /protein_id="ACU95601.1"
FT                   /translation="MGVELDTLGNVHLVTLTLQGERLRRTAEWTGGRHPVRNPDRAASR
FT                   PVTRMFRRPAVVAAMTVVTLLSGAGTASAVQAEPNAMTFGLLGPVGLVAVVLGVLGMAA
FT                   GVIRQRKKNRTQTATSTVETGAPVGTITVPDTEAGVAVSSRAAD"
FT   gene            532455..532787
FT                   /locus_tag="Svir_05280"
FT   CDS_pept        532455..532787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05280"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterised BCR, YnfA/UPF0060 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95602"
FT                   /db_xref="GOA:C7MUN9"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUN9"
FT                   /protein_id="ACU95602.1"
FT                   /translation="MLVLRSIVLFVLAALAEIGGAWLVWQGIREHRGWIWIGAGVIALG
FT                   LYGFVATLQPDAHFGRILAAYGGVFVAGSLVWGMVVDGYRPDRFDVIGALICLLGVAVI
FT                   MYAPRG"
FT   gene            532974..534413
FT                   /locus_tag="Svir_05290"
FT   CDS_pept        532974..534413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05290"
FT                   /product="glycosidase"
FT                   /note="PFAM: Alpha amylase, C-terminal all-beta domain;
FT                   Alpha amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95603"
FT                   /db_xref="GOA:C7MUP0"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP0"
FT                   /protein_id="ACU95603.1"
FT                   /translation="MFQRVFAVVLLVSALLTLPVRTTPPADAAPPGERDVIATLFQWNW
FT                   NSVARACHEQLGPNGYGAVQVSPPTEHVVLGDDGYPWWQDYQPVSYKLESRRGTRAEFA
FT                   NMVNACHDAGVKVYVDVVVNHMSGQDECGTGSAGSEYCHYEYPEAGYGYDDFHHCGRNG
FT                   DDNIVDYHDRYEVQNCELVNLADLATESETVRDRIGAYLNDLLDLGVDGFRVDAVKHIP
FT                   AEDVAAILSRLRSPAYIYQETLYGEGEPITPDEYLDNGDVYDGRYARDIARIFNSEKLA
FT                   YLRDFGTAVPSDRIVVFIDNHDSQRGGETLTYADGARYSLANAFMLAWPVGTPKVNSSF
FT                   TFDDYDAGPPSDAAGNTTDATCDSGAWQCEHDWQPIRNMVGFHNEVRGEPVVHWWDNGN
FT                   DTIAFGRGTKGYVVLNDESEPVTGRSFHTGLPEGTYCDVLHGDVVNGACTGPTYTVDAA
FT                   GWFRADIGAHDGVALHVGARV"
FT   gene            534628..535728
FT                   /locus_tag="Svir_05300"
FT   CDS_pept        534628..535728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05300"
FT                   /product="ribonuclease, putative"
FT                   /note="PFAM: Ribonuclease BN-like family; TIGRFAM: YihY
FT                   family protein (not ribonuclease BN); ribonuclease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95604"
FT                   /db_xref="GOA:C7MUP1"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP1"
FT                   /protein_id="ACU95604.1"
FT                   /translation="MGQVKADEGKGTKGAKGSEDSPGVAGVKDAKSGKDEDKLLPRLRR
FT                   KHPWLDHVIRANEAFTERFGNHYAAAITYFSVLSLVPLLMVGFSVAGFVLAGNDVAMRQ
FT                   LREGIVNSAPEGLGGLFTSIVQAALDSRAGAGILGLLLALYSGLGWMGNLRDALTVQWG
FT                   QEKPKLPFLSTKVKDLGALAGLGVALAVSFGLTAVGSGLGEFLLELMGLEDAAWARFLL
FT                   RLGTIVLALAANVLVFLWVLAWLPRKKVAVRNAVRGAVLAAVGFEVLKQVGGVYLSSVL
FT                   SSPSGALFGSVIGLLVFANLVARFLLFATAWAATAEGNLVTRTVEPPAPAVVRPTVEVR
FT                   RGGGPGLAVGAFGAGALLAWLAKRRS"
FT   gene            535772..536974
FT                   /locus_tag="Svir_05310"
FT   CDS_pept        535772..536974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05310"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95605"
FT                   /db_xref="GOA:C7MUP2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP2"
FT                   /protein_id="ACU95605.1"
FT                   /translation="MSTMTSTPRDAALPREIWVLLAASFLIAIGYGIVAPALPNFATSF
FT                   DVGVTAASVVVSAFAFVRLLFAPMSGRLVTRFGERPIYLWGVSIVAVGTLLCGVAADYW
FT                   QLLLFRSASGVGSTMFTVSAIGLLIRISPPELRGRASGLWGSSFLLGGIVGPVVGSGLV
FT                   TVSLRAPFFVYGGALVLTTLLVWWQLRDSELVARPAEESGQRMTFPQALRHSSYRAALA
FT                   SNLANGWVVFGVRMSLLPLFVTAVLNQDEAFTGIALAVFAAMNAAALLYVGRVSDKRGR
FT                   KPPALLGLALLAAGALGIGLASDPWVFLGAVVVTGLGAGALNPAQNATVADVLGSKARG
FT                   GSVLAGFQMAADVGAVAGPLIAGAVAEQWSYSAAFGLTAAVAVVALLLWCGAKETLPAK
FT                   N"
FT   gene            complement(536979..538211)
FT                   /locus_tag="Svir_05320"
FT   CDS_pept        complement(536979..538211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05320"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="PFAM: D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95606"
FT                   /db_xref="GOA:C7MUP3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP3"
FT                   /protein_id="ACU95606.1"
FT                   /translation="MRIATPIRTLFALFVTALLAGTSVLVATPPAEAATESPTECPNRT
FT                   LPPPPVDKSEEPPPGEQSPTPLPVPETPAGGERMAECGIVRPADSPEPPEDITAAAWLV
FT                   QDLDTGYVLAAKNPHGRYRPASLIKTLLALVVLEELPPDHVVVATKEDANQECTCVGLV
FT                   EGGEYTVDQLIHALLMHSGNDVAHALATALGGVDAAVEKMNALAEWLGAADTRAATPSG
FT                   LDGPGMMTSAYDMSLIFRYAMQQPAYAEAVGTKHIDFPGGPGEPDFPVYNDNPLWASYE
FT                   GFLGGKTGFTDDARHTYVGAAERDGRRIAVVLLQAEQQPIRVAEQAQRLLDYGFGLAAA
FT                   GKEPVGTVTTAPPFSSVDEDGEGTDVIDVATTSPSDPFGTTGWIVTLIVTVLVLTGLLV
FT                   GHRKGLLRRPD"
FT   gene            538254..538526
FT                   /locus_tag="Svir_05330"
FT   CDS_pept        538254..538526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95607"
FT                   /db_xref="GOA:C7MUP4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP4"
FT                   /protein_id="ACU95607.1"
FT                   /translation="MRMSRGTSLFLTAFGVWSWIIWITFARNLWNSDNSWNSDGSPTSF
FT                   FVVHLLLAVTSFVLGTIIGVIGWRGLRASRNRGEAEGAAERTTKS"
FT   gene            538818..540191
FT                   /locus_tag="Svir_05340"
FT   CDS_pept        538818..540191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05340"
FT                   /product="endo-1,4-beta-xylanase (glycosyl hydrolase family
FT                   10)"
FT                   /note="PFAM: Cellulose binding domain; Glycosyl hydrolase
FT                   family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95608"
FT                   /db_xref="GOA:C7MUP5"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP5"
FT                   /protein_id="ACU95608.1"
FT                   /translation="MSTAHQRRSGLRRAGTRIRKVVAAVAVGAVTAGGLVAAAGTASAQ
FT                   TTLGDAAAAQGRYFGTAVAVDRLGEPDYTATLNREFNSITAENSWKWESLQPSPGYFDF
FT                   STADRIAEHARQQGMELRGHTLVWHSQLPSWVENIGSADELRAVMRNHITTVMEHYKGQ
FT                   VRSWDVVNEAFEDGNSGARRNSVFQRVLGDSWIEEAFWIAREADPNATLCYNDYNTDAW
FT                   NTAKTQAVYNMVADFVSRGVPIDCVGFQAHFNSGNPVPENYHITLQNFADLGVEVQLTE
FT                   LDIAGSGASQAEQYAGVTLACLAVPQCTGITVWGVTDKYSWRAEDTPLLFDGNYNPKQA
FT                   YYAVLETLGGSGGGGGGDGACTVTYEETERWGDRFNGRVTVRAGDEAISSWSTTVTVHP
FT                   PQRISATWNGDPSWDASGNVMTMRSNSGLPAGGQTSFGFTVMANGNWTAPILGSCVAS"
FT   gene            complement(540296..541084)
FT                   /locus_tag="Svir_05350"
FT   CDS_pept        complement(540296..541084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05350"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95609"
FT                   /db_xref="GOA:C7MUP6"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP6"
FT                   /protein_id="ACU95609.1"
FT                   /translation="MTATVSEGVHDTSQIPAPEGSVTITVKILRFNPETDTEPHWESYD
FT                   VPALPTDRVLNLLFNIKNYVDGTLAFRRSCAHGICGSDAMQINGINRLACKVLVKDLIG
FT                   KKSKDGKPPVVTVAPIKGLPTLKDLYVDMEPFFEAYRAVKPYLIAYGNEPTRERLQSPA
FT                   DRERFDDTTKCILCAACTSSCPVYWADGSYFGPAAIVNAHRFIFDSRDEGAEERLDILN
FT                   DAEGVWRCRTTFNCTDACPRGIQVTKAIQEVKRALLFRRT"
FT   gene            complement(541086..542873)
FT                   /locus_tag="Svir_05360"
FT   CDS_pept        complement(541086..542873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05360"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein C-terminal domain; Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM: succinate
FT                   dehydrogenase, flavoprotein subunit, E. coli/mitochondrial
FT                   subgroup; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95610"
FT                   /db_xref="GOA:C7MUP7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP7"
FT                   /protein_id="ACU95610.1"
FT                   /translation="MQFHKYDVVIVGAGGAGMRAAIEAGQRARTAVLTKLYPTRSHTGA
FT                   AQGGMCAALANVEEDNWEWHTFDTIKGGDYLTDQDAAEIMAKEAIDAVLDLEKMGLPFN
FT                   RTPDGKIDQRRFGGHTREHGKAAVRRACYAADRTGHMILQTLYQNCVKHGIEFFNEFYV
FT                   LDIALTDTADGPVASAAIAYELATGEIHVFQAKSIIFATGGFGKVFKTTSNAHTLTGDG
FT                   MGIYLRKGLPLEDMEFYQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYAPTIK
FT                   DLAPRDIVARSMVLEVLEGRGAGPNKDYVLLDCTHLGEEVLETKLPDITEFARTYLGVD
FT                   PVKEPVPVYPTAHYAMGGIPTNVHGEALRDNENIVPGVYAAGECACVSVHGANRLGTNS
FT                   LLDINVFGKRAGIAAAEYANSRDFAELPDDAAKTVETMVNHLRSSTGGERVVDIRNELQ
FT                   ATMDANAAVYRTEDTLKQALTDVQSLKERYGRISIMDKGQRYNTDLLEAIELGFLLDLA
FT                   EVLVNAALARKESRGGHAREDYPDRDDVNFMRHSMSYKILPEKDDPDAQLGLPGFRADL
FT                   RLDYKPVTFTRYEPMERKY"
FT   gene            complement(542900..543316)
FT                   /locus_tag="Svir_05370"
FT   CDS_pept        complement(542900..543316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05370"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /note="PFAM: Succinate dehydrogenase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95611"
FT                   /db_xref="GOA:C7MUP8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP8"
FT                   /protein_id="ACU95611.1"
FT                   /translation="MAEALTLDKPRSPRRPAARRSNFELYSWLFMRISGLLLVVLVLGH
FT                   LFIMNILDGGVHRINFAFVAGRWSSPFWQFWDLTMLWLAMIHGGNGLRTVIEDYARKES
FT                   TRFWLKMVLYVATVVILLLGTLVIFTFDPNIPAD"
FT   gene            complement(543316..543666)
FT                   /locus_tag="Svir_05380"
FT   CDS_pept        complement(543316..543666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05380"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /note="PFAM: Succinate dehydrogenase cytochrome b subunit;
FT                   TIGRFAM: succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95612"
FT                   /db_xref="GOA:C7MUP9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUP9"
FT                   /protein_id="ACU95612.1"
FT                   /translation="MWSWVLHRITGVLTFFFLFVHVLDTALVRVSPNTYDAIIETYKNP
FT                   IVNLMEVGLVGAVLYHALNGIRVILVDFWSKGAKYQHVMLWSLIGVWVLVMIPGTYFML
FT                   ERTVSDLFGGGN"
FT   gene            544210..545316
FT                   /locus_tag="Svir_05390"
FT   CDS_pept        544210..545316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05390"
FT                   /product="nucleoside-binding protein"
FT                   /note="PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95613"
FT                   /db_xref="GOA:C7MUQ0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ0"
FT                   /protein_id="ACU95613.1"
FT                   /translation="MAGVLTLAACAKDSGNDNAASGGGESSGECVTAAAPPRPEAGEGK
FT                   REKEAEDVDASDLKVGLAFDVGGRGDASFNDAAAAGVDKAVEELGVSDTTESTATGTES
FT                   EDAKQQRLTQMAQQGYNPIIAVGFAYSDAIDAVAPKFPDTQFAIVDDDSVDQPNVTPLV
FT                   FTEEQGSFLVGVAAVYKSENCHVGFVGGVNTPLIQKFEAGFVQGAKAVSDKVKIEIDYL
FT                   TPAGDISGFNDPGKGNVVAEAQIDKGADVLYHAAGASGKGVFEAAKANDALAIGVDSDQ
FT                   YEQKTVADVKDVIMTSMLKRVDVAVYDFIRAVAEDDLDSLPERFDLAADAVGYSTSGGM
FT                   VDDIVDVLEGYKQQIVDGEIEVSATPSN"
FT   gene            545454..547007
FT                   /locus_tag="Svir_05400"
FT   CDS_pept        545454..547007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05400"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95614"
FT                   /db_xref="GOA:C7MUQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ1"
FT                   /protein_id="ACU95614.1"
FT                   /translation="MTESRPAVELKGITKRFPGVVANSDVHLTVRAGEVHAVCGENGAG
FT                   KSTLMKILYGMQQPDEGTITVHGEAVRFRNPQDAIKAGIGMVHQHFMLADNLSVRENIL
FT                   LGAESLHGIGQKATARMAELAESTGLRVNLDSLVEQLGVADRQRVEIVKVLYRGARIVI
FT                   LDEPTAVLVPQEVDALFDTVRRMREQGYTFIFISHKLDEVRQIADQVTVIRRGTTVGTV
FT                   DPRTVSSRELAEMMVGSELPSPETRESTVTDRVVLRVENLRLKAEDSERAVLDDVSLTV
FT                   RAGEVLGIAGVEGNGQTELVEAIMGMRKAATGRIELVDAEGRTRDLTKLGTLARREAGI
FT                   GYIAEDRHRHGLLLNRSLWMNRILGYQTRKPVSNGRILDPAAAREDTRRIVAEYDVRTP
FT                   GVEVASGALSGGNQQKLIVGRELSGDPVLLIASHPTRGVDVGAQALIWDRIRAARRQGL
FT                   AVLLISADLDELIGLSDTIRVMLRGRLVTEADPATVTPTELGSAMTGADEGRFLPEDVA
FT                   "
FT   gene            547004..548098
FT                   /locus_tag="Svir_05410"
FT   CDS_pept        547004..548098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05410"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95615"
FT                   /db_xref="GOA:C7MUQ2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ2"
FT                   /protein_id="ACU95615.1"
FT                   /translation="MISWRTALLPPALAIAFAMALSSVALLVSGANPMEAFAAMGAQLF
FT                   KGTTAVDTVNLATVYYFAGLAVAIGFQMNLFNIGVEGQYRFAAVIAAIVGAAMELPPVL
FT                   HVLAILAVAMLSGAAYALLPAILKVTRGVSEVITTIMLNSIVFGIVAYLISADQFGVQR
FT                   GNNISTAQIPETGWIPGIPLGEAGTMFGAVFLAIAMGVGYWFLLNRTRFGFELQASGES
FT                   PTAATAGGVSAKRMTMIAMLLSGAVAGLIAMPELLGRDHVYAMTATQGYGFTGIAVALL
FT                   GRNHPAGVAFGALLWAFLDKSAVSLESIGIPREIATIIQGTIVLSVVVAYEIVKRAELA
FT                   AEQRRVGRQTRNGMPASVSQGGAV"
FT   gene            548191..549375
FT                   /locus_tag="Svir_05420"
FT   CDS_pept        548191..549375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05420"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95616"
FT                   /db_xref="GOA:C7MUQ3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ3"
FT                   /protein_id="ACU95616.1"
FT                   /translation="MLWAVVAISVLSTTAYLTGLDSLTSSNTSQTALRLALPILFAALG
FT                   GLWAERAGVINIGLEGMMILGTWGAAWGAYYGGVWAGLLAAILFGALGGLLHAVATVTF
FT                   GVNHIVSGVAINLLGLGVTKYLANIVFEPLSGNPRQSPPVPKFETYSATFLSDWLAELE
FT                   QAQRVGISDAAGLLHGLVTQVSPLAMIALLLVPLSYLVLWRTRFGLRLRSCGENPVAAE
FT                   SLGVNVYVHKYLALLISGGLAGMGGASLVLLAGGADYLENQTNGRGYIGLAAMIFGNWR
FT                   PGGLLGGAALFGYSDGLQLSAGGEAVLALCYGAVLLLAVIAVVQLVRRRWLAAALSAVA
FT                   AGVLYYVYWANDELPRELIPYTPHFVTIIILAVAAQKLRPPKAIGKRYRRGEDD"
FT   gene            549378..549782
FT                   /locus_tag="Svir_05430"
FT   CDS_pept        549378..549782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05430"
FT                   /product="cytidine deaminase"
FT                   /note="PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region; TIGRFAM: cytidine deaminase,
FT                   homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95617"
FT                   /db_xref="GOA:C7MUQ4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ4"
FT                   /protein_id="ACU95617.1"
FT                   /translation="MSAEVTADDWERLRSEAVAAARKAYAPYSGLQVGSAALTDDGRIV
FT                   TGCNVENASYPVGLCAEATMSGQLRLSGGGRFVAVTCRSGEGEPLMPCGRCRQLLFEFG
FT                   GPGCLVDTPRGVQPMSEVLPQAFGPEDLPS"
FT   gene            549779..551095
FT                   /locus_tag="Svir_05440"
FT   CDS_pept        549779..551095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05440"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="PFAM: Pyrimidine nucleoside phosphorylase C-terminal
FT                   domain; Glycosyl transferase family, helical bundle domain;
FT                   Glycosyl transferase family, a/b domain; TIGRFAM:
FT                   pyrimidine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95618"
FT                   /db_xref="GOA:C7MUQ5"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ5"
FT                   /protein_id="ACU95618.1"
FT                   /translation="MTGEPFAAVDVIRTKRDGAALSDEQIRWVVDAYTRGVVADEQMAA
FT                   LAMAILLRGMDRAEIACWTGAMIDSGERLSLRCSRPLVDKHSTGGVGDKITLPLAPLVA
FT                   TCGAAVPQLSGRGLGHTGGTLDKLEAIPGWRAELSADEISRQLEDVGAVVCATTPTLAP
FT                   ADRKLYALRDVTATVDSVPLIASSIMSKKIAEGVDRLVLDVKTGSGAFMKTREQARELA
FT                   TTLVEIGAAHGVATTAVLTAMDTPLGSAVGNAVEVAEAVDVLRGGGPADVVELTVALAR
FT                   EMLALAGLSDVDPARVLASGQAYETWCRMIRAQGGDPEAALPEPAHVHVVEASEAGTMT
FT                   RLDAYGVGVVAWRLGAGRARKDDPVQPAAGVRCLVKPGQRVEVGQPLFELHTDTPEAVA
FT                   AVLPTLRAAYDIDGHETAPAALQARGGVVLERVVSGASG"
FT   gene            complement(551137..552186)
FT                   /locus_tag="Svir_05450"
FT   CDS_pept        complement(551137..552186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95619"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ6"
FT                   /protein_id="ACU95619.1"
FT                   /translation="MTTDNHLAAPSFDRMRNMLVRAAEVRESEQQQIFDALDDIYARLA
FT                   PVDSLGAVRKRLSELPDRTEMSVLAERLDEAMTRLEAQDNALADLARSVEAIVDKLAKP
FT                   FGQLDGRLDGVAARFEGVAGRMDGLEDKLANIHRRLDELGNHLDKQDTKLDAVPAAVQG
FT                   PLRERIDTLETTLKERVERLDSDSKERITASTDTLRSAMTDTAETFDPSARLDTLNERL
FT                   EQLGDRLDALSARLDKVEENVGAQLGDLDGSIKSGLSKVEDTLAQQPDNEHFAAVVRRS
FT                   NEESERRIGGQLDEAMATFAELMLGGGPAPQPAISAPPTPRQPRRRNGRSAKGSDAKSK
FT                   SGADVDSDD"
FT   gene            552431..553522
FT                   /locus_tag="Svir_05460"
FT   CDS_pept        552431..553522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05460"
FT                   /product="adenosine deaminase"
FT                   /note="PFAM: Adenosine/AMP deaminase; TIGRFAM: adenosine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95620"
FT                   /db_xref="GOA:C7MUQ7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ7"
FT                   /protein_id="ACU95620.1"
FT                   /translation="MSTRTVPTLQELRDAPKVLLHDHLDGGLRPGTVVELAEETGYDGL
FT                   PTTDVGELSRWFKTAADSGSLESYLETFAHTCGVMQTEEALSRVAAECVEDLADDGVVY
FT                   AEVRYAPELFVERGLSLEAVVEAVQDGFDRGRKAAAERGRNIRVGQLLCAMRQHARARE
FT                   VADLTVRYRDRGVVGFDIAGPEAGYPPTRNLDAFEFLRENNAHFTIHAGEAFGLASIWE
FT                   AIQHCGAERLGHGVRIVDDITTSEDGEVSLGRLAAYVRDRRIPLEVCPSSNVQTGAAPS
FT                   IAEHPIGLLAKLRFRVTVNTDNRLMSDCTVSSEFAALVDAFGFDWADVQWCTINAMKSA
FT                   FISFDERLDIINNIIKPWYAERV"
FT   gene            complement(553767..555050)
FT                   /locus_tag="Svir_05470"
FT   CDS_pept        complement(553767..555050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95621"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ8"
FT                   /protein_id="ACU95621.1"
FT                   /translation="MAQDIIPIELGLPQGDLVTLWAPRWREDGEEWEAFLGDEEDLYAF
FT                   PDSAHLAAYVRTAEQHDLIDHPAWEAVPALNVPELIPDDDHCYDLVGVPELVAEDPDSW
FT                   TLAELAEIVNIVRSLADVCDLDEVHEVLDSCEAFSLLNQGQLPFTGREGARLWNDLSVT
FT                   VSEKWDIVLDAIDELVTIPEVDSATLDETTEELAAFHEESAEAEAGVDAEDDDLDTVDG
FT                   DDFDDEDETDVTDDDFDDEPLGFWAEVGIDPIKIVLPSRDYYTLRCYLDDDPVFLGSNG
FT                   TIEVYPSERALARALADGGKLAHTDLAEVSTWDEVLAAATAGELEIDVDPDNTYVLTGL
FT                   DDDIAEGVDAIEPTQLELAVELLTDAADWAGDDEVSKALATSERLGWLVSFVLRPDPTR
FT                   LTPSPPFDAEQQAWRNLVDSFENRLHLN"
FT   gene            555197..557725
FT                   /locus_tag="Svir_05480"
FT   CDS_pept        555197..557725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05480"
FT                   /product="superfamily II RNA helicase"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95622"
FT                   /db_xref="GOA:C7MUQ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUQ9"
FT                   /protein_id="ACU95622.1"
FT                   /translation="MTDFLTDRLPGDTDPDALFDAFSTWVSERGLELYPAQEEALIELV
FT                   SGANVILSTPTGSGKSLVAVGAHFAALAEGRRSFYTAPIKALVSEKFFSLVEIFGADNV
FT                   GMLTGDSSVNPDAPIICCTAEILANLALRLGPEADVDEVGQVVADEFHFYSEPDRGWAW
FT                   QVPLLELPKAQFLLMSATLGDVSFFERDLTRRTGRHTAVVTSAQRPVPLTFRYALTPMH
FT                   ETVSELLHSGQAPIYIVHFSQAAAVERAQALMSINVCTRAEKDAIAEAIGDFRFSAGFG
FT                   KTLSRLVRHGIGVHHAGMLPKYRRLVEQLAQSGLLKLICGTDTLGVGINVPIRTVVLSS
FT                   LTKFDGTRQRHLKAREFHQIAGRAGRAGYDTDGYVVVQAPDHVIENAKALEKAGDDPKK
FT                   KRKIVRKKAPEGFVNWTESTFERLVAAEPEPLVSSFKVTHSMLLNVISRPGDAFAHMRR
FT                   LLEDNHEDRPSQRKHILRAIAIYRALRAAGVVEELDEPDEEGRRVRLTMDLQLDFALNQ
FT                   PLSPFALAAIELLDPESPSYALDVVSIVEATVEDPKQVLSQQQFKARNEALAEMKAQGI
FT                   DYEQRMELLEDITYPKPLEELLEAAYSRYRQGHPWVADYELSPKSVVRDMYERAMNFVE
FT                   YINFYGLARSEGVLLRYLADAYDALRRTVPDEAKTEPLQDLIEWLGELVRQVDSSLLDE
FT                   WEALRHPDEVELDESGRPELPEGPPPVTYNERAFRVLVRNEMFRRVQLAAREDYETLGR
FT                   LDADSGWDAEAWEDALADYYDTYDEILTDADARGPGLLLIEQERDVWRVRQIFHDPEGN
FT                   HDWGISAEVDLAASDEAGTPVIRITDVNEL"
FT   gene            complement(557838..558701)
FT                   /locus_tag="Svir_05490"
FT   CDS_pept        complement(557838..558701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05490"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95623"
FT                   /db_xref="GOA:C7MUR0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR0"
FT                   /protein_id="ACU95623.1"
FT                   /translation="MSRVEVAKTYKLYIGGKFPRSESGRTYPVSDAKGKFLANVAHASR
FT                   KDLRDAVVAARKAFAGWSGATAYNRGQVLYRVAEVMEGRHDQFVAEVAACEGLPTRKAE
FT                   SIVDAAVDRWVWYAGWTDKLAAVLGSANPVAGPYFSFTVPEPTGVVGVLAPQRSSLLGL
FT                   VSVLAPVLATGCTAVVVSSAERPLPAVTLSEVLATSDMPGGAVNVLTGRASELGSWLAS
FT                   HEDVNAIDPTGADSADRVELAREAAGTVKRMLDVPDEEPDWTRRPGLGRLRTYLEPKTV
FT                   WHPMGV"
FT   gene            complement(558688..560127)
FT                   /locus_tag="Svir_05500"
FT   CDS_pept        complement(558688..560127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05500"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95624"
FT                   /db_xref="GOA:C7MUR1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR1"
FT                   /protein_id="ACU95624.1"
FT                   /translation="MSQWEYAPAPESRDIANLKPTYRPFIGGEFVDGSGEPLQTINPAT
FT                   EEVLAEVGTASVSDVDNAVKAARKAYDRVWGPMPGTERAKYIFRIARLIQERARELAVL
FT                   ETLDNGKPIKESRDTDIPTAAAHFFYHAGWADKLEYAGLGPQPRPLGVAGQVIPWNFPL
FT                   LMLAWKVAPALATGNTVVLKPAETTPLTALVFAEICQQADLPPGVVNIVPGAGDIGAAV
FT                   VEHPDVDKVAFTGSTAVGKHIQRTLAGTRKRLTLELGGKAANIVFDDAPLDQAVEGIVN
FT                   GIFFNQGHVCCAGSRLLVQESIAEELLDKLRARISTLRLGDPLDKNTDIGAINSAEQLA
FT                   KIEDLVASGERDGAQRWSSPCTLPDKGFFFAPTVFSNVEQSMRIAREEIFGPVLSVLTF
FT                   RTPDEAVAKANNTPYGLSAGVWTEKGSRILWMANRLRAGVVWANTFNRFDPTAPFGGYK
FT                   ESGFGREGGRTGLEAYLHVQG"
FT   gene            complement(560130..561083)
FT                   /locus_tag="Svir_05510"
FT   CDS_pept        complement(560130..561083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05510"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="PFAM: DeoC/LacD family aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95625"
FT                   /db_xref="GOA:C7MUR2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR2"
FT                   /protein_id="ACU95625.1"
FT                   /translation="MATATLPAELADAIRDERSLRRFLHGLPGVDQVGVEQRAANLATR
FT                   SIKKDSKLWAINTAISMVDLTTLEGADTPGKVRSLAAKARRPDPDHPDTPHVAAVCVYP
FT                   DLVATAVEALGTTDIAIASVATAFPAGRSSLDVKLADVALAVSAGATEVDMVIDRGAFL
FT                   AGRYGQVFDEIRAVKEACGDAHLKVILETGELATYDNVRRASWLALLAGGDFIKTSTGK
FT                   VSPAATLPVTHVMLQAVRDWYTATGELRGVKPAGGIRTTKDAVRYLVAVREVAGEEWLT
FT                   PSLFRFGASSLLNDLLLQRRTQLSGHYSGPDYLALD"
FT   gene            complement(561139..561786)
FT                   /locus_tag="Svir_05520"
FT   CDS_pept        complement(561139..561786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05520"
FT                   /product="protein of unknown function (DUF1707)"
FT                   /note="PFAM: Domain of unknown function (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95626"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR3"
FT                   /protein_id="ACU95626.1"
FT                   /translation="MSEQPSPRDPKQLRASDADRERVAQVLHKAMGEGRITLDELTERL
FT                   DQVYAAKTLGELEPIVADLPTDGTVLPTALPATSPSASPDQRIGGTPGSTMSVAVMSGV
FT                   ERKGVWVLPRQHSSFAFWGGVEIDLRHARFAEQHSTITAVAIMGGIDVIVPDDITVEVN
FT                   GVGIMGAFETRNKKGASPTAPPGAPVVKVNGLAFWGGVEVKRVPRSKIKELE"
FT   gene            562305..562928
FT                   /locus_tag="Svir_05530"
FT   CDS_pept        562305..562928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05530"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95627"
FT                   /db_xref="GOA:C7MUR4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR4"
FT                   /protein_id="ACU95627.1"
FT                   /translation="MDVLVVDHPLARARLSTMRDARTDSAAFRAALHELTVMLIYEAMR
FT                   DAPLTTERIHTPVARTDAYRLANPPLLVPVLRAGLGMADQAHKLIPDAQMGFVGLARDE
FT                   ETLQPTPYMESLPESLAGRPVLVLDPMLATGGSMAHTIRLLTDRGATDVTAVCAVAAPE
FT                   GVERLKESGLPVRVVTASVDERLNDSGFIVPGLGDAGDRQYGTA"
FT   gene            complement(562930..563523)
FT                   /locus_tag="Svir_05540"
FT   CDS_pept        complement(562930..563523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05540"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95628"
FT                   /db_xref="GOA:C7MUR5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR5"
FT                   /protein_id="ACU95628.1"
FT                   /translation="MPRPKTHDDALRVKLLNRAGELLAEEGPQGLSLRRLAAEVGTSTT
FT                   AVYSLFGSKPALISELCTEGFRRIGERLESVPHTDDPPADLVRLGVVYREAALAQRHIY
FT                   PIMFADAAASGEPPADLSEASLLTLEPLRDAVQAGIDAGAFPHAPADMIAGSVWAYAHG
FT                   MVLFELHHNLPAGFEYRHAYERGLRATVTGWRID"
FT   gene            563579..563797
FT                   /locus_tag="Svir_05550"
FT   CDS_pept        563579..563797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95629"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR6"
FT                   /protein_id="ACU95629.1"
FT                   /translation="MRLVRTGSSASLKAASRVASVRLCVRERMAEVAEVAEAAEVVKDV
FT                   EPAATNRSKFGRAERGRHGFESGGEGA"
FT   gene            564225..565751
FT                   /locus_tag="Svir_05560"
FT   rRNA            564225..565751
FT                   /locus_tag="Svir_05560"
FT                   /product="16S ribosomal RNA"
FT   gene            565896..569025
FT                   /locus_tag="Svir_05570"
FT   rRNA            565896..569025
FT                   /locus_tag="Svir_05570"
FT                   /product="23S ribosomal RNA"
FT   gene            569096..569224
FT                   /locus_tag="Svir_05580"
FT   rRNA            569096..569224
FT                   /locus_tag="Svir_05580"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(569449..570957)
FT                   /locus_tag="Svir_05590"
FT   CDS_pept        complement(569449..570957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05590"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95630"
FT                   /db_xref="GOA:C7MUR7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR7"
FT                   /protein_id="ACU95630.1"
FT                   /translation="MTETVVPRRGRSLAIGAGGLAVLLGALDTYVVIGLFRQIMEDLQI
FT                   PVNRLERLTPIVTGYLLGYIAAMPLLGQASDRFGRKRLLQVCLGMFVVGSVLTATAPDL
FT                   PLIVTGRVVLGVAGGALLPVTMALAADLWSHQRRATVLGAVGAAQELGSVLGPVYGITL
FT                   AAATGWRGVFWINVPLALLAMVAVHFSVPSEQTRRTASVDVVGGGLLAVTLGLLVIGLY
FT                   NPEPGEQVLPDWGVPVLAAAAVIFIAFVLHQVKATHRLIDPTRVRMKPFLAALGVSLAA
FT                   GAALMVTLVDVDLFAQTLLGLDDEGGVLLLLRFLVALPVGALIGGVLTSRFGERWLAVA
FT                   SMVLAAVGFWLMSAWTVDVQADPHVLGPFMLPRLDTDLVVVGLGLGLVIAPLSSAVLRV
FT                   TSAEQHGVASAGVVVARMTGMLVGIAALSAWGLHRFHSMTASLDVPLPMLYPSDEAFQS
FT                   AMDAYTAAVKEAMVTQYTEIFAITGVVCIAGALCATLITARSSR"
FT   gene            complement(570954..571637)
FT                   /locus_tag="Svir_05600"
FT   CDS_pept        complement(570954..571637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05600"
FT                   /product="Protein of unknown function (DUF1396)"
FT                   /note="PFAM: Protein of unknown function (DUF1396)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95631"
FT                   /db_xref="InterPro:IPR009830"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR8"
FT                   /protein_id="ACU95631.1"
FT                   /translation="MTLRRILVGACALLVTFTAAACGSDDAPSEPLPDASTLIQDAAAA
FT                   TRDIESTHFTIEVNGTIPGLAVHSLDGDLTRSGEAQGTGTLEQAGQLVEVSFVLVDDTL
FT                   YLKGPTGGYQKIPAALSSSIYDPSAVLDPERGVAKLLTSLRDPRTEGTDELDGVATYKV
FT                   SGDLAEDVLAGVVPGVNTGAEVTFWLRADDEPLPVRATAVLNDDASVDITLSDVNKPVT
FT                   VEPPA"
FT   gene            complement(571705..572157)
FT                   /locus_tag="Svir_05610"
FT   CDS_pept        complement(571705..572157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95632"
FT                   /db_xref="GOA:C7MUR9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUR9"
FT                   /protein_id="ACU95632.1"
FT                   /translation="MATLLIVHHTPSPHLQAMLEAVVAGATDPEITGVEVVREPALSAT
FT                   ASDVLAADGYLLGTPANLGYMSGALKHFFDTVYYPCLESTRKRPFGYYVHGNQGTEGAT
FT                   KSIDSVTTGLGWSKAAPAVVVHGEPSKEDLAACWELGATIAACLSE"
FT   gene            complement(572362..574014)
FT                   /locus_tag="Svir_05620"
FT   CDS_pept        complement(572362..574014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05620"
FT                   /product="phosphomannomutase"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95633"
FT                   /db_xref="GOA:C7MUS0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS0"
FT                   /protein_id="ACU95633.1"
FT                   /translation="MQQKPTRLTTQLRDTTFRWIADDVDDETRAELQDLLARAMTGDSD
FT                   AVAELDDRMSGTPTFGTAGLRGPVRAGSNGMNTAVVIRTTAGLADWLAHTHPGGTVVIG
FT                   RDARHGSERFASATAEVLDGAGFDVRVLPRPLPTPVLAYATLALGACAGVQITASHNPP
FT                   ADNGYKVFDHTGIQIIPPADTEIEQRIAAAPGAVSVPRGRGARTLGDDVLRGYLDRVAA
FT                   LARSENRDVRIAITPLHGVGGDVVVEALHTAGFTDVHLVEQQAEPDPDFPTVTFPNPEE
FT                   EGATDLLLQLAADIDADLAIALDPDADRCALGTRTSDGTWRMLHGDETGVLLGDRLLAR
FT                   TDVPDPLVATTLVSSSLLDRIAAAHGARHARTLTGFKWLMRAGERLVYAYEEALGVCVN
FT                   PDFVKDKDGIAAAVFAADVVAEAKSRGRTLLDLLDELTLRHGISVTGQVAPRFADLAER
FT                   ATVMERLRSQPPDRLAGVAVTAEELPEADALKLSGDRVRVIVRLSGTEPKVKAYLEVTA
FT                   PAPPPERLTETRRAARETLDRLRDDVSRLLTVP"
FT   gene            complement(574428..575234)
FT                   /locus_tag="Svir_05630"
FT   CDS_pept        complement(574428..575234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05630"
FT                   /product="purine nucleotide phosphorylase"
FT                   /note="PFAM: Phosphorylase superfamily; TIGRFAM: inosine
FT                   guanosine and xanthosine phosphorylase family; purine
FT                   nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95634"
FT                   /db_xref="GOA:C7MUS1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS1"
FT                   /protein_id="ACU95634.1"
FT                   /translation="MNSSNTQPRDLAATAASVLTERAGVEAFDIAVVLGSGWRPAADAI
FT                   GEPKAEIPLGELPGFETPSAVGHGSTARAVLIGDKRILVLLGRTHLYEGKGVARVVHGV
FT                   RTAAAAGVRTVLLTNAAGGLREGLQVGQPVIIADHLNMTATSPITGANFVDLVDLYSHR
FT                   LRAVAKEIDPSLTEGVYAGLPGPHFETPAEIRMLRTLGADLVGMSTVLEAIAARAEGVE
FT                   VFGLSLVTNLAAGITGEPLSHEEVIETGRASAERMGNLLRELVARA"
FT   gene            complement(575345..576331)
FT                   /locus_tag="Svir_05640"
FT   CDS_pept        complement(575345..576331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95635"
FT                   /db_xref="GOA:C7MUS2"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS2"
FT                   /protein_id="ACU95635.1"
FT                   /translation="MALGQYRTWHRPMLACAASMAVMTVVSAIGLVVDDRSIVGAPAWL
FT                   KPFKFAVSITVYCITWAWLVSLIRTRRRLAHRVSNALVGVLTLEYTLIVIQVIRGTTSH
FT                   FNFTTPFNAGLVTLMGISISFLWVGTLVLTLLLLRTPITDAADRWAMRSGALVSLVGLG
FT                   LGGLMLSPTDEQSTQAEQGTLGRVIGAHTVGAPDGGPGMPITDWSTVGGDLRIPHFVGM
FT                   HALQALPLLAMLLTLLARRWTRLRDDTVRARIIIVGSLSYTAVLALLTWQALRGQPLIR
FT                   PDGLTLTALSALLVASSVSVLWALRERTSYEDDDRIRNRHRHESTAP"
FT   gene            576444..577097
FT                   /locus_tag="Svir_05650"
FT   CDS_pept        576444..577097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05650"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95636"
FT                   /db_xref="GOA:C7MUS3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS3"
FT                   /protein_id="ACU95636.1"
FT                   /translation="MAELSGESGVPVATIKYYLREGLLHPGERTSPNQARYDGTHIQRL
FT                   RLVRALLDIGGLSVATAKDVLAALDSSEVSLHHVLGVTQYGLPLANPEQADEEARAWAW
FT                   ATLEKLMDERDWECEEGSPVVESLIGVLATMYALGYADFVSVLGRYAEAAENVAEVDVR
FT                   YIADLPNPESIVEGMVVGTLFGDALLVALRRLAQANVSATVFDTDGKVSRREAE"
FT   gene            complement(577075..578334)
FT                   /locus_tag="Svir_05660"
FT   CDS_pept        complement(577075..578334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05660"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95637"
FT                   /db_xref="GOA:C7MUS4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS4"
FT                   /protein_id="ACU95637.1"
FT                   /translation="MERVSAPTDDRRLVAGRYRLRSVLGSGSMGTVWSAYDEFLHRPVA
FT                   VKEVRLPPGVPPARVTELRERTLREARAIAVLSHPNVVILHDVVREHGDPYVVMELLPS
FT                   RSLAGLLSQMGRLTVAQTAAVGEAVAAALEAAHTAGITHRDVKPGNVLVSDDGRIKLTD
FT                   FGIARNVSEATMTHTGMMLGSPAFIAPEVATGGPVTYTADLWGLGATLFAASEGRPPYD
FT                   ADGDPLETVVSVVQGDVPRPSPGPLAPVIRGLMMKKPSERMSLAEVRRRLHPLLTQPRH
FT                   TLFPAELFTESEVSRVRDEASVTRVIPKVPALPEEPDTEDVSAPAGGALAADPGPLPFA
FT                   TDDEPASSSRSTRTSRPPRESAHAKRSSLWPSWLPRPNTELLTGLPGTLTERRNVLAAA
FT                   VVVFVLAAALGFALTRLLAG"
FT   gene            578454..580322
FT                   /locus_tag="Svir_05670"
FT   CDS_pept        578454..580322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05670"
FT                   /product="methylmalonyl-CoA mutase, N-terminal
FT                   domain/subunit"
FT                   /note="PFAM: Methylmalonyl-CoA mutase; TIGRFAM:
FT                   methylmalonyl-CoA mutase, heterodimeric type, beta chain;
FT                   methylmalonyl-CoA mutase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95638"
FT                   /db_xref="GOA:C7MUS5"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS5"
FT                   /protein_id="ACU95638.1"
FT                   /translation="MSNGAEVGAELALAAEFDAPSRRDWERLVEKVLDRVGGDWDRLVT
FT                   TTYDGIEIQPLYTVDDPVPPAGLPGLPPFVRGARPDGHVLTGWDVRARYDVGENFDESA
FT                   AAALNEAVLTDLDGGVTSLWLRVGDGEDGAVPVSSLDAVLQEVRLDLAPIVLDAGEEYE
FT                   RAAQALLALCSEHGVPDTEVAGNLGADPIGVHARTGRAQDVSAAAAFTAKVAERYPKLS
FT                   TLVADGLPYHEAGGSDAQELGAVLATAVAYLRAATEAGLDVATAAARIEFRLAATTDQF
FT                   NTIAKLRAARRAWARVLEVCGAPGIAMRQHAVTSPAMLTRRDPEVNLLRTTVACFAAGV
FT                   GGADAVTVLPFDHAIGLPDKFSRRLARNTQAILLEESKLANVIDPAGGSWYVENLTDAL
FT                   AHAAWDEFTAIEKAGGIEAELASGALADRLADTWRRRSRRIATRRDPITGVSEFPLLDE
FT                   NTVERTPRPAGQGGGLPRVRYAQDYERLRDRSDAHLAEHGSRPKVFLATLGPLAQHTAR
FT                   ATFAANLFQAGGIEPVNPGLADPSVEDLVAAFRDSGTPVACLCGSDVAYGESAEAVAAA
FT                   LRSAGATTVLLAGKPADIDGVTGYVHTGCDALAVLSDTLDTLGVAQ"
FT   gene            580319..582499
FT                   /locus_tag="Svir_05680"
FT   CDS_pept        580319..582499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05680"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /note="PFAM: B12 binding domain; Methylmalonyl-CoA mutase;
FT                   TIGRFAM: methylmalonyl-CoA mutase N-terminal domain;
FT                   methylmalonyl-CoA mutase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95639"
FT                   /db_xref="GOA:C7MUS6"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS6"
FT                   /protein_id="ACU95639.1"
FT                   /translation="MSIPDFSDIELGAGAAPSGDKQEWLEALRASTGKDVDALTWQTPE
FT                   GISVKPLYTAEDLTDLDFLRTYPGIAPYLRGPYPTMYTTQPWTIRQYAGFSTAEESNAF
FT                   YRRNLAAGQKGLSVAFDLATHRGYDSDHPRVAGDVGMAGVAIDSIYDMRQLFDGIPLDR
FT                   MSVSMTMNGAVLPVLALYVVAAEEQGVRPEQLAGTIQNDILKEFMVRNTYIYPPQPSMR
FT                   IISDIFAFTSQRMPKFNSISISGYHMQEAGATADLELAYTLADGVEYIRAGLDAGLDID
FT                   AFAPRLSFFWAIGMNFFMEVAKLRAARLLWAKLVKQFEPRNPKSLSLRTHCQTSGWSLT
FT                   AQDVYNNVVRTCVEAMAATQGHTQSLHTNALDEALALPTDSSARIARNTQLLLQQESGT
FT                   TRVIDPWGGSAYVERLTYELARRAWSHIEEVESAGGMARAIDAGIPKLRIEEAAARTQA
FT                   RIDSGRQPVIGVNKYRLGPEDDTELDVLKIDNAGVRAQQLEKLRRLRAERDEDATQDAL
FT                   RRLTAGAEGDGNLLELAIDAARAKATVGEISEALEKVWGRHSGQIRTISGVYREEVGKT
FT                   AKVETARQRVDAFAEAEGRRPRILVAKMGQDGHDRGQKVVATAFADLGFDVDVGPLFST
FT                   PAEVARQAVEADVHIVGVSSLAAGHLSLVPQLRDELAALGRDDIMIVCGGVIPPQDYDE
FT                   LRAAGASAIFGPGTVIADSVVTLLDELEARHS"
FT   gene            582502..583503
FT                   /locus_tag="Svir_05690"
FT   CDS_pept        582502..583503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05690"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="PFAM: ArgK protein; TIGRFAM: LAO/AO transport system
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95640"
FT                   /db_xref="GOA:C7MUS7"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS7"
FT                   /protein_id="ACU95640.1"
FT                   /translation="MARILDVPAYAKGVLDGDRGILARAITLVESQRPDHRKLAQDLLV
FT                   ELLPHAGGAVRIGITGVPGVGKSTFIDQLGTQLTGAGHRVAVLAVDPSSPRTGGSILGD
FT                   KTRMARLSTDPAAFVRPSPSSGTLGGVARATRETIVLMEAAGYDVVLVETVGVGQSEVA
FT                   VAGMVDTFLFLTLARTGDQLQGIKKGVLELADVIAVNKADGEHEREARKAARELSGALR
FT                   MIYGPDAAWTPPVLTCSGLTGAGLDTVWQQLMRHREQLVESGELEARRQQQQVDWVWAM
FT                   VRDQLLDRLVEHPAVRAIVDEVERDVREGRSTATLAAERILSAFSGETPHSG"
FT   gene            583530..583862
FT                   /locus_tag="Svir_05700"
FT   CDS_pept        583530..583862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95641"
FT                   /db_xref="GOA:C7MUS8"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS8"
FT                   /protein_id="ACU95641.1"
FT                   /translation="MSVRVLGVVLSVLTVVVVVSTGAAVPAAQAASGVASTGYVAHVVA
FT                   QDESTRESETSESGESSSGEPELDPQTEAEAEKNKNKVVVGVIAAILLGIVAAGRYLRA
FT                   KKAKGG"
FT   gene            583985..584137
FT                   /locus_tag="Svir_05710"
FT   CDS_pept        583985..584137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95642"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUS9"
FT                   /protein_id="ACU95642.1"
FT                   /translation="MCTAVLGEFVELHRLDGFAELAQPNPFRQLYQRTTGVYTIAALVA
FT                   CGGAV"
FT   gene            584134..585414
FT                   /locus_tag="Svir_05720"
FT   CDS_pept        584134..585414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05720"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Peptidase family M20/M25/M40; TIGRFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95643"
FT                   /db_xref="GOA:C7MUT0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT0"
FT                   /protein_id="ACU95643.1"
FT                   /translation="MTVLDSRPEVPGESDPGTSADSLLAAAGTVAAGDVGAGRGPDWLD
FT                   DWLADRAVDVVSWRRHIHAHPELARREYGTTELIVRLLRSAGLQPRVLPGGTGLICDVG
FT                   TGRRCVALRADLDALPLTEATGLPFASSVDGVAHACGHDVHTTVLLGAGLALATAAELP
FT                   GRVRLLFQPAEEVMPGGALDAIEAGALDGVDRIFGLHCDPRLAVGRIGTRVGALTSAAD
FT                   LVELTLTSPGGHTSRPHLTADLVHGLGTVITSLPALLSRRVDPRSGTVLVWGAVHAGEA
FT                   ANAVPQEGRLCGTLRTADHETWTMLEPLVESSVKSLLAPTGVGYELNYLRGVPPVVNDS
FT                   ESTALLRVGVEAALGAGALANAEQSSGGEDFGWYLEHVPGAFARLGVWSGEGQMRDLHQ
FT                   PTFVADERALFVGIRVMVHAALAALAA"
FT   gene            585597..586490
FT                   /locus_tag="Svir_05730"
FT   CDS_pept        585597..586490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05730"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF559)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95644"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT1"
FT                   /protein_id="ACU95644.1"
FT                   /translation="MWHDRGMRGPVTRRDAAAALGEHALRTALRHGVLTQPWRGVVMHT
FT                   ADLRDLRARAAAAVLFVGEPVVLSGPTALRLHGCDAVPETGPIHVTVPYSRSARSRPGL
FT                   AMHQSRFNSADVIELDGLPVFPLELAIADQLCGRDARRAFAALDQALRMRPGEEGESFR
FT                   SAVRARLTSRADRRGVPRALMLTELATGRADSPPESSLLLTVVEAGFPVPEPQHPIHTI
FT                   DGRLLYVLDLAWEQWRIAVGYDGYEAHEDRAAHDAERGRRLAGRGWLVIRARAEDLRDP
FT                   SRVLRELREAFAQRSR"
FT   gene            complement(586650..587162)
FT                   /locus_tag="Svir_05740"
FT   CDS_pept        complement(586650..587162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05740"
FT                   /product="AIG2-like family protein"
FT                   /note="PFAM: AIG2-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95645"
FT                   /db_xref="GOA:C7MUT2"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT2"
FT                   /protein_id="ACU95645.1"
FT                   /translation="MWGHAECIRSGDAAAATLGVVPLYAAYGSNMDPAQMMERAPHSPM
FT                   AGTGWLEGWRLTFGGEDLYWEGALATIVEDPGSRVFVVLYDVTPLDESRLDQWEGGELG
FT                   LHNKIRLRVQTMDGSVLAWLYVLDAYEGGLPSARYLGVLADAAEAAGAPADYVNDLRTR
FT                   PCKRIGP"
FT   gene            587203..588606
FT                   /locus_tag="Svir_05750"
FT   CDS_pept        587203..588606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05750"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase component"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerisation domain; Pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95646"
FT                   /db_xref="GOA:C7MUT3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT3"
FT                   /protein_id="ACU95646.1"
FT                   /translation="MTKIVIMGGGPAGYEAALVAAQHGADVTVVERDGLGGACVLYDCV
FT                   PSKTFIASSGARASLQSFPELGIQVDSEPRVDLPSVHARVRDLALAQSADIRARLQREG
FT                   VRILTGTARFRDSKPGLATHKIGVTYPETGEEEILDADVVLVATGATPRVLPGAVPDGE
FT                   RILDWRQLYSLPELPEHLAVVGSGVTGAEFASAYTEMGVKVTVVSSRDRVLPHEDADAA
FT                   AVLEEVFSRRGTTVVKQARAERVERTADGVVVHLTDGRKIEASHALMTVGSVPNTSDIG
FT                   LERVGIEPGPGGFINVDRVSRTSAPGVYAAGDCTGVLMLASVASMQGRIAMWHALGQSV
FT                   TPIRLRTVAANVFTHPEISAVGVSQQAIDSGEVPARTIMLPLATNARAKMEGVHHGFVK
FT                   LFCRPATGVVVGGVVVAPNASELILPIALAVQNQLTVDNLALTFSVYPSLSGSITEAGR
FT                   QLMRHDDLD"
FT   gene            588740..589531
FT                   /locus_tag="Svir_05760"
FT   CDS_pept        588740..589531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05760"
FT                   /product="lactoylglutathione lyase family protein"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95647"
FT                   /db_xref="GOA:C7MUT4"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT4"
FT                   /protein_id="ACU95647.1"
FT                   /translation="MIVRDTPYPDGMPCWVDLRVPDPRMAMDFYGALFGWAFADQGDET
FT                   GNYLLCLVNGRIVAGLGGSPPDQQAPPVWTTYLATSNVDATAERVRNAGGRLLTEPTDT
FT                   LWESRMAIAADPTGAVFGLWQAGRVIGAQLTQAPSALMWNECLTRDFSAAEEFYGHVFG
FT                   YAIGRQEDQEPAYGTFVSDERIVGGLGELSPEVPADVPSHWMTYFGVVDTDAVAARAIE
FT                   LDGTVIAPPKDSPYGRVSALSDNQGVAFSVITVTAEPEPEA"
FT   gene            complement(589631..591145)
FT                   /locus_tag="Svir_05770"
FT   CDS_pept        complement(589631..591145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05770"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95648"
FT                   /db_xref="GOA:C7MUT5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT5"
FT                   /protein_id="ACU95648.1"
FT                   /translation="MASYVAAIDQGTTSTRTMIFDHSGQVVASEQREHKQIFPKAGWVE
FT                   HDAEEIWANTRATAAGALANADLTASEIAAVGITNQRETTLVWDRKTGKPVYNAIVWQD
FT                   TRTDRIIEELGALGGGQERYRDKTGLPLATYFSGPKIKWILDNVEGARERAEKGDLLFG
FT                   NMDTWLLWNMTGGVDGGIHVTDPTNASRTLLMDLDTLSWNPDIAADMGIPMSMLPEIRS
FT                   SSETYATTRERGSLRGVPIAGILGDQQAATFGQACLSVGEAKNTYGTGNFVLLNTGTEK
FT                   VMSQNGLLTTVCYKLGTKDPVFALEGSIAVTGSLVQWLRDNLKMIDSAAEIEEHARTVD
FT                   SNGGAYIVPAFSGLFAPYWRSDARGALVGLTRYVNKGHLCRAVLEATAFQSREVIDAMN
FT                   ADSGVPLKSLKVDGGMVVNDLLMQFQADILGVPVIRPKVNETTALGAAYAAGLAVGFWA
FT                   GEDDIRNNWAEDKRWEPNMDEARREREYRNWKKAVTKTFDWVTEED"
FT   gene            complement(591167..592114)
FT                   /locus_tag="Svir_05780"
FT   CDS_pept        complement(591167..592114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05780"
FT                   /product="MIP family channel protein"
FT                   /note="PFAM: Major intrinsic protein; TIGRFAM: MIP family
FT                   channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95649"
FT                   /db_xref="GOA:C7MUT6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT6"
FT                   /protein_id="ACU95649.1"
FT                   /translation="MSVKDTRHRTSSLARLRQNTGGELLAEFLGTAVLILLGCGSVAVA
FT                   LAGLPGSGRQIDAFGPGNWLIIVFGWGLAVVFGVYVAGGVSGAHINPAVTLAFAVRRKF
FT                   SWAKVVPYWIAQLLGAFAGAAVVYAVYADAINAFNAAEGFADRAESVPSFSIFATFPAE
FT                   YFGGGVWGPLVDQIVGTAILVMLIAALIDSRNMSPQNNFGPWVIGFVVTAIGLSFGTNA
FT                   GYAINPARDFGPRLLAYFAGWGEAALPGNGEWFSNYWWIPILGPLVGGVVGILIYDLFI
FT                   GQVLKARETLEGVEGPPAGRVPEPTDATETRRSE"
FT   gene            592272..594035
FT                   /locus_tag="Svir_05790"
FT   CDS_pept        592272..594035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05790"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95650"
FT                   /db_xref="GOA:C7MUT7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT7"
FT                   /protein_id="ACU95650.1"
FT                   /translation="MSSPPVEVRRDEEAKVTVSLGPVNREESWQRLGDEDFDLVVIGGG
FT                   VVGVGTALDAATRGLRVALVEARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRER
FT                   ELMLTTIAPHLVKPVSFLYPLTHRVWERPYTATGLLLYDTMGGARSVPGQKHLTRAGAL
FT                   RMVPALKRDALIGGIRYYDASADDARHTMMVARTAAHYGAVVRTSTQVVGFLREADRVT
FT                   GVRVRDVEDGRETDVRASVVVNCTGVWTDELQHLAGSRGRFRVRASKGVHIVVPRDRIV
FT                   SETGLILRTEKSVLFVIPWRSNHWIVGTTDTDWNLDLAHPAATKNDIDYILSHVNKVLA
FT                   TPLTHDDIEGVYAGLRPLLAGESEETSKLSREHAVARVAPGLVAIAGGKYTTYRVMAAD
FT                   AVDAAAADLPGRPRQSITDKVPLVGADGYHALVNQADQLAAKHGLHPYRVRHLLDRYGS
FT                   LVHEVLAQADGKPELLKPIDSAPDYLKVEAVYAASHEGALHLEDVLARRTRISIEYPHR
FT                   GVDCAKQVADLMGDVLSWSQETRAREVELYEARVKAERESQSEPSDESADARRSAAPEA
FT                   RSGLVDLSATA"
FT   gene            complement(594066..594413)
FT                   /locus_tag="Svir_05800"
FT   CDS_pept        complement(594066..594413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95651"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT8"
FT                   /protein_id="ACU95651.1"
FT                   /translation="MTWLWLTLAGLVLVAGALVPVLPRRERRSDAAETRARSAYLLLGH
FT                   HVDPPPPAPEGDAETEALFRRAIERWHSAGGVLAEATTREEFALAQRIAEEGLDTVAEA
FT                   HARLGLPPPAR"
FT   gene            complement(594410..595297)
FT                   /locus_tag="Svir_05810"
FT   CDS_pept        complement(594410..595297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95652"
FT                   /db_xref="GOA:C7MUT9"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUT9"
FT                   /protein_id="ACU95652.1"
FT                   /translation="MKRIPLWCWATLVGLGAFLWVFTPWEDVSERARTAAQNLGATSVY
FT                   AEPGAPDVVDPERAGKVIGDRAIVVAVFDETPLIEYADEQSPRQALCRDVASLVPTNLV
FT                   VVFAANPDGDYNGSYCHGPDFPAPTLTDDTTDVFFLSLLATAEQSWQYRTSETDLVPQL
FT                   EEFVLAFDTETFKAYGEVPRRGPVNSVYDVWQLVLACLAMVSATVVVFLLLRQLGRALF
FT                   ASRALRPREAGLNARLNRLADRVLHPEGGAPNAAAAKEYVLALREFHDTDRQRGRQRLD
FT                   AVERRIEKIEGMLL"
FT   gene            complement(595294..596619)
FT                   /locus_tag="Svir_05820"
FT   CDS_pept        complement(595294..596619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95653"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU0"
FT                   /protein_id="ACU95653.1"
FT                   /translation="MVTALTWALLLIGALLTPDPALAQRAEDSAAPLPPKLDVEAALAA
FT                   LETEQIYRAPGAVAYLDEELIRAELTDDMRVLVAPFTGPYGAEGHYANSEEYRAQVFRP
FT                   LRDWAEDRGLVLIRVEGLLASSNKGVSAVASDLDGLRRHLGQYDVTSSVWTLVQHAKGS
FT                   DTDAEPPHPMPEWVDPTPQQTAELVERLRRDRVYNAPGREDPFQGSLDLIRESTGFTLR
FT                   VVAFPPVEPGEPMVDYAPALAEHFPDDVILVAYGDWLEIAGPHPVALSSARNYAYGRYQ
FT                   QGPYRAGMVLDDRIGTVLSRADELLTQHPFGRPQPKTVEQLITELAPWLLGGSALVLGG
FT                   VPLAREFGRRIRSARTEREAFRYAKARAFAAIAELGEELLAHRDDPAPYVAAAAERHAA
FT                   ASALFEQATTSAAMKEVHDIADKGSRSLRKRAQHPTGPGTRT"
FT   gene            complement(596700..597218)
FT                   /locus_tag="Svir_05830"
FT   CDS_pept        complement(596700..597218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05830"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95654"
FT                   /db_xref="GOA:C7MUU1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU1"
FT                   /protein_id="ACU95654.1"
FT                   /translation="MEPAEINAGTLYLRQLRADGAIDDRPALVEAFADPVIRNFVRNYV
FT                   VDSVEAAEEYVRRRAEEWKRDQRCSWAVAEPTTGELLGEVGLKELDLAAGTAEVAVWVH
FT                   PSARGRGVATTAVGAAVRFGFGALGLSHIDYVHEPDNAASREVARKSGFTLLGPDGENV
FT                   RWRQTAENG"
FT   gene            complement(597235..597627)
FT                   /locus_tag="Svir_05840"
FT   CDS_pept        complement(597235..597627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05840"
FT                   /product="protein of unknown function (DUF1707)"
FT                   /note="PFAM: Domain of unknown function (DUF1707)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95655"
FT                   /db_xref="GOA:C7MUU2"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU2"
FT                   /protein_id="ACU95655.1"
FT                   /translation="MTVDRPNYRLSDAERKEALDALAEHVRTGRLDVVEYDERSAVVSA
FT                   AKTRRELEPVFSDLPEPRPSVLAAPTRYERDGAVRSQRRRGLSITVAVIVGCALFLLLP
FT                   RLGLLGLLLPVLIAVVVGTIISGRLR"
FT   gene            complement(597697..599472)
FT                   /locus_tag="Svir_05850"
FT   CDS_pept        complement(597697..599472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05850"
FT                   /product="acetyl/propionyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: Biotin carboxylase C-terminal domain;
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95656"
FT                   /db_xref="GOA:C7MUU3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU3"
FT                   /protein_id="ACU95656.1"
FT                   /translation="MPKPATVQKVLVANRGEIAVRVIRAARDAGLGSVAVYADPDRDAP
FT                   HVRMADEAFALGGSTAAETYLVVDKLLDIARRSGANAVHPGYGFLSENADFAQAVIDAG
FT                   LIWIGPSPQAIRDLGDKVTARHIAMKAGAPLVPGTKDPVSGADEIVEFAKEHGLPVAIK
FT                   AAFGGGGRGLKVARTFEEIPELFESATREAVAAFGRGECFVERYLDKPRHVEAQVLADK
FT                   HGNVIVVGTRDCSLQRRHQKLVEEAPAPFLTDEQREIIHSSAKAICREAGYSGAGTVEY
FT                   LVGSDGTISFLEVNTRLQVEHPVSEETTGIDLVREQFRIAEGGVLPYSEDPAPRGHSIE
FT                   FRINGEDAGRNFLPAPGTVTKLVFPQGPGVRVDSGVESGSVIGGQFDSMLAKVIVTGAD
FT                   RQQAIERSKRALDEMVVEGLATVLPFHRAILRDPAFVGDENGFSVHTRWIETEFDNTIE
FT                   PFTAPGDAETEETPRQTVVVEVGGRRLEVSLPGDLALAGGNRAGATKAKPRRRGGGTKV
FT                   TAGGDAVTAPMQGTVVKVAVTEGQQVEAGELVVVLEAMKMENPVTAHKSGTVKDLSIEV
FT                   GQSVNQGAVLLEIKD"
FT   gene            599664..600389
FT                   /locus_tag="Svir_05860"
FT   CDS_pept        599664..600389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95657"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU4"
FT                   /protein_id="ACU95657.1"
FT                   /translation="MVRASPPRVVVATVVLAWVVTIAAQVAAAVWGSTTPEPVRPEPPR
FT                   RAHGVDCGDEVCRVFASTMVNGMSVELLANSDGGVGRLRAGGPASGTVTETGLTSKGVR
FT                   LNHNSLRCATGATPVCLVRGPYDGGMAGEVHVWRGDSWATVDRFFFSDGGVVMLDDVVD
FT                   TALPEVILAREVCVDKTRRGNRLGSCSNVGVLAEVVDLEGDRAGCTVPRTSPGELPGWP
FT                   EVQVRRDDLTECPDDLEAG"
FT   gene            complement(600439..601110)
FT                   /locus_tag="Svir_05870"
FT   CDS_pept        complement(600439..601110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05870"
FT                   /product="MAF protein"
FT                   /note="PFAM: Maf-like protein; TIGRFAM: MAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95658"
FT                   /db_xref="GOA:C7MUU5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU5"
FT                   /protein_id="ACU95658.1"
FT                   /translation="MRFVLASASPARLAVLRAAGVDPDVVVSGVDEEAVTAALSDPTPA
FT                   ELVTALARAKAEDVAGRVSSGDTADPTAAADTPATTDTVVVGCDSMLFIGGELVGKPGT
FT                   VDVARARWRNMAGGTGELLTGHAVVRLRNGDVVARAEGTRATTVRFSTPSAEELDAYLA
FT                   TGEPLAVAGAFTLDGLGGWFVEGVDGDPSSVIGISLPLTRRLLAEVGVSVPHLWSESAP
FT                   R"
FT   gene            complement(601128..601385)
FT                   /locus_tag="Svir_05880"
FT   CDS_pept        complement(601128..601385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95659"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU6"
FT                   /protein_id="ACU95659.1"
FT                   /translation="MSELTESEPTEPVGGDQNVLLRVVRGAPDDAELAALTAVVAGLTA
FT                   TTRNASTPSPRRSRWADPASRLRLPARPARDGWRASAYPA"
FT   gene            complement(601411..603051)
FT                   /locus_tag="Svir_05890"
FT   CDS_pept        complement(601411..603051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05890"
FT                   /product="acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: Carboxyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95660"
FT                   /db_xref="GOA:C7MUU7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU7"
FT                   /protein_id="ACU95660.1"
FT                   /translation="MSSATEPLGTPPAEEPDIHTTAGKLADLYRRYSEAIHAGSARAVE
FT                   RQHARGKKTARERIDMLLDPGSFVELDALARHRSTNFGQERNRPYGDGVVTGYGTIDGR
FT                   PVCVFSQDVTVFGGSLGEVYGEKIVKVMDLAMKTGRPIIGINEGAGARIQEGVVSLGLY
FT                   AEIFRRNTHASGVIPQISLIMGANAGGHVYSPALTDFVVMVDKTSQMFITGPDVIKTVT
FT                   GEEVTLEELGGGRTHNTKSGNAHYLAADEEDAISYVKELLSYLPSNNLSEPPVFDAPAP
FT                   TEGSIADDITDSDRELDTLIPDSPNQPYDMREVISRVLDDGEFCEVQELFAPNIIIGFG
FT                   RVEGHSVGVVANQPTQLAGCLDINASEKAARFVRTCDAFNIPVLTFVDVPGFLPGTDQE
FT                   WNGIIRRGAKLLYAYAEATVPLVTVITRKAYGGAYDVMGSKHLGADINIAWPTAQIAVM
FT                   GAQGAANIVHRKRLAEAAEAGEDVEALRSQLIQEYEDTLCNPYVAAERGYVDSVIPPSH
FT                   TRGHVARALRMLRDKRETLPPKKHGNIPL"
FT   gene            603157..603984
FT                   /locus_tag="Svir_05900"
FT   CDS_pept        603157..603984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05900"
FT                   /product="birA, biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /note="PFAM: Biotin/lipoate A/B protein ligase family;
FT                   TIGRFAM: birA, biotin-[acetyl-CoA-carboxylase] ligase
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95661"
FT                   /db_xref="GOA:C7MUU8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU8"
FT                   /protein_id="ACU95661.1"
FT                   /translation="MTTPQKIDAERLRSRLLAPAGPYAAIDVVSRTGSTNADLRVRAAE
FT                   GASDRTVLLAEEQTAGVGRRGRTWASPAGSGVYLSVLLRPAEVPPASLGSLAMVAGLAL
FT                   TDVAAELGVDAVLKWPNDMLAGPDRAKCAGVLAEAVSTGDSAVVCGIGLNVLPLREPVS
FT                   PGPGGQPATSLADQGARTTDRTEVAASLLAALHERELAWRRARGDLEMAGLLDTYRERC
FT                   ATLGREVRLEITGGRSRYCRVVDIHPTGALVVDEDGFWSTVFAADVVHLRPAS"
FT   gene            604092..604703
FT                   /locus_tag="Svir_05910"
FT   CDS_pept        604092..604703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05910"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95662"
FT                   /db_xref="GOA:C7MUU9"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUU9"
FT                   /protein_id="ACU95662.1"
FT                   /translation="MFEVAYPDRLLSEGEQVVAHKHPHFKMLIFPTLALVVTAVAGGYL
FT                   AWQATDFAAPWDTVVLITIAVVGGILIVWLFLTPFVRWRTTHFVVTTDRVIVREGVIKR
FT                   TGIDIPMGRIHSVRFEHGLVDRIFGCGTLIIESASDEPLTFDDIPQVERMHTYIYRQVN
FT                   DNPYDDYGAPGVRDEPHARPYDPAEEFESDAGRRERYGRA"
FT   gene            604690..605634
FT                   /locus_tag="Svir_05920"
FT   CDS_pept        604690..605634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05920"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: HMGL-like"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95663"
FT                   /db_xref="GOA:C7MUV0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV0"
FT                   /protein_id="ACU95663.1"
FT                   /translation="MGVRELGLPERFPHDGSLPERVTIWEVGPRDGLQNERTTVPVDVK
FT                   LEFLDRLADAGLTTVEATSFVHPKWVPQLADAEELLARLRRRDGVRYPVLVPNERGLDR
FT                   ALAAGVTHVAVFASATESFARRNLNSGLDAQFAMFEPVIARAREAGLDVRGYVSMCFGD
FT                   PWEGIVPTEQVVTVGRRLLDAGCTQLSLGDTIGVATAAAVERLLDAFIEGGVAIADLAV
FT                   HFHDTYGQALANTLAALRKGVTTVDASAGGLGGCPYAESATGNLATEDLVWLLDGLGVE
FT                   HGVDLDALVETSRWMSRQLGRSSPSRVVRALSG"
FT   gene            605648..606211
FT                   /locus_tag="Svir_05930"
FT   CDS_pept        605648..606211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95664"
FT                   /db_xref="GOA:C7MUV1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV1"
FT                   /protein_id="ACU95664.1"
FT                   /translation="MLSLRVLSSGAVGSGNRSDTVCVQPGATAVNSDLRRRGEVVTEHR
FT                   AQVEELLADYRRSREQLAVVHRQLASVSASASSADGLVTATVGARGVLTDLVIDNAAYE
FT                   RYRPAELAAHIVRAAREAAVEAFNGAEEVLVPVLGGDVEPRTVLLGTADLTVDEIVGEK
FT                   PPDDSGEVFEDQNWIDDSEWSRAR"
FT   gene            606193..606537
FT                   /locus_tag="Svir_05940"
FT   CDS_pept        606193..606537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95665"
FT                   /db_xref="GOA:C7MUV2"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV2"
FT                   /protein_id="ACU95665.1"
FT                   /translation="MVTGPMSAQDGFAVDPQRLQAGAAEFDTFAERARALARGLADELD
FT                   DTGTPWGTDAVGDSFAAVHVGPANRTRELVEGLAGALAEFGEALAEAAAAYDAADADAA
FT                   EAVREPGRTR"
FT   gene            606549..608561
FT                   /locus_tag="Svir_05950"
FT   CDS_pept        606549..608561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95666"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV3"
FT                   /protein_id="ACU95666.1"
FT                   /translation="MGIELPAELAEIARVTGVSWPEADEDALRTQAQGWRRAAQELTAL
FT                   ARDADVCVTRVFEALSGPAAEAAQARWSTLGDADTGLLAEAIKGATEAADRLDHAAEQV
FT                   GRAKVEIVRQLVEAAQTRDATLVAADTGHPTALLGLETVLRDAAVNLGNVTSELIDAVG
FT                   ADPASTPDLEGRPGPVDAAGVDGAEAAPAGESADETGTEHGAASVSAEHADGAAESDEP
FT                   DEESGTEDTGPISLAQAPTPPTGQRFPQFIASEAPTPSSGTAFASGPVAPPPSGQQQVG
FT                   PPVPGVPGPVAAEPWVRPGQTHLSGFAGAPVAPSALPNAGQYAPPPQWGGYAPQGAVGA
FT                   SYVPMPPPGHGGAPPGPGMSPAVPPAQPGVPPGAPGRPVSWHSPYPAAPYAPQAQPWPQ
FT                   ASGPHPGSQHRFAAPQPAPQQPVPQPHQPRPHPGAAAVPVGAPRQERESVVALFVVHMF
FT                   PIGHLPVASDRPARQLPVPESDDCGVARFAPHDHPRSDEIDPGHALTVLRGGGRYPAPP
FT                   PAEVLPCPPAELTDAYDPLGGLTESEWNHRYLVRDGERPEYAWPTPEQYPEGCHEPGEA
FT                   VVLEEGTILDRFGTAYGRVFAADGTGFPRRGLPPAHLDSGYRRYRVLRELPVWRAVSAP
FT                   WFGQPGGGVRYRTMYSAAELVALGYLADITFEERA"
FT   gene            608558..608827
FT                   /locus_tag="Svir_05960"
FT   CDS_pept        608558..608827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95667"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV4"
FT                   /protein_id="ACU95667.1"
FT                   /translation="MNTESIKRWLDAVGVPEEVVSIGAETDNAWCLLRSEEPGGGEVTW
FT                   EVFWREQGNRYDWARFTNEQVACHYLFGRLAWAQVARGAVGVLP"
FT   gene            complement(608924..609736)
FT                   /locus_tag="Svir_05970"
FT   CDS_pept        complement(608924..609736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05970"
FT                   /product="histidinol-phosphate phosphatase"
FT                   /note="PFAM: Inositol monophosphatase family; TIGRFAM:
FT                   histidinol-phosphate phosphatase HisN, inositol
FT                   monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95668"
FT                   /db_xref="GOA:C7MUV5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV5"
FT                   /protein_id="ACU95668.1"
FT                   /translation="MTVLRYSVDLALAQRLADAADAITTSRFRALDLNVDRKPDRTPVT
FT                   DADTAVEDAVRKLLAAERPDDAVAGEERGGSATAPGRVWVVDPIDGTKNFLRGVPVWAT
FT                   LIALVEDGVPVVGMISAPLLGRRWWAATGEGAWLRDMAGERRISVSRVSSLADATVSTT
FT                   DLGSWVEHHSREAYLRLVDACWESRAFGDFWQHCLVAEGALDIAIEPIVNPWDVAAVRV
FT                   LVTEAGGRFSDLAGTPRFDGGSALSTNGLVHEQALELVTAPEARNAES"
FT   gene            609779..610471
FT                   /locus_tag="Svir_05980"
FT   CDS_pept        609779..610471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05980"
FT                   /product="response regulator with CheY-like receiver domain
FT                   protein and winged-helix DNA-binding domain protein"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95669"
FT                   /db_xref="GOA:C7MUV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV6"
FT                   /protein_id="ACU95669.1"
FT                   /translation="MVLLAEDDPAIAEPLSRALRREGYEVTVVADGPSALDTAAQDRID
FT                   LLVLDLGLPGMDGLEVCRRLRATDRTLPVLMLTARTDEVDFVVGLDAGADDYVAKPFRL
FT                   AELLARIRALLRRRAPEVLESGGVRMDVGARVVTVDGCEVALANKEFELLRVLLAKAGQ
FT                   VVSREEILSEVWNDLDPETSKTSKTLDMHMSWLRRKLARARFGEEGRRAGSECIATVRG
FT                   VGFRFNTD"
FT   gene            610478..611761
FT                   /locus_tag="Svir_05990"
FT   CDS_pept        610478..611761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_05990"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: HAMP domain; His Kinase A (phosphoacceptor)
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95670"
FT                   /db_xref="GOA:C7MUV7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040868"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV7"
FT                   /protein_id="ACU95670.1"
FT                   /translation="MRRRILLAILLAVAVTGAALGVPLGVTTWLLVENLTREDLASSAQ
FT                   RIAAILDDQLADGRALDLGQVRAAVPKNGNLTVVRQGTPPLWYGRRLGPDVVVETVPIA
FT                   QNGTVRLAIPAEPMRTQQTQVAAAVLLVVVLSVGMGTVVATVTARRLAQPLRHVADRAA
FT                   RLGSGDFRPDRRRYEVPELDMVADALDASATALAQLVQRERQLVGDVSHQLRSRLTALQ
FT                   LQLEPLTAHPDPEVTESARAVQEQADRLTEVLDELLAAARAASEVGAEPIDLSGLLSEI
FT                   VDEWRQLFKRRNRTLRLKAGEGLWARATPGRLKEILGVLLDNSIKHGAGTVTVTARRGE
FT                   NDNTVVVQVQDGGTGIPDDLAAHVFERGFSGAGSTGVGLALARALAEADGGRLELSVRS
FT                   PATFSLFLRVPRPSDVAGVSWPAERVPR"
FT   gene            complement(611791..612333)
FT                   /locus_tag="Svir_06000"
FT   CDS_pept        complement(611791..612333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06000"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95671"
FT                   /db_xref="GOA:C7MUV8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV8"
FT                   /protein_id="ACU95671.1"
FT                   /translation="MAVVESVLARVPEPLRSVLVKHRELVKFVVVGSTTFVVDNGIWYL
FT                   LKLTILNTKPTTAKAIAILIATIVSYVLNREWSFRTRGGRERAHEATLFFLVSGVAVAI
FT                   NLVPLYMSRYVLNLEVPHVSLFVQEIADFASGSVIGMLLAMAFRFWGFRRWVFPDELGR
FT                   KRRETTTDDAPTTVPRH"
FT   gene            complement(612343..614829)
FT                   /locus_tag="Svir_06010"
FT   CDS_pept        complement(612343..614829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06010"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95672"
FT                   /db_xref="GOA:C7MUV9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUV9"
FT                   /protein_id="ACU95672.1"
FT                   /translation="MATDSASPHGRSDADLIASVRAGRIEEYGALYERHVKAATRLARQ
FT                   WYPMDRVTADEVVAEAFATVLDTLREGKGPDSAFRVYLLSTVRATAANRVRGAKPIGGA
FT                   TLSPTPAESERTSPTGYETSFPPSAVPSTPSSASPASPQASPDLAFGDREHLERSLIAR
FT                   AFSRLPERWQAVLWHTVIEQESPSDIAPLLGLSPNTVSALAYRAREALRQECLRAHLAE
FT                   TSAHRCRATASKLGVWARDGLSLRERAQVEQHLDHCARCRALADELADVNASLRGVVAL
FT                   LVLGGAAFGYLAATGGVASAVTTGSPAAVTGPRHFLGVAVSGVALATAIAVALTAGGVN
FT                   GAPVAQQSPEPTHEQQPPTTSPPSAPSVSPSPSTELPSPQPSLPALPVPRPEAGSYQPP
FT                   KASEPIPPPPLPHPPSDGADTEEPRRPPTTPPPSGGVGDDMLPPSPRLTASAPRDGVTL
FT                   DAGGEAAGLDITVRNDGDAVAEGITVELRLPDGVTAVDAPDDGDDEDGGDDGQDDDDAG
FT                   AEDGAEDSGTPDEDGTEDGVTQLAAETATGPADGTARSGSPARARTGSGTATADEGTAG
FT                   KEVTCPAGEGTVTCVVTDPLEPDESALLRFRVAASSTASSGAAVGTVTAADTDPAHFTV
FT                   PITVNRDAADLDVSSAGEYLLVKLRNEGVRQADATVTLTVPARLLTTHRLECETGSDDD
FT                   PLRCESRRPLAPGGTARLWLRLPHSHDGAVTVIGTVGDATVTETVEPNPSLPDLPGPVL
FT                   PGAPDAETPPPEPTRPTEDPASTPAATTPEDPADTITVTPTPSPTSQKHAWSPLAELRK
FT                   WFSRRAGRRIRPRQAT"
FT   gene            615103..616437
FT                   /locus_tag="Svir_06020"
FT   CDS_pept        615103..616437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06020"
FT                   /product="Protein of unknown function (DUF2029)"
FT                   /note="PFAM: Protein of unknown function (DUF2029)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95673"
FT                   /db_xref="GOA:C7MUW0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW0"
FT                   /protein_id="ACU95673.1"
FT                   /translation="MSTTDTQIQTAGGEKHLSLRESLGRLSVRPRSVALLALLPVLAVV
FT                   TGVLGWVFDWRLGVDSAVYRAGALTLLQGESLYEGDTLGSEPWWALLPFTYPPAAALLF
FT                   TPLAFFPVQVAWGVVSAVSFLALALVVRVTIASLPRLVGELPRWASPARATLIFTIVFF
FT                   GLEPVWRTVFLGQINIILMALVMLDVLVVCRRDSRWGGVLVGVAAAVKLTPLIFIPHLL
FT                   FTGRKWDAARALATFAGLQALMFVIVPADATRFWTHTVFNQGRIGPMHWAGNQSLNGLL
FT                   NRVTDLAPWASTAALGIGALLAPFAVWVMLRFHRRGQHLYALLVTAFYALLVSPVSWSH
FT                   HWVWAVPLIVALVARLPRTNPTTAWRSWVLAGSVTVVFVSCVLLVLPNGRNLELHWEVW
FT                   QFVLGSAYLLVPVMLAAALGIRWLTRRRRIAVAAAGADGRPARPN"
FT   gene            616460..617638
FT                   /locus_tag="Svir_06030"
FT   CDS_pept        616460..617638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06030"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="PFAM: ATP-grasp domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95674"
FT                   /db_xref="GOA:C7MUW1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW1"
FT                   /protein_id="ACU95674.1"
FT                   /translation="MDTRTGLPVVGMVGGGQLARMTHQAAIGLGQSLRVLAVSEHDSAA
FT                   LVAGDVTFGQHTDLEALRSFARGVDVLTFDHEHVPGEHVAALEADGVVVRPGSAALTFA
FT                   QNKLLMRERLAAQGFPVPAFAAITGVDDVLKFGESHAWPVVLKAATGGYDGRGVWMVAS
FT                   PDEARALVPELLDAGTRLLVEQKVAMRRELSALVARSPFGQGSAWPVVETVQRNGINTE
FT                   VLAPAPGLTEQRTQQAQELALRIAAELGVVGVLAVELFDTDDGLLVNELAMRPHNSGHW
FT                   TMDGSRTSQFEQHLRAVLDYPLGVTELLSPTVMANVLGAPETPAMSFDERVHHLFARFP
FT                   DVRVHLYGKGERPGRKLGHVNVLGPIGETRQRAKLAAHWLSHAEWLDGYSAH"
FT   gene            617694..618194
FT                   /locus_tag="Svir_06040"
FT   CDS_pept        617694..618194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06040"
FT                   /product="phosphoribosylaminoimidazole carboxylase, PurE
FT                   protein"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95675"
FT                   /db_xref="GOA:C7MUW2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW2"
FT                   /protein_id="ACU95675.1"
FT                   /translation="MARACVGIIMGSDSDWPVMQAAAEALDEFGVPYEVGVYSAHRTPQ
FT                   RMLDYARSAAEHGLRVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLKHLDGLDSLLSIV
FT                   QMPAGVPVATVSVGGARNAGLLAVRMLAVSDVALRGRMERFQDDLEQQVLDKDAALRAR
FT                   VDG"
FT   gene            complement(618208..619848)
FT                   /locus_tag="Svir_06050"
FT   CDS_pept        complement(618208..619848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06050"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95676"
FT                   /db_xref="GOA:C7MUW3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW3"
FT                   /protein_id="ACU95676.1"
FT                   /translation="MPNTTVPHPPGLPTSLTYPDAPVGSLLAGAASRYRDRIAFRHADE
FT                   ELSFSQLWSSACRFGNALRERGVGPGDTVALHLPNCLAFPIAYYGTLLAGATFSPANPL
FT                   LPPKALAEQLADADARVVVTHGGVADALSGLDIELVLTYRPREAAALDFEKFIADAPED
FT                   RPDVEIDAARTLAHLGYTGGTTGRSKGVRLTHRNVVVNALQYVCWGSGSVPVLDDAGEV
FT                   TVTQIGDEAEWTTPLGTGVSINLTPWFHAMGIGGLNIGVLSGASVTIHDRFDPRSYIAD
FT                   AERLRVTSMSGAPALFAALLACPDFHTADLSSVRGITSGAAPMPRAMGEALLARFPDAV
FT                   ITEGYGLTEVTMGATIAPSWRSGVRKVGTVGVPIFDTEVKIMSVDGVEELPPNTPGEVY
FT                   LRGPQVMQGYHNRPEETEAVFADGWLRTGDIGMLDDDGYLSIVDRAKDMLLYKGYNVYP
FT                   RELEELLTALPGVAAAAVVGRPDPNVGELPVAFVVRAPGQDGMTPDALMQAVNEQVLPY
FT                   KRIREVRFVDAIPTSAAGKVLKRRLREQL"
FT   gene            complement(620189..620896)
FT                   /locus_tag="Svir_06060"
FT   CDS_pept        complement(620189..620896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06060"
FT                   /product="conserved hypothetical protein TIGR03089"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR03089"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95677"
FT                   /db_xref="InterPro:IPR017523"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW4"
FT                   /protein_id="ACU95677.1"
FT                   /translation="MSLTEHLLRPLLSSSAARPAITHYDDADGSRIELSVATLANWAAK
FT                   TANWLVEEFDIEPGDEVAVDLPAHWQTAGVLFGAWWCGAHVVQGPAEAAVAFVGPDADG
FT                   SAADATAIVALDPLGRGLTTEPPDGAFDYLSEARACGDDFSPLFPVDDDTPALLGITVA
FT                   ELTARARERATALGIGEGDRVLSTRAWTLPDGVVDAVLAPVAAGAHLVQVTNADPVKVA
FT                   EHRDTERTTVELG"
FT   gene            complement(621009..622553)
FT                   /locus_tag="Svir_06070"
FT   CDS_pept        complement(621009..622553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06070"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain protein"
FT                   /note="PFAM: Cell envelope-related transcriptional
FT                   attenuator domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95678"
FT                   /db_xref="GOA:C7MUW5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW5"
FT                   /protein_id="ACU95678.1"
FT                   /translation="MDKGEKRPTTEGEEHEGASPGQIESEHGPDARSDSDGGMIPDRSD
FT                   TDAADTDSHPGSDDSENSDRDHDGDDGDGAGSGPGARTEPETAEETGESGAGESARGPA
FT                   EEPDAASRAPTRGRGRNRGRKAAKALVRSVGALLSVIALAITGYAYSTLDTLQDNVNTT
FT                   DALRQNDEPDDGEPPPPPEDDGATDILLVGTDARTDMEGNPLPPHVLRQLRTENKPGIS
FT                   TDTLILLRIPHDGAPPTGISIPRDTWVAVSGDEHAKINSVYGTEKYRTANELRREGVTD
FT                   RSEVERRSDQAGRAALVRTVQEFTQVRIDHYAEVNLFGFYLITEALDGVEVCLNHATFD
FT                   TDSGANFAAGRQTVSGGEALSFVRQRNNLPRGDLDRIQRQQAFLASALNKVLSAGTLTD
FT                   TGKLKKLANALRRSLVLDSDLDLLKFARQTRGIASGDFSFVTIPVVDIAAWSPDGKQSI
FT                   VQVDVEEVRKFIAGVVEQGDGRGRDDRTAGERPSGGGSAPQNDGTKITADGVTCVN"
FT   gene            complement(622598..624214)
FT                   /locus_tag="Svir_06080"
FT   CDS_pept        complement(622598..624214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06080"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain protein"
FT                   /note="PFAM: Cell envelope-related transcriptional
FT                   attenuator domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95679"
FT                   /db_xref="GOA:C7MUW6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW6"
FT                   /protein_id="ACU95679.1"
FT                   /translation="MTDGAREPLDTPVIRSKSRLRTIGLIGGRTLVSLLSVVVLALTAY
FT                   GWQMIGTAQSNLATTDVFDDQEPGAKPLDGSVDILLVGIDSRTDAQGNPLPQEVLDMLH
FT                   AGKDEGTKQTDTMILVHIPQDGTSATAISFPRDSWVELAGGYGTNRLNTAFRFAYNHTR
FT                   NTLLAQGETDTEAIEKQAEAEGRKNLIATIEQLIGRPGMIDRYAEVNLASFYEITKAIG
FT                   GIEVCLKQPAKEAKSGINLPAGRQTIEGVQALAFVRQRTGLPRGDLDRINRQQAFLSGL
FT                   ARKMLSKEILLNPSRLSEVISAVQKSVVVSKDWDLLEFAHQMRNLSGGQIEFHTVPVVQ
FT                   DMYVNGASVLEVDPAQIRAFIDELVPRETEGDPRMDSVPQTVPGAEAYTVHIYNATADP
FT                   SLGEATRTLLASQGFGGESYAQSDPQNSTVIYHAPGEQAGVDALRTALGVDFAAQADPQ
FT                   LAPGTLNLYLGGDFTLPPTTQGAEGLTGVQPLRTGSVGYRAQQQSDTGQSAPESGEPGT
FT                   DEGSEDAEDGPITAGGVPCIY"
FT   gene            624394..625386
FT                   /locus_tag="Svir_06090"
FT   CDS_pept        624394..625386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06090"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95680"
FT                   /db_xref="GOA:C7MUW7"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW7"
FT                   /protein_id="ACU95680.1"
FT                   /translation="MRVLVTGGAGFIGSHYVRQALSGAYDSLRDAEVIVLDKLTYAGNR
FT                   SNLDPVADSPRFRFVQGDICDSALVREVMTGVDLVVHFAAESHVDRSIVGSADFVLTNV
FT                   LGTQTLLQAACDAEVGKFVHVSTDEVYGSIDEGSWPEDHPLEPNSPYSASKASSDLIAR
FT                   SFHRTYGLPVCITRCSNNYGPYQFPEKVIPLFITNLLDGKRVPLYGDGLNVRDWLHVDD
FT                   HCRGVQLVADRGRPGEIYNIGGGTELTNRDLTKRLLDAVGADWEMVEQVEDRKGHDRRY
FT                   SVDITKISTELGYRPEVDFETGLAETVRWYTENRQWWEPLKERAALTAR"
FT   gene            625451..626392
FT                   /locus_tag="Svir_06100"
FT   CDS_pept        625451..626392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06100"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family;
FT                   TIGRFAM: dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95681"
FT                   /db_xref="GOA:C7MUW8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW8"
FT                   /protein_id="ACU95681.1"
FT                   /translation="MSRSDDTEGAGIAVLVPGGRGQLGRDLVAAAAALGDRIDVIAPGS
FT                   AELDVTEPGAVVEAVTDLATGAAQSGRRAVVINAAAYTAVDAAEEDEGTAFSVNADGPR
FT                   MLAAVCSSRGVPLVHVSTDYVFSGTADRPYEPEDALGPRSAYGRTKAAGENAVLGSGAR
FT                   AWVVRTAWLYGAGGNNFVRTMMELESRRDTVSVVDDQCGSPTSSADLARGLLELADRIT
FT                   SGRGPRRKVLHCTNSGQTTWFGLARAVFEELGADPGRVRPCSTEDFPRPAPRPPYSVLS
FT                   NAAWLESGLTPLRPWREALTAFFAELRSRRTA"
FT   gene            complement(626389..627474)
FT                   /locus_tag="Svir_06110"
FT   CDS_pept        complement(626389..627474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06110"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95682"
FT                   /db_xref="GOA:C7MUW9"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUW9"
FT                   /protein_id="ACU95682.1"
FT                   /translation="MAKRELRVLLDGTPLLGHRTGIGRYTASLSEELASLSGVDTRAVG
FT                   FTLRGWRGLRSVLPHGVRARGMPVAARLLRASWLRSNFPPVETFAGRADVVHGTNFVLP
FT                   PTLRAARVLTIHDLAFLDAPEELAPSDHNLPELVRRGAAGADVICTPTAAVADSVAERL
FT                   DVDRDKIEVTPLGVDAGWFTGRPPGEERRLRLGLPDEYLLFAGAPGPRKGLDWLLRAHA
FT                   TDSSLPPLVFAGPGNFPVTERTRHIGYLSDVDLQRVVAGASALVLPSRDEGFGLPILEA
FT                   MACDVPVVCTDVPSLREVSGGLARLVQYGDVDGLAEALRQAVDEPSAASTSATRRAHAA
FT                   SFTWRRCAEATLAAYRRAVSS"
FT   gene            complement(627467..629983)
FT                   /locus_tag="Svir_06120"
FT   CDS_pept        complement(627467..629983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06120"
FT                   /product="predicted glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferase family 2; Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95683"
FT                   /db_xref="GOA:C7MUX0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX0"
FT                   /protein_id="ACU95683.1"
FT                   /translation="MLAQGETAQPSVSVVVVNYRGADDTIACLRALSELDYPRLEIICV
FT                   DNASPGDDADRIRAAVPSATLIAAERNLGFAGGCNLGARHAQGTVLAFLNNDARPHPRW
FT                   IDAAVTALRADPTVAAVASKVLDLDGEKADFVDGGLTWFGMGYKRHADTPIADLPQAEH
FT                   DTAKDVLFATGSAMFVRASVFAELGGFDDDFFMFYEDVDLGWRLNLRGWRVRYEPASIA
FT                   YHRHHGTMSAVDAPDSGRETFLLERNALCALYKNLSDDTLAKVLPAALALTVRRATARG
FT                   ELDPALLDLASGVGPPETTPVPVSRSALAGVLAIDAFVERLPALAEARAEEQAKRVRTD
FT                   ADLLPLLRKALEPAYPLPRYLAAHDILTEVFGIEDAFGSRRSICVITGDTLTSRMAGPA
FT                   IRAWNIADVLSREHDVRLVTVNPVADPPPAPFPVVAASRHELDHHVAWADIVILQGHIL
FT                   ELAPSLKHEYAHKIVVCDVYDPMHLELLEQGRDAPDDIREADLAGVTKVLDAQLERGDF
FT                   FLCASERQRHLWLGHLTALGRLSPRLYDADPTTRSLLAVVPFGLSPEPPRRTGPGLRAK
FT                   LGIAADDRVVLWAGGVYNWFDPLTLIRAVDLLSTECPDVRLVFLGMKHPNPEVGEMDIA
FT                   GRTQRLADKLGLTGKHVFFNEGWVPYDERQNWLLDADCGVTTHFEHVETMFAFRTRVLD
FT                   YLWAGLPIVTTDGDAFADLVRDERLGVVVPAEDPEELAKALKRCLYDTEFAQGCRERMV
FT                   AVAERFTWPNVLRPLVEFCRDPRPAADRLPGGDHLAPSPPKSAAELVRRDLALVRSYLA
FT                   EGGPSELARRVKGRVLKLARRGLRRG"
FT   gene            complement(630009..630980)
FT                   /locus_tag="Svir_06130"
FT   CDS_pept        complement(630009..630980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06130"
FT                   /product="predicted glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95684"
FT                   /db_xref="GOA:C7MUX1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX1"
FT                   /protein_id="ACU95684.1"
FT                   /translation="MPTDVPVTTSHPVATTVVVVTWRGADHIADCLDGLTAQDRPHRTI
FT                   VIDNASDDGTSVVLARHPSRPRVLRLPRNTGYAGGVAAALPYVDTPFLAWLNDDAVPEP
FT                   GWLSALEDTLRADGRLAAVASLLLRPDGTPQSYGVCLTADGHGADLTEPRPPFGFCGGA
FT                   VLLRTDTLREVGGVPAEYFCYYEDTDTAWRLRLAGYDIAVARDAVVVHRHGASTRPGST
FT                   RFHRWNERNRLLTLLRCAPITVAARELARFAALTAVLPLRRRGWSRHGAAVPTAANFRV
FT                   ALRCRVLADIAVRLPATLRARAAVGRRSVTGRAEVWHRWAGQ"
FT   gene            631021..632160
FT                   /locus_tag="Svir_06140"
FT   CDS_pept        631021..632160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06140"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95685"
FT                   /db_xref="GOA:C7MUX2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX2"
FT                   /protein_id="ACU95685.1"
FT                   /translation="MPELVVVAEQLLAAVPGGTGRYTAQLLRALAATAPPGWTVSSVVA
FT                   RRPDVEAARVEGVAGPRVLPLPPRALVASWEAGIPLWPGGDAVHAPTPLAPPRSPRGRT
FT                   LSVTVHDTVPWTHPETLTPRGVSWHRRMVERAARRADTVVVPTEAVARDLTARVPMCAR
FT                   VRVAPHGVTDLGPPTPVPGLPRRYVLVVGTVEPRKGIDVLVEAVAELTRSGEAATDVPL
FT                   LVVGQPGWGGLDPLRLAARHGLVDGRVRVLGRLTDGELATVLRNATVVAVPSLAEGFGL
FT                   PVLEAMAAGVPVVHSDDPALVEVSAKAAEVVPRGDARALATGLRKVLTDPDLAAGRVAA
FT                   GKARARDFSWHRAATVVWDCHTGKDGGLSDPGQQHGGES"
FT   gene            632170..633318
FT                   /locus_tag="Svir_06150"
FT   CDS_pept        632170..633318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06150"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95686"
FT                   /db_xref="GOA:C7MUX3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX3"
FT                   /protein_id="ACU95686.1"
FT                   /translation="MPEPRVLIDATAVPADRGGVGRYVDSLIAALDEGGARLTVVCQAR
FT                   DAQLYSELAPHARVVHTAQSAATRTARLTWEQTTLPGLARRLAVDVVHSPHYTMPLAGR
FT                   TASVVTLHDATFFTDAGLHSSVKARFFRAWTVTALRRATLCVVPSFATAEELRRVTRVR
FT                   DAELRVIQHGVDVNRFHPPTAEEIQAARDVVGLGAMPYLAFLGALEPRKNVPALIRGFS
FT                   LAVADRPDPPALVLAGQPGWDSQVESALAAAPLRLRVIRAGYLPYDTLAGFLGGAELVA
FT                   YPSLGEGFGLPVLEAMASGACVLTTRRLALPEVGGDAVAYCGVGAGDIAAALRELLDNP
FT                   GRRAELMQAALRRAKEFSWATSAALHREAYDRAWHKHRRAKA"
FT   gene            633383..634249
FT                   /locus_tag="Svir_06160"
FT   CDS_pept        633383..634249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06160"
FT                   /product="predicted glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95687"
FT                   /db_xref="GOA:C7MUX4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX4"
FT                   /protein_id="ACU95687.1"
FT                   /translation="MTEPKNYGDALAVVTVTYSPGETLTRFLDTLEKATERDVQVVLAD
FT                   NGSVDGAPERAAAERDNVRFVPTGGNLGYGGGANAGVASLGDDVGWIVIANPDLEWDPG
FT                   SIDALLEVAQRWPRGGAFGPLIREPDGTVYPSARLLPSLGRGIGHAVFGKIWPRNPWTR
FT                   SYRQETAAPTERTAGWLSGSCLLLRREAFDAVGGFDTRYFMYFEDVDLGDRLSRAGWLN
FT                   VYAPSASVMHIGGQSTSQASARMLAAHHDSAYRYLADRYTGLRWKPVLAAIRIGLAIRL
FT                   KLETRKA"
FT   gene            complement(634345..634788)
FT                   /locus_tag="Svir_06170"
FT   CDS_pept        complement(634345..634788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95688"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX5"
FT                   /protein_id="ACU95688.1"
FT                   /translation="MDPRDRADAVLARAGARKGVVTPDNMTSPMDSASTLKIPRAVVQR
FT                   IDAEPDPDTTTKLPASMIRANDTERRESHLAEADQTTSLREATDQATVTQPLRIQPEGA
FT                   DGPNAASAGAEQEEPGTEEGGLVPTVTKQQQPQSYVARRLEGL"
FT   gene            634941..636020
FT                   /locus_tag="Svir_06180"
FT   CDS_pept        634941..636020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06180"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   family protein"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95689"
FT                   /db_xref="GOA:C7MUX6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX6"
FT                   /protein_id="ACU95689.1"
FT                   /translation="MASVSGVDAVILVGGKGTRLRPLTLSAPKPMLPTAGVPFLSHVLS
FT                   RIRAVGITHVVLGTSYRAEVFEEHFGDGSELGLDIEYVAESEPLDTGGAIRNVADRLRN
FT                   DDVVVFNGDILSGADLGALVTTHREVAADVTLHLQRVDDPSRFGSVPTDADGRVTAFLE
FT                   KTPNPPTDQINAGCYVFRRSVIEEIPAGRPVSVERETFPGLLESGRHVHGFVDDSYWLD
FT                   VGTPEAFVRGSADLVTGVAPTEALPGPTGERLVLDGASVADDAVVTDGSTIGAGAYVAS
FT                   SAQVRGSVLFDGASVAEGAVVERSVLGKGARVGKGAVLRGVVVGDGASVGADCELLDGA
FT                   RVWPDVELPESAIRFSSDA"
FT   gene            636013..636924
FT                   /locus_tag="Svir_06190"
FT   CDS_pept        636013..636924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06190"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95690"
FT                   /db_xref="GOA:C7MUX7"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX7"
FT                   /protein_id="ACU95690.1"
FT                   /translation="MPELSRCWRPAYPLDAVTVLSPLRRGRGDPCLRHDDGGRTWVTGN
FT                   TSEGPGTLVFRVCGDGTVEARAWGDGAQVLLDGLPDLLGAADDDSGFVAHHDVVARARR
FT                   RLPSLRLTSTGRVWDALVPAVLEQKVTRYEAHRSWRELCRWFGAPAPGPVPEGLRIPPT
FT                   PAAILSISDWQWHRAGVDLRRRSTLVVAARVAHRLEEAVALRGERGRALLRAVPGVGVW
FT                   TAAEVAQRAWGDADAVSFSDFHVPSIVGYALVGRALDDEGLAEVLAPYAPQRQRVVRYL
FT                   QAMGYSRPRFAPRYPVRDYRAI"
FT   gene            636968..637579
FT                   /locus_tag="Svir_06200"
FT   CDS_pept        636968..637579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06200"
FT                   /product="conserved hypothetical protein TIGR00370"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; TIGRFAM:
FT                   conserved hypothetical protein TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95691"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX8"
FT                   /protein_id="ACU95691.1"
FT                   /translation="MRLLPCADAGLLVELDDLDQVLGLHAALQADPPPGVVDLVPAART
FT                   LLLRFDPDTADADEIERAVRRARPTRVAEREAELVEIPVTYDGEDLAEVASMAGLTPRQ
FT                   VVAAHTGTEWTVAFGGFAPGFGYLTGAMWPFDIPRRTESRTTVPAGAVALAGAFSGVYP
FT                   RSSPGGWQLIGRTELIMWDTDRDPPALLRPGVRVRFVEVR"
FT   gene            637579..638451
FT                   /locus_tag="Svir_06210"
FT   CDS_pept        637579..638451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06210"
FT                   /product="biotin-dependent carboxylase-like protein"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; TIGRFAM:
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95692"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUX9"
FT                   /protein_id="ACU95692.1"
FT                   /translation="MVSAIPAELEVMEPGLLATVQDLGRPGLAGIGVGASGAADRTSFR
FT                   LANRLVGNPEDAAAVEVTFGGFAARARRDLVVAVTGAPCPVTVGDRQGAVNSVLFVRAG
FT                   ECLRLGRPERGLRSYVAVRGGLAVERVLGSASTDVLSGVGPPPLRTGHVLPVGIPRLPL
FT                   PDIGFAPVPPLPEDELVLRVVPGPRTDWFADDALTTLFGESYEVSSRSNRIGIRLEGPA
FT                   LRRTRADELPSEGMVPGALQVPPSGRPTLFLADHPVTGGYPVIAVVVASDVDKAAQARP
FT                   GMRIRFTPR"
FT   gene            complement(638781..639326)
FT                   /locus_tag="Svir_06220"
FT   CDS_pept        complement(638781..639326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06220"
FT                   /product="NUDIX family protein"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95693"
FT                   /db_xref="GOA:C7MUY0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUY0"
FT                   /protein_id="ACU95693.1"
FT                   /translation="MVSPLHTEATATLEAWKPESAAQEALRQSYLGFLAAREDACERSC
FT                   AAGHLTASTVVLDASGEHVLLTLHPRVGRWLQLGGHCEPEDSSLAEAALREATEESGIS
FT                   GLRLVPEPLHLDVHPVTCSLGVPTRHFDVRFVAMAPEGARPVVSDESEELRWWPVRELP
FT                   PDSEDLTELIAAALEAKP"
FT   gene            complement(639320..640666)
FT                   /locus_tag="Svir_06230"
FT   CDS_pept        complement(639320..640666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06230"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /note="PFAM: F420-0:Gamma-glutamyl ligase; Nitroreductase
FT                   family; TIGRFAM: F420-dependent oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95694"
FT                   /db_xref="GOA:C7MUY1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR019943"
FT                   /db_xref="InterPro:IPR023661"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C7MUY1"
FT                   /protein_id="ACU95694.1"
FT                   /translation="MSEHAATRIEILPVEGLPEFRPGDDLTGAIARQAPWLRSGDVVVV
FT                   TSKVVSKVEGRLVRVPSDPQARDKARRQLIEQESVRVLARIGRTVITENHLGVVQAASG
FT                   VDASNVDRSEVALLPADPDASALALRNGLRERLGVEVAVVITDTMGRAWRVGQTDAAIG
FT                   SSGLRVLRSYAGEYDAQGNELAVTEIAVADEVAAAADLVKGKLTGVPVAVVRGLSIGDD
FT                   IPGAATARDLVRPAEEDLFRLGTAEAIAQGRREAVLVRRSVREFTGDPVAPEALRRAVA
FT                   AALTAPAPHHTRPVRFGWLRTRTQRERLLDAMRQAWRADLESDGFTEEQITKRLRRGDI
FT                   LYTAPEVVVPFLVPDGAHVYRDDRRNACERTMFTVAGGAAVQALLVALAAEGLGSCWIG
FT                   STIFAPDVVRQTLGLPEDWHPLGAVAIGHPTTPLSPRQPRELAEGLVEW"
FT   gene            complement(640659..641627)
FT                   /locus_tag="Svir_06240"
FT   CDS_pept        complement(640659..641627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06240"
FT                   /product="LPPG:FO 2-phospho-L-lactate transferase"
FT                   /note="PFAM: Uncharacterised protein family UPF0052;
FT                   TIGRFAM: LPPG:Fo 2-phospho-L-lactate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95695"
FT                   /db_xref="GOA:C7MVH6"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVH6"
FT                   /protein_id="ACU95695.1"
FT                   /translation="MGGARFLLGVKAALGLPPVGEGESPHEITALVNTGDDVWMHGLRI
FT                   CPDLDTCMYTLGGGVDPERGWGHADETWTVHSELAAYGAEPTWFSLGDKDIATHLIRTR
FT                   MLRAGYPLSAVTEALCDRWRPGVRLLPMSDDRVETHVVVDDPDEPGQRKALHFQEWWVR
FT                   YRAKLPAHSIVPIGAEEAQPAPGVLSAIEEADAVLFAPSNPVVSVGTVLSVPGVREALR
FT                   RTKAGVVGVSPIIGDKPLRGMADACLKAIGVDTSAEAVGRHYGSRRDSEDGLLDGWLIH
FT                   EGETAEVPGVTVRAVPLIMSDVEATAAMVRAALEVAGVDSE"
FT   gene            642281..642601
FT                   /locus_tag="Svir_06250"
FT   CDS_pept        642281..642601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06250"
FT                   /product="ferredoxin"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95696"
FT                   /db_xref="GOA:C7MVH7"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVH7"
FT                   /protein_id="ACU95696.1"
FT                   /translation="MTYVIAEPCVDVLDKSCIDECPVDCIYEGERMLYIHPDECVDCGA
FT                   CEPVCPVEAIYYEDDVPDEWAAYTKANADFFEELGSPGGAAKVGKVAHDPQWIKDLPPQ
FT                   GE"
FT   gene            642598..643689
FT                   /locus_tag="Svir_06260"
FT   CDS_pept        642598..643689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06260"
FT                   /product="aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95697"
FT                   /db_xref="GOA:C7MVH8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVH8"
FT                   /protein_id="ACU95697.1"
FT                   /translation="MSGPKLPDFPWDSLAGHAATARAHPGGIVDLSVGTPVDPVPDSIR
FT                   VALASVSDIPGYPATHGTPELRETVVEALRRRHGVTGVEPDAVLPTIGSKELVAWLPTL
FT                   LGAGEGKTVVIPELAYPTYEVGALLAGASIVRADSLTALGPARPALLWLNSPSNPTGKV
FT                   LGVEHLRKVVEWARERGTVVVSDECYLALGWDAEPVSILHPDVHGGSLDGLLAVHSLSK
FT                   SANLAGYRAGFVTGDPELVRRLLEVRKHAGMIVPRPVQEAMRAALADDEALSEQRRRYA
FT                   ARRAVLRPALEKAGFRIDDSEAGLYLWATRGESAQDTLSWLAERGILAAPGTFYGPRGH
FT                   SHVRVALTATDERVNAAAERLAE"
FT   gene            complement(643902..644888)
FT                   /locus_tag="Svir_06270"
FT   CDS_pept        complement(643902..644888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06270"
FT                   /product="tetrahydrodipicolinate N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95698"
FT                   /db_xref="GOA:C7MVH9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVH9"
FT                   /protein_id="ACU95698.1"
FT                   /translation="MSAANPNPETTGATGVGLATVTNDGTVLDTWFPQPKLTAEAHESR
FT                   TERLSAEQAAEALGEEATSLLGPDEARGVEVVAVRTSIATLAQAPVDAHDVYLRLHLLS
FT                   HRLVRPHGQNLDGVFGLLSNVVWTNHGPCPVEGFEATRLRLRSRGPVTVHSIDKFPRMV
FT                   DYVVPSGVRIGDADRVRLGAHLASGTTVMHEGFVNFNAGTLGASMVEGRISAGVVVGDG
FT                   TDLGGGASIMGTLSGGGKEIISVGERCLIGANGGIGISLGNDCVVEAGLYVTAGTKVKF
FT                   EGRTVKARDLSGISGALFRRNSTTGEVEVVERTGAGVELNAALHAND"
FT   gene            complement(644910..645341)
FT                   /locus_tag="Svir_06280"
FT   CDS_pept        complement(644910..645341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95699"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI0"
FT                   /protein_id="ACU95699.1"
FT                   /translation="MRTRACVVLAAALFTLTGCSGEAGPTPKGTPDPGPAALARKVTVL
FT                   RADDCHTAPTEVRPADCEKYVTQVENIPGNAHKYATGHPRLAEAADTLSSTLRAYRHNN
FT                   CAGSGDADVCTSALTDMASALTDLHTELSALPDVTAQSG"
FT   gene            645378..646454
FT                   /locus_tag="Svir_06290"
FT   CDS_pept        645378..646454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06290"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="PFAM: Peptidase family M20/M25/M40; TIGRFAM:
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95700"
FT                   /db_xref="GOA:C7MVI1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI1"
FT                   /protein_id="ACU95700.1"
FT                   /translation="MPSLDLRSDPVDLTAALVDIESVSGAEAGIADAVEAALRAQAPHL
FT                   EVVRNGDAVLARTNLGRPSRIVFAGHLDTVPVNDNLPSRRTGSGDDEVLHGLGSVDMKG
FT                   GDAVFLHLAATLPEPRHDVTFVFYDCEEVEAERNGLGRIERELPEWLRGDLAVVGEPSN
FT                   AVIEAGCQGTMRVELRVEGVRAHTARAWMGSNAIHALAEPLRRLAEYEARVVEIDGLTY
FT                   REGLQAVRIEGGVAGNVVPDSAVLTVNHRFAPDVSPEQAEARLRKVFDGYELTVVDCSP
FT                   GALPGLSAPAAAELVAAAGGRVAAKLGWTDVARFAALGMPAVNFGPGDPTLAHTKQEQV
FT                   RVVEIRRVAEVLRSLLSG"
FT   gene            646471..647253
FT                   /locus_tag="Svir_06300"
FT   CDS_pept        646471..647253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06300"
FT                   /product="conserved hypothetical protein, DprA/Smf-related,
FT                   family 2"
FT                   /note="PFAM: Possible lysine decarboxylase; TIGRFAM:
FT                   conserved hypothetical protein, DprA/Smf-related, family 1;
FT                   conserved hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95701"
FT                   /db_xref="GOA:C7MVI2"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI2"
FT                   /protein_id="ACU95701.1"
FT                   /translation="MTEVTRNINNGDDSPPERHRGPVVLRRGSQAEKTTTDQRLLDSRG
FT                   PSDWVHTDPWRVLRIQAEFVEGFGALAEIPRAVTVFGSARTPRDHPEYELGRKIGAALA
FT                   EIGFAVITGGGPGTMEAVNRGASEAGGLSVGLGIELPFEQGLNRWVDLGVNFRYFFTRK
FT                   TMFIKYSQAFICLPGGFGTLDELFEALTLVQTKKVTKFPVVLFGSKYWGGLYEWVRDTM
FT                   LAEGKINERDLRLLHVTDDIDEAVGVVKEAYKAWEDTH"
FT   gene            647254..647823
FT                   /locus_tag="Svir_06310"
FT   CDS_pept        647254..647823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06310"
FT                   /product="conserved hypothetical protein, DprA/Smf-related,
FT                   family 2"
FT                   /note="PFAM: Possible lysine decarboxylase; TIGRFAM:
FT                   conserved hypothetical protein, DprA/Smf-related, family 1;
FT                   conserved hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95702"
FT                   /db_xref="GOA:C7MVI3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI3"
FT                   /protein_id="ACU95702.1"
FT                   /translation="MKRICVFCGSASGKDPGYADEAAAVGRLLAERGIGVVYGGGQVGL
FT                   MGVVADAALEAGGEVIGVIPKHLMRAELAHHGLTELHVVEDMHKRKATMARLSDAFLAL
FT                   PGGAGTLEELFEVWTWAQLGLHAKPVGLLDVGGYYTKLVEFLDHMVIEGFLGEASRDLV
FT                   IVGSDPRAVLDAFSRHSYTPVDKWAG"
FT   gene            complement(647836..648507)
FT                   /locus_tag="Svir_06320"
FT   CDS_pept        complement(647836..648507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06320"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="PFAM: Acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95703"
FT                   /db_xref="GOA:C7MVI4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI4"
FT                   /protein_id="ACU95703.1"
FT                   /translation="MLQLLIRGVLAPLAKLAYRPDVQGLENVPLDGPVILAPNHRSAID
FT                   TAVIALVAPRPVRFLGKAEYFTGTGLKGRFVASFLSALGYLPVERGNAMAGIAALKAAR
FT                   EVLEAGETFAIYPEGTRSLDGRLYRGHTGVGTLALETGAAVVPVALHGTEKLLPVGKKI
FT                   PRLAKVSVRFGKPLDFSRYDGLSSSPAIRRAVTDEIMYSIMELSGQEYVDSYHKLPRSA
FT                   A"
FT   gene            648537..649475
FT                   /locus_tag="Svir_06330"
FT   CDS_pept        648537..649475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06330"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95704"
FT                   /db_xref="GOA:C7MVI5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI5"
FT                   /protein_id="ACU95704.1"
FT                   /translation="MARSTSMDERWFRRRTWQSPQWSVSELVSAKRGRTVSVVLPALNE
FT                   EATVGSVVASVRPLVGGLVDELVVLDSGSSDGTAAEAERAGATVVRREEVLVDLAPLPG
FT                   KGEALWRSLAATTGDLVVFLDSDLVDPDPGFVPALLGPLLCEPGVELVKGFYRRPLRLE
FT                   EDELTTGGGRVTELLARPLLAALRPSLSGLVQPLGGEYAATRRLLEALPFACGYGVEIG
FT                   LLLDTEATCGLDALAQVNLGVRKHRNRSLTQLGVMAREILGTALSRCGVDAPGVPELTQ
FT                   FVQVGGEWIPDVSPVPLIDRPPMRQVLAKRT"
FT   gene            649503..649817
FT                   /locus_tag="Svir_06340"
FT   CDS_pept        649503..649817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95705"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI6"
FT                   /protein_id="ACU95705.1"
FT                   /translation="MTTALIYLLVMLLVAAVVFLLASLVFGRGEELAPLAPGSSPTRLP
FT                   AEDITGKDVEHVKYQVVLRGYKMSEVDWVMSRLGAEIDLLRARVAELEAERQNCEASRE
FT                   "
FT   gene            649810..650259
FT                   /locus_tag="Svir_06350"
FT   CDS_pept        649810..650259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06350"
FT                   /product="Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /note="PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95706"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI7"
FT                   /protein_id="ACU95706.1"
FT                   /translation="MSELVASVEVAAPVGTTWLALTDWERQREWIPATTVRVASGNGRS
FT                   VGSRLEAFTGVGGIGVTDTMEIVNWEPPVRCTVRHLGLLVRGTGTFHVQTKGPQRSVFV
FT                   WAEEFTPPFGPVGKVGWMLARPAFTLALRRSLRAFARFAENYTVG"
FT   gene            650259..650840
FT                   /locus_tag="Svir_06360"
FT   CDS_pept        650259..650840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06360"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /note="PFAM: Methyladenine glycosylase; TIGRFAM:
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95707"
FT                   /db_xref="GOA:C7MVI8"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI8"
FT                   /protein_id="ACU95707.1"
FT                   /translation="MGPELVGVDGVARCSWGNTAPDYAVYHDEEWGVPLRGEIALFERL
FT                   SLEAFQSGLSWLTILRKREDFRRAFAGFDPERVAAFDAEDVDRLLADASIVRNRAKILA
FT                   TITNARAVVELDAPLDELLWSFAPEPGRRPRPRTMADVPARTPESQAMATALKKRGFVF
FT                   VGPTTCYALMQATGMVDDHVQGCFRANDRD"
FT   gene            complement(650855..651706)
FT                   /locus_tag="Svir_06370"
FT   CDS_pept        complement(650855..651706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06370"
FT                   /product="Enoyl-CoA hydratase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95708"
FT                   /db_xref="GOA:C7MVI9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVI9"
FT                   /protein_id="ACU95708.1"
FT                   /translation="MTAEKSTEAQTNDSPDTISPPTDDVLLVTDVDGVRTLTLNRPRAY
FT                   NSLTVELKERLLAALRQAAEDDAVRAVVLTGSGKAFCAGQDLKEHVEGLRTGDLAPLST
FT                   VARHYNPIVTAIVDLPKPVIAAVNGSAAGAGAAFAYACDLRIAATSASFSMAFAGVGLG
FT                   PDSGASWTLQRLVGYGKAMELMLLGNKVDSGEALRLGLVNEVVPDDEFPERVRTVAASL
FT                   AAGPTRAYAKIKQTVTRAAESTLAEALAAENAAQTELGGTADHREAVEAFVEKRRPNFT
FT                   GK"
FT   gene            651893..652060
FT                   /locus_tag="Svir_06380"
FT   CDS_pept        651893..652060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95709"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ0"
FT                   /protein_id="ACU95709.1"
FT                   /translation="MAAMKPRTGDGPLEVTKEGRGLVMRVPLEGGGRLVVELTMEEAKD
FT                   LGAALQQATS"
FT   gene            652134..653600
FT                   /locus_tag="Svir_06390"
FT   CDS_pept        652134..653600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06390"
FT                   /product="leucyl aminopeptidase"
FT                   /note="PFAM: Cytosol aminopeptidase family, N-terminal
FT                   domain; Cytosol aminopeptidase family, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95710"
FT                   /db_xref="GOA:C7MVJ1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ1"
FT                   /protein_id="ACU95710.1"
FT                   /translation="MARSPVPSVPTRLIDVEVADRARRGAPVAVLVAEGDDAAHVEVPA
FT                   GVGFSGKAGQVQILPDEDGPRWVVGVGAGTPRHYREAGAAFVRAAHAYADTEADSGGRP
FT                   PVTVQVRPPEQAGAGEYAAFTTGAILGGYRYRVTGSDEPARVRRLRLVAPEGSVDECAA
FT                   AVARAGELARATALARDLANTPSNVKNPAWLADTAQRIADVPGLSVTVRDDEWLAQQRF
FT                   GGMLAVGGGSAHPPRLIELSYRPRGAAAHLLLVGKGITFDTGGISVKPAAGMHLMRTDM
FT                   SGGGAVVAAMRAIATLKPRVRVTALVPAAENAISGSAYRPGDVVRHYGGRTTQIDNTDA
FT                   EGRMVLADALAYGIATFRPDVVVDVATLTGAMKVALGLRTGGLFATDDELADRLLTAGA
FT                   EVGEQWWRMPLSDEYADAIRSEIADVRQGPPGPGGITAALFLREFTAGLPWAHLDIAGP
FT                   ARAESTYAEVVPGGTGFAARTLVQFVASYA"
FT   gene            complement(653591..654508)
FT                   /locus_tag="Svir_06400"
FT   CDS_pept        complement(653591..654508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06400"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: LysR substrate binding domain; Bacterial
FT                   regulatory helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95711"
FT                   /db_xref="GOA:C7MVJ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ2"
FT                   /protein_id="ACU95711.1"
FT                   /translation="MTNEFDDARLTTELAPAAALLRVLKLTSNLTRAAAELGIPQPTAS
FT                   RRLAALSARVGVPLTVPDGRGIRLTRVGRLLADASERAVDILNHGVRQVREEIDPDAGH
FT                   VVLGFLHLLGRSLVPGLLRDFRLEHPRTRFSLVQGSRRDIVDDLAAGTIDLALVAPPPH
FT                   DEDLGSVVLTEQELFVAVPTDHRLADRSSVRLAELADEVFVMLEPGYGLRQITDDLCAK
FT                   AGFTPTVAFEGQESDTVRGLVAAGLGVALLPAFEPHPPPGVAEIRLDPPVTRKISLAWS
FT                   ADRPLSPAAAVFREFVHDRVRTQA"
FT   gene            654609..655826
FT                   /locus_tag="Svir_06410"
FT   CDS_pept        654609..655826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06410"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95712"
FT                   /db_xref="GOA:C7MVJ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ3"
FT                   /protein_id="ACU95712.1"
FT                   /translation="MNARRVTVAVAAAGICSFSLLYAPQPLLPQLAAEFGLDPGAASLA
FT                   VSMGTGGLAAAVVPIAVLSEIVGKRPVVIVSVLASALLGLVLPFAPSYEVLLVLRVLQG
FT                   IAIAGFPGVAAAYLTEVLGRAGVAGAVGAMIAGNTVGGMLGRLVAGGVTERLGWHGALA
FT                   VVGGIGLLCALLTVATLPRVPRASRRDREGAGGVGEATESLGSKLRAVLSGFRVGLRRP
FT                   VLWAQYGVALLAMGSFVALYNAAGFRLTGDPLNLSPAVASLVFLCYAMGSVSSATAGRL
FT                   VARYGRMRCLLMSLALTAVGAAATVWGSLAVVIAGFVVFTGGFFAAHAVANGWAAAEAP
FT                   TQARASASGLYTLAYYLGSSVGGTVGSIVYGYAGWTWLVGTVAVWLGCAAAGVVLLARR
FT                   HASETV"
FT   gene            complement(656040..656699)
FT                   /locus_tag="Svir_06420"
FT   CDS_pept        complement(656040..656699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06420"
FT                   /product="predicted O-methyltransferase"
FT                   /note="PFAM: O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95713"
FT                   /db_xref="GOA:C7MVJ4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ4"
FT                   /protein_id="ACU95713.1"
FT                   /translation="MNSETHITGWVDLGEFIEAYLPEDDVLASARLRAEQLGCPPVSCA
FT                   TGSLLSFLAASLQARAIVEIGTGAGVSGLYLLRGMAKDGVLTSIDIEPEFHRSARQSFL
FT                   DAGYPAGRTRLIIGRAMDVLSRLTTGGYDMVFADASRVEYPGYFDLGVQLLRPGGVIAF
FT                   HNVLAAGRIADPTRREPELLALRDVARAVREDKRLVPTLLPVGNGLLVAAVATPED"
FT   gene            657025..657618
FT                   /locus_tag="Svir_06430"
FT   CDS_pept        657025..657618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06430"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95714"
FT                   /db_xref="GOA:C7MVJ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ5"
FT                   /protein_id="ACU95714.1"
FT                   /translation="MEVPQLPHDSTQTAPVLVEDDATWTPPTWDEVVRQHADRVYRLAY
FT                   RLTGNAHDAEDLTQETFIRVFRSLASYKPGTFEGWLHRITTNLFLDMARRRSRVRMEGL
FT                   PEDTDRLVGDGPSPEQVYSDTHLDPDLQAALDELPPEFKAAVVLCDVEGLSYEEIGATL
FT                   GVKLGTVRSRIHRGRQALKSSLERRRALKQEARV"
FT   gene            657615..658502
FT                   /locus_tag="Svir_06440"
FT   CDS_pept        657615..658502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95715"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ6"
FT                   /protein_id="ACU95715.1"
FT                   /translation="MTVGKGRRWPESHLLPDAVAAFVDQELSLGAQERAAAHLAHCPRC
FT                   AAEVAAQRAASEAVRQARTPSISASFLASLQRIPQTADLPNGPDNLAIGPNGQVMAVQR
FT                   PDHVAGLRDGLPSGALGTSAPLGTSPTVLGNGPRLAGGRKRATQGAGVVVSGLVLSALA
FT                   LVATTNLSEEGARDADPSATPRTDVLPAKFGGHAATDTLKATPLVEETGVAPAESTEPS
FT                   EPLHSSEPGRPSGSAETSEASEASEASETTVTSTVPTSIGMTVSSTSATPVPPSDVVAS
FT                   ATTGAVIAPPGVPH"
FT   gene            658598..660151
FT                   /locus_tag="Svir_06450"
FT   CDS_pept        658598..660151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06450"
FT                   /product="trypsin-like serine protease with C-terminal PDZ
FT                   domain protein"
FT                   /note="PFAM: PDZ domain (Also known as DHR or GLGF);
FT                   Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95716"
FT                   /db_xref="GOA:C7MVJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ7"
FT                   /protein_id="ACU95716.1"
FT                   /translation="MNEPATPNQEESGHQEYRLRPRPVMRPPVDPEAAAVFGRPKGVKG
FT                   SFDLLHRPDTNVCPVSLQTGPPPPALAEAFGRRPGEENVVLQRPDGYGRSDDPAVSDGD
FT                   GVREDEEGPLWASESDPWRDPNSPVVLGAPALREQERAEGDVERPTGPLLSLPEVLFGR
FT                   RVKPTALALLAVVALLIGAGGGVVGWALASAGDSLTGELNFAEAEAAKERPPDSVAAIA
FT                   QKVAPAVVSIEVEAGQSGGVGSGVVIDPQGYILTNHHVVSSAMQDDDTKVTVVFIDGTR
FT                   TRGEIVGTDPKTDLAVLKVNVENPVVIEIGDSDSLAPGDRVMAIGSPFGLENTVTEGIV
FT                   SALNRPVTAPGENGDPPVTYDAIQTDAAINPGNSGGALVDSTGALVGINSMIRTVGDSG
FT                   EGGSIGLGFAIPANQAIRISESLVRDGTVKHASLGVNAASVAANTSRGAQVRNVVPGSP
FT                   AAQAGIKEGDVIVRVGERQVRNAAELTVAVREHDIGESVPVRLVRGGRQLTVEVTLGSD
FT                   "
FT   gene            660198..660611
FT                   /locus_tag="Svir_06460"
FT   CDS_pept        660198..660611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06460"
FT                   /product="twin arginine-targeting protein translocase TatB"
FT                   /note="PFAM: mttA/Hcf106 family; TIGRFAM: twin
FT                   arginine-targeting protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95717"
FT                   /db_xref="GOA:C7MVJ8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ8"
FT                   /protein_id="ACU95717.1"
FT                   /translation="MFDNIGWSEILILIVAGLFILGPERLPEAAAWLGRTVRKIREFAT
FT                   GARQQLREEVGTDLEEFRKPIEELRNLRNLDPKQVVTKHLFDGDPDPLGLNDINGTGNG
FT                   TNGAPQNGGYTAAPRQVEPLKPGEKPPVDPDAT"
FT   gene            complement(660631..661776)
FT                   /locus_tag="Svir_06470"
FT   CDS_pept        complement(660631..661776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06470"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="PFAM: ParA/MinD ATPase like; Domain of unknown
FT                   function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95718"
FT                   /db_xref="GOA:C7MVJ9"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVJ9"
FT                   /protein_id="ACU95718.1"
FT                   /translation="MTTTQEIPRVEDVRTALNSVHDPEIRKPITELDMVKDISVGEDGV
FT                   VTVAIYLTVAGCPLKDTITRDTKAAVSKLPGVRDVHVELDVMSDEQRTELRRKLRGDVE
FT                   EPVIPFAQPGSLTRVYCVASGKGGVGKSSVTVNLAAAMARKGLSVGVVDADIYGHSIPR
FT                   MLGANGKPTKVEKMIMPPQAHGVKVISIGMFTPGNTPVVWRGPMLHRALQQFLADVFWG
FT                   DLDILLLDLPPGTGDIAISVAQLIPNAEILVVTTPQQAAAEVAERAGAIALQTRQRVAG
FT                   VIENMSWFEAPDGSRMEIFGSGGGQTVAESLSKSVGAEVPLLGQVPLDPKLREQGDAGT
FT                   PIVLAEPDSEASKVLINAAEKLSVRARGLAGMMLNVTPAGR"
FT   gene            662144..662662
FT                   /locus_tag="Svir_06480"
FT   CDS_pept        662144..662662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95719"
FT                   /db_xref="GOA:C7MVK0"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK0"
FT                   /protein_id="ACU95719.1"
FT                   /translation="MIVTGPFSSGRQAAGLPRLPTPPSGWPIGSYATYEEAQRAVDYLA
FT                   DNEFQVQDVTIVGVDLMLVERVIGKLSWGRVLGTGALSGAWFGFFVGVLLIMVSRPEEM
FT                   WSPVLLGLVAGVVFGAAFAAMSYAFTRGRRDFSSASQLVAGRYDVLCRPRNAEKGRDLL
FT                   ARLAMGSHN"
FT   gene            662956..664164
FT                   /locus_tag="Svir_06490"
FT   CDS_pept        662956..664164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06490"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95720"
FT                   /db_xref="GOA:C7MVK1"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK1"
FT                   /protein_id="ACU95720.1"
FT                   /translation="MRINVYYAPEDNFQTVVDNCNTQANGRYEIVYHKLPRDADGQREQ
FT                   MVRRLAAGDTSMDVLGLDVTWVPEFAEAGWIEEWTGENKAEAERDVLPGPLKTAQWDGK
FT                   LYAAPKNTNVQLLWYDDRITPEPPRTWEEMMETSRRLREQGKPHEIVFTGAQYEGLVVV
FT                   YNSITESAGGRILSEDGESVIVDEGAVRALEILREVSSSGLTDPSLTNQREDEVRLTFQ
FT                   QGNAAFQLNWPFVYASYASEKPDELQHMKWAPYPGVGDADSGRSTIGGYDLAVSATSRN
FT                   KPEAFEAALCLRSAENQKFSALMDGVPPTIESVYDDTTPLDPSKPADPEDNPTMEMKYP
FT                   MKDAIRDELKDAAVRPLTPAYQNLSIVMAKVLSPPGEIDPERTAAELREQLEEALSSKG
FT                   VIP"
FT   gene            664161..665126
FT                   /locus_tag="Svir_06500"
FT   CDS_pept        664161..665126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06500"
FT                   /product="carbohydrate ABC transporter membrane protein"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95721"
FT                   /db_xref="GOA:C7MVK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK2"
FT                   /protein_id="ACU95721.1"
FT                   /translation="MSDTAASPTATAGSATRVETGERGKAPMSEGKRAERRLGLLLVAP
FT                   AAIVMLAVTGYPILYSVWLSLQRYDLRFPDDREFVWFANYAAVLTNSYWWTAFGVTMLI
FT                   TVVSVAIEFVLGMALALIMHRTLVGRGLVRTVTLIPYGIVTVVAAFSWFYAWTPGTGYL
FT                   ANALTPGSAPLTEQGSSLAIIILAEVWKTTPFMALLLMAGLALVPEDLLKAASMDGANA
FT                   WQRFTKVMLPVMKPAILVALLFRTLDAFRVFDNIFVLTGGANDTSSVSMQTYNNLMKGL
FT                   NLGIGSTMAVLIFIAVAIIAFIFIKVFGTAAPGSDQEGKR"
FT   gene            665126..665974
FT                   /locus_tag="Svir_06510"
FT   CDS_pept        665126..665974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06510"
FT                   /product="carbohydrate ABC transporter membrane protein"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95722"
FT                   /db_xref="GOA:C7MVK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK3"
FT                   /protein_id="ACU95722.1"
FT                   /translation="MAGSGLGTSLAARKARWALIDIIVVVYALVPVLWIVSLSFKTKET
FT                   LADGNFIPREWTLDNYREIFATNEFIRPLLNSIGIALIATLIAVVLGMMAAYAVARLDF
FT                   PGKKLLIGVSLLIAMFPQISLVTPLFNIERELGLFDTWPGLILPYITFALPLAIYTLSA
FT                   FFREIPWELEKAAKMDGATPGQAFRKVIAPLAAPGVFTSAILVFIFCWNDFLFAISLTS
FT                   TEASRTVPAALSFFTGASQFEDPTGTISAAAVVITIPIILFVLFFQRRIVAGLTSGAVK
FT                   G"
FT   gene            665978..667159
FT                   /locus_tag="Svir_06520"
FT   CDS_pept        665978..667159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06520"
FT                   /product="carbohydrate ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95723"
FT                   /db_xref="GOA:C7MVK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK4"
FT                   /protein_id="ACU95723.1"
FT                   /translation="MAEIVLDKVTKRFPDGALAVSEMDLHIKDGEFVILVGPSGCGKST
FT                   ALNMIAGLEDITSGELRIDGERANEKTPKDRDIAMVFQSYALYPHMSVRENMAFPLRLA
FT                   KMDEATVKQKVEEAARILHLTQHLDRKPSNLSGGQRQRVAMGRAIVRNPKAFLMDEPLS
FT                   NLDAKLRGQMRTSVSRLQRKLGTTTIYVTHDQVEAMTLGDRVVVLRSGVVQQVGSPQFL
FT                   YDHPINLFVAGFIGSPSMNFVPATLENGTLNSVLGAVELPDRLRRLAEQANAPREVIMG
FT                   VRPEHFEDVSLLEEGHRRGGATFTATVDVLESMGSEKYAYFTVDTEPVTTAGLTELVAD
FT                   TGAADVPGQGSTVVARLSAASEAREGDQAQVWFDVDKIQLFDPTSGKNLTYEG"
FT   gene            complement(667282..667398)
FT                   /locus_tag="Svir_06530"
FT   CDS_pept        complement(667282..667398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95724"
FT                   /db_xref="GOA:C7MVK5"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK5"
FT                   /protein_id="ACU95724.1"
FT                   /translation="MLRMLTNLKFWALIGALTWLVVVVVIIALNPEYAFHGG"
FT   gene            complement(667432..668523)
FT                   /locus_tag="Svir_06540"
FT   CDS_pept        complement(667432..668523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06540"
FT                   /product="Mg2+/Co2+ transporter"
FT                   /note="PFAM: CorA-like Mg2+ transporter protein; TIGRFAM:
FT                   magnesium Mg(2+) and cobalt Co(2+) transport protein
FT                   (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95725"
FT                   /db_xref="GOA:C7MVK6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK6"
FT                   /protein_id="ACU95725.1"
FT                   /translation="MPAISSLGNLRGRAHGRASRDRRRTGQEKQTSACVVDCGVYINGV
FT                   RQPGEWSHAEAIAEVRKRGEGFVWIGLHEPDEKQIQGIAETFGLHELAVEDAVHAHQRP
FT                   KLERYDDTLFMVFRTIRYVEHDSPTTANEIVESGELMAFLGSDFIITVRHGNHAGLTHL
FT                   RRELDADPERLLPGPAAVLHAIADYVVDHFLVVTERIEDDIDEMETEVFAPRTRITSEQ
FT                   IYLFKREVLELRRAVLPLARPLRRLAEGHSRLIPEEIRSYFRNVHDHVTTVSERVSAFD
FT                   ELLTTLVDATLGKLTLQLNSDMRKITAWAAIIAVPTAIAGIYGMNFDYMPELGFKYGYP
FT                   LTLGVILALCLLLYRIFRKNRWL"
FT   gene            668918..670093
FT                   /locus_tag="Svir_06550"
FT   CDS_pept        668918..670093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06550"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2332)"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95726"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK7"
FT                   /protein_id="ACU95726.1"
FT                   /translation="MADDADDVDGAEKTVRLASGTEMTSSLETIRERLRRFSAEEAAGV
FT                   SPLYEHLAAQAAADDDVAALLTAASGNDARPTLLLAAAHRLLQAEPIHPLSRYYPSLGG
FT                   PAGPDTQTWPLFREFVLDRAEAMRELIARRFTQTNEVGRAAVLFPAVASVAKRVRGPIG
FT                   LLEAGCSAGLLLGMDTFAYRYQCDGGEQLSAGPAKASVGLHCALSVGEGAVFPTLPKRM
FT                   SVRARVGLDRVPVDASDEDELAWLEACVWADQPERVRLLRTAAAAQGRWRPELVTGDVV
FT                   DDLADAAARVPEELPLVVYTSHTLPYLPESRREDFIAALRELAVRRPLWWVALESYEAA
FT                   LRYVLPGRDEFAYSATRRATLGVVSFDGRGMDVELNATATPHGRRMTWCAR"
FT   gene            complement(670136..670561)
FT                   /locus_tag="Svir_06560"
FT   CDS_pept        complement(670136..670561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06560"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95727"
FT                   /db_xref="GOA:C7MVK8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK8"
FT                   /protein_id="ACU95727.1"
FT                   /translation="MSKVGGQTVVATVRCVGGIVFDSSGRLLLVRRGHAPGKGLWSLPG
FT                   GRVETGENDTEAVMRELREETGLAVRPLTLAGTLTRGQYEIHDYTCIVEGGQLRPGDDA
FT                   DDVKWVDSAEFTALDEAGHLTEDLAETLRLWNALPRR"
FT   gene            670733..670903
FT                   /locus_tag="Svir_06570"
FT   CDS_pept        670733..670903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95728"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVK9"
FT                   /protein_id="ACU95728.1"
FT                   /translation="MIAVNAKKLASFAGIALVLFFVIARPTEAAGFVDSIITALRDAAE
FT                   AVITFVSSVFS"
FT   gene            670923..671483
FT                   /locus_tag="Svir_06580"
FT   CDS_pept        670923..671483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06580"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95729"
FT                   /db_xref="GOA:C7MVL0"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL0"
FT                   /protein_id="ACU95729.1"
FT                   /translation="MFAPRDPDEYLLDTERRVIRVRRHWSCLIWQTFEAVALIAVCVMI
FT                   SYILPPAMWLMQNVLWYAALFLVLRFAYQVIEWWVERLVVTDKRFVMTKGVWTTQVLMM
FT                   PLTKVTDLTYERPFLGRILGYGTMIVESAGQIQALNRIEYLPRPEEFYDTISELVFGDK
FT                   QKQAERFSMIKAQRAARRGKVVG"
FT   gene            671509..672396
FT                   /locus_tag="Svir_06590"
FT   CDS_pept        671509..672396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06590"
FT                   /product="predicted metal-dependent phosphoesterase, PHP
FT                   family"
FT                   /note="PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95730"
FT                   /db_xref="GOA:C7MVL1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL1"
FT                   /protein_id="ACU95730.1"
FT                   /translation="MVDVRIDLHTHSAVSDGTDSPAELVRIAAESGLDVIALTDHDTTA
FT                   GWEAAAAALPPGLRLVPGAELSCELPAADGRKVSVHVLAYLFDPDAPALVAEQRRLRQE
FT                   RRERLRAMAERMAADGLPVDPDEILAGLAPDAPAGRPHLARALVRAGVVENVNEAFARF
FT                   LGVGRGYYVPRMDTPVETAVDMIAAAGGVTVLAHPFANSRGPAVSEEAIGELAERGLAG
FT                   VEVDHPEHDAKARKRLRALADDLGLVRTGSSDYHGANKTIAIGQETTDPEQFEALLARA
FT                   GDASQRAGTRRTAP"
FT   gene            672396..673016
FT                   /locus_tag="Svir_06600"
FT   CDS_pept        672396..673016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06600"
FT                   /product="conserved hypothetical protein TIGR00427"
FT                   /note="PFAM: MarC family integral membrane protein;
FT                   TIGRFAM: conserved hypothetical protein TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06600"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95731"
FT                   /db_xref="GOA:C7MVL2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL2"
FT                   /protein_id="ACU95731.1"
FT                   /translation="MTQVFDVTLFLEASITLLVIMDPPGTVPVFLSLVGRKPPAARAKA
FT                   ARQAVLVSLLVITLFAVAGEFILAYLGIGIHALQGAGGLLLLLVALDLLTGRGSSQPEA
FT                   AEDVNVALVPLGTPLLAGPGAIAATIVFVRQTEGDIDGYLALGAAIIVVHLGLWACMRF
FT                   SGVLIKVVRESGITLLAKIAGLLLAAIAVDLVADSVRGFIEGT"
FT   gene            673020..673880
FT                   /locus_tag="Svir_06610"
FT   CDS_pept        673020..673880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06610"
FT                   /product="RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06610"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95732"
FT                   /db_xref="GOA:C7MVL3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL3"
FT                   /protein_id="ACU95732.1"
FT                   /translation="MGQLGFDFGIEPRPLIKVTPARLSLYDDCPRRFRMTYLDQPAPSR
FT                   TGPWAHTTLGAVIHNALRELFALPASERTPERAEALVSRHWRSGGFADAEQVARYAEAA
FT                   RRWTADYVERHGADAEPVGVERWVSATVGSDPASPSLIVEGRADRIDAHDGELVVIDYK
FT                   TGRTPPSDEHARRSRALALYAIAASRTLRKPCSRVELHHVPTATVAVAEHTDADLNEHV
FT                   QKAEETAAASRAAADKLTRGGDPDQLFPARPAPRCAWCELRSHCPEGRQAVPAARPWDL
FT                   LAPTT"
FT   gene            673895..674230
FT                   /locus_tag="Svir_06620"
FT   CDS_pept        673895..674230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06620"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95733"
FT                   /db_xref="GOA:C7MVL4"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL4"
FT                   /protein_id="ACU95733.1"
FT                   /translation="MDMAEPDTVELTVASSPEPMRARVPVWRGITGSVVAGWVAVLLVL
FT                   LGAQVLAWVNGGEGPGVYPVVGHLVGVVLAGAAQYWAERNSGASAGVAGMVVVGVSATM
FT                   LWLFWWS"
FT   gene            complement(674254..675147)
FT                   /locus_tag="Svir_06630"
FT   CDS_pept        complement(674254..675147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06630"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06630"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95734"
FT                   /db_xref="GOA:C7MVL5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL5"
FT                   /protein_id="ACU95734.1"
FT                   /translation="MSSEPRSGFSQLCPHGADRVELPGVYGPVAALQGPQPTDPAATVL
FT                   LVPGYTGSKEDFAPLLDGIAEAGLLPVAIDLPGQYESPGPDDESAYGPAQLGKSVAELV
FT                   TALSAERPVLLLGHSYGGLVARAAVLAGAPVAGLTLLCSGPSALPPGPRYTALSIGEQL
FT                   LRTQGVEACYALREQLTAQLSPQIPPPPPELARFLRERFVSTSAASLLGMADALRNEPD
FT                   LVPDLATALREHDIPALVVAGEHDNAWSVPSQRDMAQRLGVEFVAVPGAAHSPNTEAPH
FT                   ALLKELLPRWHAWLRR"
FT   gene            complement(675144..676499)
FT                   /locus_tag="Svir_06640"
FT   CDS_pept        complement(675144..676499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06640"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95735"
FT                   /db_xref="GOA:C7MVL6"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL6"
FT                   /protein_id="ACU95735.1"
FT                   /translation="MSTPPDRSSEHSPATPAHPPGTEDVLASADVRPTDPTDSALSRRP
FT                   SRSSRRSPWDRPRDRVLAAVLAVVCAAAVTVVWLFSDSRATEHRTASVPPPRLDPPAAV
FT                   PGSLAERWRAPSEATPEPVAEGGFVITASAGTVAGRDPLTGEIRWSYSRDLELCTVAGA
FT                   WSKAVAVYRKDLGCSEVTQLDPGTGRRTAQRNGDAEAPTRLVVDDAHVTTTGERLLNTW
FT                   RSDLVQTMEYGRVPAPENPQRQPRSGCRYSNVSAGADKVGVIEHCPKEVGARLTVLKAA
FT                   GEESDEPEQVFSTLLAEPTAQLVAMSEERVAVALPEQRRLLLFDYEGEQRSSHDIAVPT
FT                   AELATVPDSGVVPVSSGRENVYWFTGSHTVALSAGELRPRWIAENTLGPGTVFAGEYVV
FT                   PIPGGLAVLDERTGATTRTVAVDRRGHDGSIELEAIGPVLIEQRGRTLVALR"
FT   gene            complement(676505..678184)
FT                   /locus_tag="Svir_06650"
FT   CDS_pept        complement(676505..678184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06650"
FT                   /product="DNA/RNA helicase, superfamily II"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95736"
FT                   /db_xref="GOA:C7MVL7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL7"
FT                   /protein_id="ACU95736.1"
FT                   /translation="MRRFDIDPNNHTAGPVAGKPDNPTFADLGVHPDIVRALSESGIER
FT                   TFDIQALTLPLALRGEDVIGQARTGTGKTLGFGVPLLQRLVTPGDGTPQALVVVPTREL
FT                   CLQVSQDLAEAGKYLGVRITSIYGGRPYESQIQSLRSGVDVVIGTPGRLLDLAEQRNLV
FT                   LGKISTLVLDEADEMLDLGFLPDIERILRMVPEDRQTMLFSATMPGPILTLARTFLRQP
FT                   THIRAEAGETGAIHERTTQFVYRAHSLDKPELIAKVLQAEGRGLTMIFTRTKRTAQKVA
FT                   DDLVERGFAAAAVHGDLGQGAREQALRAFRSGKVDILVATDVAARGIDVEGVTHVINYQ
FT                   MPEDEKTYVHRIGRTGRAGRTGVAITLVDWDEVPRWKLISDELGLDMPEPVETYSTSKH
FT                   LFTDLGIPEDATGRLPLSKRTRAGLAAEDEEDFGDRRRRGRTGVSGRRPRRQRRRTRGG
FT                   REITSTTTRKESVERSDDATTGTDTTDATDEAGPATDPPRPRRRRTRGGSHPPTADLTA
FT                   PPEKAESTSGDGGERPARRRRRRRRVVAAGPANTVDTAARAD"
FT   gene            678553..679221
FT                   /locus_tag="Svir_06660"
FT   CDS_pept        678553..679221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06660"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95737"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL8"
FT                   /protein_id="ACU95737.1"
FT                   /translation="MTDAQAGDTESLGTGVVDLLGVLAYSELSAFDRLAEDARTAPTLA
FT                   GRVALASMAAAEMGHYALLERYLADHGVSVEDAMRPFIRHIDAFQESTTPRMWLESLVK
FT                   AYVVDNLAADLYRELAEVLDERTRELVVTVLADTGHSEFAQREVAAAIENDTPTRDRLA
FT                   LWSRRLFGEALTQAQYIVAERDGLAELIVAGSGDLSGIAALFRRLQQRHTKRMQNLGLG
FT                   "
FT   gene            679263..679493
FT                   /locus_tag="Svir_06670"
FT   CDS_pept        679263..679493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95738"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVL9"
FT                   /protein_id="ACU95738.1"
FT                   /translation="MEVKIGIKDAPRELVVASNSSQEEVEKQVAEALGVDNGLLRLNDE
FT                   KGRTFLVPASRIAYVEIAPSDVRRVGFAVGS"
FT   gene            complement(679594..679926)
FT                   /locus_tag="Svir_06680"
FT   CDS_pept        complement(679594..679926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95739"
FT                   /db_xref="InterPro:IPR032371"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM0"
FT                   /protein_id="ACU95739.1"
FT                   /translation="MSGHEHDEDGYTGAATLVLGETELDIEVELRGHFQPIDGYYRWYG
FT                   RIKANPTLSELAGGKKHKVEIRTPEGSAHGEISDPDPWDRYRIMGKSTPPFAVPTSLED
FT                   LAPAES"
FT   gene            complement(679923..680693)
FT                   /locus_tag="Svir_06690"
FT   CDS_pept        complement(679923..680693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06690"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95740"
FT                   /db_xref="GOA:C7MVM1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM1"
FT                   /protein_id="ACU95740.1"
FT                   /translation="MDNMPERVNSLSRSARFSDEKPTGDARRDRWRKHRIARRAEFVEA
FT                   ALKALDEHGPDMGMEELAAAAGVTKPVLYRHFADKADLYLALGQRGTEILFERLMPAIN
FT                   SELAPLPRIRMALTAFFSVIEEHPNLYRLLVRRSFGGKPVGTDVVAEDKQLIAAALTAL
FT                   LGDYMRMLNMDSGAAEPWAHGLVGMVQSTGEWWLDKRTMSRDSVVEYLTQIIWAAIDGL
FT                   TRQHGIVLDPNKPLEANKVVTLKPGPFEQTGETS"
FT   gene            680751..681656
FT                   /locus_tag="Svir_06700"
FT   CDS_pept        680751..681656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95741"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM2"
FT                   /protein_id="ACU95741.1"
FT                   /translation="MTRAVTEATREKTAERLLRSSANKFYDPEVDIDWDAPLVEGKRYL
FT                   PDERTSLYGTALWERLTPEQRIELGKHEAASIATNGIWFEVLLMQMLLKEVYNTDPTTN
FT                   FAQYALTEVADECRHSTMFARFSERIGCPHYGPVAWRRRMGKLLNVLAYGPAMYGAILV
FT                   AEEILDRLQREQMNDPQIQPLVRMVNRIHVLEEARHVTFAREEVRRGVAKLRGPELAYQ
FT                   QWLLAVVSHEVTRSLVNPAVYKAVGIRPRDGYRAAMNNPHWQATIRYFGERIMSFLDEV
FT                   GLVGGPGMPWWRRSFLIADK"
FT   gene            681653..682543
FT                   /locus_tag="Svir_06710"
FT   CDS_pept        681653..682543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06710"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06710"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95742"
FT                   /db_xref="GOA:C7MVM3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM3"
FT                   /protein_id="ACU95742.1"
FT                   /translation="MSTRQFVTRDGTRLAVETAEPVGSAAETTVVLVHGWTQDRRTWDR
FT                   VVGLLPPDVRRVRYDLRGHGESAPAEPGTATIDHLADDLAEVIDAEAPSGRLVLAGHSM
FT                   GGMTIMALADRHPELVRNRVNGVAFVSTACSGMDRMTLGLPGFLGNLAHRVERGLADLL
FT                   TRYRGDRLPIGRIPANLAIRWLVFGRGPGNADVASVVDQFLRAHPASVGAFQNAISLHD
FT                   RTAALATLRHTPSVVLAGTADRLCSPRHAQAIAAELEAGHLVLYPDAGHMLPQERAHDV
FT                   AEHIAALCRFPLVTK"
FT   gene            complement(682612..683277)
FT                   /locus_tag="Svir_06720"
FT   CDS_pept        complement(682612..683277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06720"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95743"
FT                   /db_xref="GOA:C7MVM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM4"
FT                   /protein_id="ACU95743.1"
FT                   /translation="MMDTEQAQTHASGRNTDTATLGRGVRLPRTERRAQLLAAAQEVFA
FT                   ANGYHAAAMDDIAERAGVSKPVLYQHFPGKLDLYIALLESHVDTLVSTVQQALASTTDN
FT                   KQRVRNAVRAFFEFVNNDVGAFRMVFESDLRGEPAVQEAVDRATSASVDAITETITADA
FT                   GLDEEKARLLAVGLVGMSQVSARFWLANSSMSLEEAVSLTSTLAWRGIGAGFPLSGRD"
FT   gene            683365..684396
FT                   /locus_tag="Svir_06730"
FT   CDS_pept        683365..684396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06730"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95744"
FT                   /db_xref="GOA:C7MVM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM5"
FT                   /protein_id="ACU95744.1"
FT                   /translation="MSETLNSSPDSSTSVSPASRPPLTHVPLSSTPLPELDLAAGPWPG
FT                   TRRQVGELTLHVRHIAGADTTRTRSVPAVYVHGLGGSSTNWTDLGRLLAPHAPGHAVDL
FT                   PGFGLSEPRDGFSFSLSAHAEVLAGYLAEHTEAPVHLIGNSMGGAISMLVAARRPELVR
FT                   TLTLISPAVPDRRPDPRRLADPRLALAYLPLIGKRVRRTLAAMTPRQRAEQVLRLCFAD
FT                   PTSVPDHRFEEFVEEHGARAAHDWAERAMALSALEIFRTWFARGTESLWSVAPRIGAPT
FT                   LVVWGTHDRVISVRRAPRTARLIPRARLFVLPRTGHVAQMERPTTVAKAVLGMWESVEA
FT                   GRW"
FT   gene            684570..685601
FT                   /locus_tag="Svir_06740"
FT   CDS_pept        684570..685601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06740"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95745"
FT                   /db_xref="GOA:C7MVM6"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM6"
FT                   /protein_id="ACU95745.1"
FT                   /translation="MSDEPSSHDDGGAQPDQRCRSAEPLRASWRPAETARERQPKVAGL
FT                   KKLTATFGWRAYLVPILLVVTVLVVFDTTRGSGANDEAASSGGDGGQAGNAAEKPDPMA
FT                   TEVPAEPIELDIPTAKLPEGGDYSQSGEGTWHVVPLGEGDGKRVGDSEQLLTYTVEVED
FT                   GIDPASYTGDDSFASAVESTLSDKRSWTGTGEVSFKRVDDRHPDPDFRVSLTSPDTSGQ
FT                   LCGTAIGYESSCRLSTPDGGSRVVINLARWVRGALAFNGDLGSYRQYVINHEVGHALGH
FT                   GHVGCQEDGALAPVMMQQTFGVANDYVAMLNDDHGGDVGKVPADGKVCRPNPWPNPQAN
FT                   SDD"
FT   gene            685705..686901
FT                   /locus_tag="Svir_06750"
FT   CDS_pept        685705..686901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06750"
FT                   /product="dinucleotide-utilizing enzyme possibly involved
FT                   in molybdopterin or thiamin biosynthesis"
FT                   /note="PFAM: ThiF family; MoeZ/MoeB domain; Rhodanese-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06750"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95746"
FT                   /db_xref="GOA:C7MVM7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM7"
FT                   /protein_id="ACU95746.1"
FT                   /translation="MSGTGGGKSTLPPLVEPAAELTKEEVERYSRHLIIPDVGVDGQKR
FT                   LKNAKVLVIGAGGLGSPALLYLAAAGVGTLGVIDFDVVDESNLQRQVIHGVSDLGKPKA
FT                   VSAKESVAEINPFVNFVIHQEQLTKDNALDIFRGYDLILDGTDNFATRYLVNDAAVLLG
FT                   KPYVWGSIFRFEGQVSVFWEDAPNGQGLNYRDLYPEPPPPGMVPSCAEGGVLGVLCASI
FT                   GSIMVTEAIKLITGIGEPLLGRLVTYDALEMRYREVKIRKDPETPKITELIDYEAFCGV
FT                   VSDEAQQAASDHTITPQELKAKFDAGEDFELIDVREPHEYEIVNIKGAKLIPKDRILSG
FT                   EALAELPQDKPIVLHCKSGARSAEALAALHKAGFRDATHLGGGVLAWARQVDPSLPTY"
FT   gene            687079..687879
FT                   /locus_tag="Svir_06760"
FT   CDS_pept        687079..687879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06760"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR02569,
FT                   Actinobacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06760"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95747"
FT                   /db_xref="InterPro:IPR013402"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM8"
FT                   /protein_id="ACU95747.1"
FT                   /translation="MSQGPPPEHVRRAFGLGSFDVAEAEPIADGSGWRCGDVVLEPVRD
FT                   RVQAVWLSRTLSALNIPDLRIARPIGASDGRWVVAGWRARRYVSGSVEHRPDETVLTAV
FT                   KLHQATAHFPRPAFLDERRDASAVAERLAWGEEHHDLDEAKGGRLFEILAPSRRPVAGP
FT                   DQLVHAELFGTLLFDGDEPPGLVGFVPRFRPAEWGAAVAAVDAVAWGGADGSLLRRWAH
FT                   LPDWSQLLLRATLFRLAWHALHPESSAASLDGLRRAASEVTELL"
FT   gene            688370..689308
FT                   /locus_tag="Svir_06770"
FT   CDS_pept        688370..689308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06770"
FT                   /product="predicted esterase"
FT                   /note="PFAM: Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95748"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVM9"
FT                   /protein_id="ACU95748.1"
FT                   /translation="MLKSVGGLTAAVTLGGAALVAPAAHAAGLTVVEHNTDDPRMWYYR
FT                   FQTPEIGWNPGVNVLLPDDYHTSGRRYPVLYLLHGGLQDFIEFDRLGIRAMTAGRPLIV
FT                   VMPDGGPAGWYSNPVSSNVGPRNWENFHIHQLIPWIDANFRTYAEYDGRAVSGFSMGGF
FT                   GALKYAAKYYGHFASVSSHSGPASLRREGGLVGHYINASSAVAELGGGTVYGVPLWDEA
FT                   RVSADNPVERIESYRHKRIFLVAGNSPDFLNIVDMVTEGQVLAGQREFRAALDAAGIPY
FT                   EAHEEPGGHFVRPHLLQADIDGVVARLRKAA"
FT   gene            complement(689521..690375)
FT                   /locus_tag="Svir_06780"
FT   CDS_pept        complement(689521..690375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06780"
FT                   /product="siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein;
FT                   Siderophore-interacting FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06780"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95749"
FT                   /db_xref="GOA:C7MVN0"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVN0"
FT                   /protein_id="ACU95749.1"
FT                   /translation="MTIEATRPRLAYMNAQVRDVRRVTPRMVRVTFAGADLNEFVDAAP
FT                   DQYVKVFFPVPGTRRPKLPPPPTADGMSWYRQYLNMPDDVRPPMRTYTVRASRPHVGEL
FT                   DIDFLLHDDAGPGSRWAESAKPGDEVALLGPHGLYEVPAGTSWQLLVGDESAVPAIAAI
FT                   CEQLPESATVTVFVEIADPTDEIPLERPGGEPVDVRWVLRGDAPVGEAVLAAVREARLP
FT                   EGEPYAWISGEADLVKHVRRHLVRERGVDKRRITFTGYWRRGRSEEAAGREQLREYDRA
FT                   TAR"
FT   gene            complement(690413..690703)
FT                   /locus_tag="Svir_06790"
FT   CDS_pept        complement(690413..690703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06790"
FT                   /product="predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /note="PFAM: 6-O-methylguanine DNA methyltransferase, DNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95750"
FT                   /db_xref="GOA:C7MVN1"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVN1"
FT                   /protein_id="ACU95750.1"
FT                   /translation="MDEELHERIRDVVASVPKGTVATYGDVAKIAGASTPRLVGRVLAE
FT                   DGHDLPWHRVLRADGTPAPHLAREQLARLRAEGVLAEGRRVDLRRYRWRAP"
FT   gene            691114..694314
FT                   /locus_tag="Svir_06800"
FT   CDS_pept        691114..694314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06800"
FT                   /product="DNA/RNA helicase, superfamily I"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06800"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95751"
FT                   /db_xref="GOA:C7MVN2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVN2"
FT                   /protein_id="ACU95751.1"
FT                   /translation="MRTPEPPVPPQTWDDGARWLLSAPRGFVRVLGAPGTGKTTLLAAT
FT                   AAARIAEGADEESVLVLTASRQAADALRADITRRLTGHRGERAGEVRTVREPIVRTVHS
FT                   YAFAVLRLQAVRDGLPVPRLLSGPEQDVVVRELLAGDLERGAPDWPEPLRPALAVPGFA
FT                   EELRDLLLRAAERGLGPEDLIKLGHRQGRDEWVAAGRFWRQYEEVTLLQGVGGHAVGES
FT                   GAPALDAAELVASALVELEGDPELLAGEQARVRHLFVDDAQHLDPLQYRLVRLLAETAS
FT                   DAVLAGDPDQSVFSFRGADPRLFADADPDGDRTVVLTRSHRLDPVVHEAVGRIAATLPG
FT                   TSAHRASVPTPTRGREGRGKVRTRLSPTPAAEAAWIADQLRRAHLLDGVPWSQMAVLMR
FT                   SVSRSLPVLQRALTMAGIPVAAVTEELPLARQPAVRPLLTVLWAAADPRVLDAETAEML
FT                   LSSPLGGADPLALRRLRRGLRRLELVAGGERSSDELLVEALRDGDVLAGLADAEAAPVR
FT                   RVSRLLTVAREAMRSGAGVEDVLWQVWQASGLQDRLVAQAAKGGTLGMRADRDLDAVVA
FT                   LFDAARRYVDRLPKAGVLGFVEYLSSQHIAGDSLAPVAVRGSGVSLLTAHGAVGREWSV
FT                   VAILGLQEGMWPDLRLRGSVLGVERLVDLLSGVDDDAVATVSATAPLLAEERRLFYVAA
FT                   SRARHTLLVSAVQGEDEQPSRFFFDLVDAGVDTERGGGPDVRLVARERGLTLAELVGEL
FT                   RAAVTDTELEPRRRKLAARQLARLARDGVPGAHPEQWYGLAGNSSDRPLREPDEVIRVS
FT                   PSVVDTLVKCPLRWLLERHGGTDPAQLSAVTGTLVHALAQAAAEGTDEQTLWKELDEAW
FT                   AKVDAGAPWFSRKERVRVEGMVRSFLTWLRQSRDELTQHAVEQDMRVSLPEAEGEPSVA
FT                   LTGRVDRLELDAEGRPVVIDLKTSKSPVAKDAAAEHPQLAVYQLATLLGAFSGHKGHTG
FT                   GARLLYVGKPNAKTGATVREQPALDEETARRWLNEVRKAAVDTVGPTYPVRENVDCSRC
FT                   PSRSACPLRPEGRQVTGP"
FT   gene            694311..697583
FT                   /locus_tag="Svir_06810"
FT   CDS_pept        694311..697583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Svir_06810"
FT                   /product="DNA/RNA helicase, superfamily I"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Svir_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ACU95752"
FT                   /db_xref="GOA:C7MVN3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C7MVN3"
FT                   /protein_id="ACU95752