(data stored in ACNUC7421 zone)

EMBL: CP001685

ID   CP001685; SV 1; circular; genomic DNA; STD; PRO; 2465610 BP.
XX
AC   CP001685; ABUE01000000-ABUE01000046;
XX
PR   Project:PRJNA29445;
XX
DT   03-SEP-2009 (Rel. 102, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Leptotrichia buccalis DSM 1135, complete genome.
XX
KW   .
XX
OS   Leptotrichia buccalis C-1013-b
OC   Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Leptotrichia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2465610
RX   DOI; 10.4056/sigs.1854.
RX   PUBMED; 21304648.
RA   Ivanova N., Gronow S., Lapidus A., Copeland A., Glavina Del Rio T.,
RA   Nolan M., Lucas S., Chen F., Tice H., Cheng J.F., Saunders E., Bruce D.,
RA   Goodwin L., Brettin T., Detter J.C., Han C., Pitluck S., Mikhailova N.,
RA   Pati A., Mavrommatis K., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Chain P., Rohde C., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Leptotrichia buccalis type strain (C-1013-b)";
RL   Stand Genomic Sci 1(2):126-132(2009).
XX
RN   [2]
RP   1-2465610
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Gronow S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Leptotrichia buccalis DSM 1135";
RL   Unpublished.
XX
RN   [3]
RP   1-2465610
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Gronow S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a7d8d8c7e0aa2377f299a284971a4384.
DR   BioSample; SAMN00002593.
DR   CABRI; DSM 1135.
DR   EnsemblGenomes-Gn; EBG00001022823.
DR   EnsemblGenomes-Gn; EBG00001022824.
DR   EnsemblGenomes-Gn; EBG00001022825.
DR   EnsemblGenomes-Gn; EBG00001022826.
DR   EnsemblGenomes-Gn; EBG00001022827.
DR   EnsemblGenomes-Gn; EBG00001022828.
DR   EnsemblGenomes-Gn; EBG00001022829.
DR   EnsemblGenomes-Gn; EBG00001022830.
DR   EnsemblGenomes-Gn; EBG00001022831.
DR   EnsemblGenomes-Gn; EBG00001022832.
DR   EnsemblGenomes-Gn; EBG00001022833.
DR   EnsemblGenomes-Gn; EBG00001022834.
DR   EnsemblGenomes-Gn; EBG00001022835.
DR   EnsemblGenomes-Gn; EBG00001022836.
DR   EnsemblGenomes-Gn; EBG00001022837.
DR   EnsemblGenomes-Gn; EBG00001022838.
DR   EnsemblGenomes-Gn; EBG00001022839.
DR   EnsemblGenomes-Gn; EBG00001022840.
DR   EnsemblGenomes-Gn; EBG00001022841.
DR   EnsemblGenomes-Gn; EBG00001022842.
DR   EnsemblGenomes-Gn; EBG00001022843.
DR   EnsemblGenomes-Gn; EBG00001022844.
DR   EnsemblGenomes-Gn; EBG00001022845.
DR   EnsemblGenomes-Gn; EBG00001022846.
DR   EnsemblGenomes-Gn; EBG00001022847.
DR   EnsemblGenomes-Gn; EBG00001022848.
DR   EnsemblGenomes-Gn; EBG00001022849.
DR   EnsemblGenomes-Gn; EBG00001022850.
DR   EnsemblGenomes-Gn; EBG00001022851.
DR   EnsemblGenomes-Gn; EBG00001022852.
DR   EnsemblGenomes-Gn; EBG00001022853.
DR   EnsemblGenomes-Gn; EBG00001022854.
DR   EnsemblGenomes-Gn; EBG00001022855.
DR   EnsemblGenomes-Gn; EBG00001022856.
DR   EnsemblGenomes-Gn; EBG00001022857.
DR   EnsemblGenomes-Gn; EBG00001022858.
DR   EnsemblGenomes-Gn; EBG00001022859.
DR   EnsemblGenomes-Gn; EBG00001022860.
DR   EnsemblGenomes-Gn; EBG00001022861.
DR   EnsemblGenomes-Gn; EBG00001022862.
DR   EnsemblGenomes-Gn; EBG00001022863.
DR   EnsemblGenomes-Gn; EBG00001022864.
DR   EnsemblGenomes-Gn; EBG00001022865.
DR   EnsemblGenomes-Gn; EBG00001022866.
DR   EnsemblGenomes-Gn; EBG00001022867.
DR   EnsemblGenomes-Gn; EBG00001022868.
DR   EnsemblGenomes-Gn; EBG00001022869.
DR   EnsemblGenomes-Gn; EBG00001022870.
DR   EnsemblGenomes-Gn; EBG00001022871.
DR   EnsemblGenomes-Gn; EBG00001022872.
DR   EnsemblGenomes-Gn; EBG00001022873.
DR   EnsemblGenomes-Gn; EBG00001022874.
DR   EnsemblGenomes-Gn; EBG00001022875.
DR   EnsemblGenomes-Gn; EBG00001022876.
DR   EnsemblGenomes-Gn; EBG00001022877.
DR   EnsemblGenomes-Gn; EBG00001022878.
DR   EnsemblGenomes-Gn; EBG00001022879.
DR   EnsemblGenomes-Gn; EBG00001022880.
DR   EnsemblGenomes-Gn; EBG00001022881.
DR   EnsemblGenomes-Gn; EBG00001022882.
DR   EnsemblGenomes-Gn; EBG00001022883.
DR   EnsemblGenomes-Gn; EBG00001022884.
DR   EnsemblGenomes-Gn; EBG00001022885.
DR   EnsemblGenomes-Gn; EBG00001022886.
DR   EnsemblGenomes-Gn; EBG00001022887.
DR   EnsemblGenomes-Gn; EBG00001022888.
DR   EnsemblGenomes-Gn; EBG00001022889.
DR   EnsemblGenomes-Gn; EBG00001022890.
DR   EnsemblGenomes-Gn; EBG00001022891.
DR   EnsemblGenomes-Gn; EBG00001022892.
DR   EnsemblGenomes-Gn; EBG00001022893.
DR   EnsemblGenomes-Gn; EBG00001022894.
DR   EnsemblGenomes-Gn; EBG00001022895.
DR   EnsemblGenomes-Gn; EBG00001022896.
DR   EnsemblGenomes-Gn; EBG00001022897.
DR   EnsemblGenomes-Gn; EBG00001022898.
DR   EnsemblGenomes-Gn; EBG00001022899.
DR   EnsemblGenomes-Gn; EBG00001022900.
DR   EnsemblGenomes-Gn; EBG00001022901.
DR   EnsemblGenomes-Gn; EBG00001022902.
DR   EnsemblGenomes-Gn; EBG00001022903.
DR   EnsemblGenomes-Gn; EBG00001022904.
DR   EnsemblGenomes-Gn; EBG00001022905.
DR   EnsemblGenomes-Gn; EBG00001022906.
DR   EnsemblGenomes-Gn; EBG00001022907.
DR   EnsemblGenomes-Gn; EBG00001022908.
DR   EnsemblGenomes-Gn; EBG00001022909.
DR   EnsemblGenomes-Gn; EBG00001022910.
DR   EnsemblGenomes-Gn; EBG00001022911.
DR   EnsemblGenomes-Gn; EBG00001022912.
DR   EnsemblGenomes-Gn; EBG00001022913.
DR   EnsemblGenomes-Gn; EBG00001022914.
DR   EnsemblGenomes-Gn; EBG00001022915.
DR   EnsemblGenomes-Gn; EBG00001022916.
DR   EnsemblGenomes-Gn; EBG00001022917.
DR   EnsemblGenomes-Gn; EBG00001022918.
DR   EnsemblGenomes-Gn; EBG00001022919.
DR   EnsemblGenomes-Gn; EBG00001022920.
DR   EnsemblGenomes-Gn; EBG00001022921.
DR   EnsemblGenomes-Gn; EBG00001022922.
DR   EnsemblGenomes-Gn; EBG00001022923.
DR   EnsemblGenomes-Gn; EBG00001022924.
DR   EnsemblGenomes-Gn; EBG00001022925.
DR   EnsemblGenomes-Gn; Lebu_R0001.
DR   EnsemblGenomes-Gn; Lebu_R0002.
DR   EnsemblGenomes-Gn; Lebu_R0003.
DR   EnsemblGenomes-Gn; Lebu_R0004.
DR   EnsemblGenomes-Gn; Lebu_R0005.
DR   EnsemblGenomes-Gn; Lebu_R0006.
DR   EnsemblGenomes-Gn; Lebu_R0007.
DR   EnsemblGenomes-Gn; Lebu_R0008.
DR   EnsemblGenomes-Gn; Lebu_R0009.
DR   EnsemblGenomes-Gn; Lebu_R0010.
DR   EnsemblGenomes-Gn; Lebu_R0011.
DR   EnsemblGenomes-Gn; Lebu_R0012.
DR   EnsemblGenomes-Gn; Lebu_R0013.
DR   EnsemblGenomes-Gn; Lebu_R0014.
DR   EnsemblGenomes-Gn; Lebu_R0015.
DR   EnsemblGenomes-Gn; Lebu_R0016.
DR   EnsemblGenomes-Gn; Lebu_R0017.
DR   EnsemblGenomes-Gn; Lebu_R0018.
DR   EnsemblGenomes-Gn; Lebu_R0019.
DR   EnsemblGenomes-Gn; Lebu_R0020.
DR   EnsemblGenomes-Gn; Lebu_R0021.
DR   EnsemblGenomes-Gn; Lebu_R0022.
DR   EnsemblGenomes-Gn; Lebu_R0023.
DR   EnsemblGenomes-Gn; Lebu_R0024.
DR   EnsemblGenomes-Gn; Lebu_R0025.
DR   EnsemblGenomes-Gn; Lebu_R0026.
DR   EnsemblGenomes-Gn; Lebu_R0027.
DR   EnsemblGenomes-Gn; Lebu_R0028.
DR   EnsemblGenomes-Gn; Lebu_R0029.
DR   EnsemblGenomes-Gn; Lebu_R0030.
DR   EnsemblGenomes-Gn; Lebu_R0031.
DR   EnsemblGenomes-Gn; Lebu_R0032.
DR   EnsemblGenomes-Gn; Lebu_R0033.
DR   EnsemblGenomes-Gn; Lebu_R0034.
DR   EnsemblGenomes-Gn; Lebu_R0035.
DR   EnsemblGenomes-Gn; Lebu_R0036.
DR   EnsemblGenomes-Gn; Lebu_R0037.
DR   EnsemblGenomes-Gn; Lebu_R0038.
DR   EnsemblGenomes-Gn; Lebu_R0039.
DR   EnsemblGenomes-Gn; Lebu_R0040.
DR   EnsemblGenomes-Gn; Lebu_R0041.
DR   EnsemblGenomes-Gn; Lebu_R0042.
DR   EnsemblGenomes-Gn; Lebu_R0043.
DR   EnsemblGenomes-Gn; Lebu_R0044.
DR   EnsemblGenomes-Gn; Lebu_R0045.
DR   EnsemblGenomes-Gn; Lebu_R0046.
DR   EnsemblGenomes-Gn; Lebu_R0047.
DR   EnsemblGenomes-Gn; Lebu_R0048.
DR   EnsemblGenomes-Gn; Lebu_R0049.
DR   EnsemblGenomes-Gn; Lebu_R0050.
DR   EnsemblGenomes-Gn; Lebu_R0051.
DR   EnsemblGenomes-Gn; Lebu_R0052.
DR   EnsemblGenomes-Gn; Lebu_R0053.
DR   EnsemblGenomes-Gn; Lebu_R0054.
DR   EnsemblGenomes-Gn; Lebu_R0055.
DR   EnsemblGenomes-Gn; Lebu_R0056.
DR   EnsemblGenomes-Gn; Lebu_R0057.
DR   EnsemblGenomes-Gn; Lebu_R0058.
DR   EnsemblGenomes-Gn; Lebu_R0059.
DR   EnsemblGenomes-Gn; Lebu_R0060.
DR   EnsemblGenomes-Gn; Lebu_R0061.
DR   EnsemblGenomes-Gn; Lebu_R0062.
DR   EnsemblGenomes-Gn; Lebu_R0063.
DR   EnsemblGenomes-Gn; Lebu_R0064.
DR   EnsemblGenomes-Tr; EBT00001626033.
DR   EnsemblGenomes-Tr; EBT00001626034.
DR   EnsemblGenomes-Tr; EBT00001626035.
DR   EnsemblGenomes-Tr; EBT00001626036.
DR   EnsemblGenomes-Tr; EBT00001626037.
DR   EnsemblGenomes-Tr; EBT00001626038.
DR   EnsemblGenomes-Tr; EBT00001626039.
DR   EnsemblGenomes-Tr; EBT00001626040.
DR   EnsemblGenomes-Tr; EBT00001626041.
DR   EnsemblGenomes-Tr; EBT00001626042.
DR   EnsemblGenomes-Tr; EBT00001626043.
DR   EnsemblGenomes-Tr; EBT00001626044.
DR   EnsemblGenomes-Tr; EBT00001626045.
DR   EnsemblGenomes-Tr; EBT00001626046.
DR   EnsemblGenomes-Tr; EBT00001626047.
DR   EnsemblGenomes-Tr; EBT00001626048.
DR   EnsemblGenomes-Tr; EBT00001626049.
DR   EnsemblGenomes-Tr; EBT00001626050.
DR   EnsemblGenomes-Tr; EBT00001626051.
DR   EnsemblGenomes-Tr; EBT00001626052.
DR   EnsemblGenomes-Tr; EBT00001626053.
DR   EnsemblGenomes-Tr; EBT00001626054.
DR   EnsemblGenomes-Tr; EBT00001626055.
DR   EnsemblGenomes-Tr; EBT00001626056.
DR   EnsemblGenomes-Tr; EBT00001626057.
DR   EnsemblGenomes-Tr; EBT00001626058.
DR   EnsemblGenomes-Tr; EBT00001626059.
DR   EnsemblGenomes-Tr; EBT00001626060.
DR   EnsemblGenomes-Tr; EBT00001626061.
DR   EnsemblGenomes-Tr; EBT00001626062.
DR   EnsemblGenomes-Tr; EBT00001626063.
DR   EnsemblGenomes-Tr; EBT00001626064.
DR   EnsemblGenomes-Tr; EBT00001626065.
DR   EnsemblGenomes-Tr; EBT00001626066.
DR   EnsemblGenomes-Tr; EBT00001626067.
DR   EnsemblGenomes-Tr; EBT00001626068.
DR   EnsemblGenomes-Tr; EBT00001626069.
DR   EnsemblGenomes-Tr; EBT00001626070.
DR   EnsemblGenomes-Tr; EBT00001626071.
DR   EnsemblGenomes-Tr; EBT00001626072.
DR   EnsemblGenomes-Tr; EBT00001626073.
DR   EnsemblGenomes-Tr; EBT00001626074.
DR   EnsemblGenomes-Tr; EBT00001626075.
DR   EnsemblGenomes-Tr; EBT00001626076.
DR   EnsemblGenomes-Tr; EBT00001626077.
DR   EnsemblGenomes-Tr; EBT00001626078.
DR   EnsemblGenomes-Tr; EBT00001626079.
DR   EnsemblGenomes-Tr; EBT00001626080.
DR   EnsemblGenomes-Tr; EBT00001626081.
DR   EnsemblGenomes-Tr; EBT00001626082.
DR   EnsemblGenomes-Tr; EBT00001626083.
DR   EnsemblGenomes-Tr; EBT00001626084.
DR   EnsemblGenomes-Tr; EBT00001626085.
DR   EnsemblGenomes-Tr; EBT00001626086.
DR   EnsemblGenomes-Tr; EBT00001626087.
DR   EnsemblGenomes-Tr; EBT00001626088.
DR   EnsemblGenomes-Tr; EBT00001626089.
DR   EnsemblGenomes-Tr; EBT00001626090.
DR   EnsemblGenomes-Tr; EBT00001626091.
DR   EnsemblGenomes-Tr; EBT00001626092.
DR   EnsemblGenomes-Tr; EBT00001626093.
DR   EnsemblGenomes-Tr; EBT00001626094.
DR   EnsemblGenomes-Tr; EBT00001626095.
DR   EnsemblGenomes-Tr; EBT00001626096.
DR   EnsemblGenomes-Tr; EBT00001626097.
DR   EnsemblGenomes-Tr; EBT00001626098.
DR   EnsemblGenomes-Tr; EBT00001626099.
DR   EnsemblGenomes-Tr; EBT00001626100.
DR   EnsemblGenomes-Tr; EBT00001626101.
DR   EnsemblGenomes-Tr; EBT00001626102.
DR   EnsemblGenomes-Tr; EBT00001626103.
DR   EnsemblGenomes-Tr; EBT00001626104.
DR   EnsemblGenomes-Tr; EBT00001626105.
DR   EnsemblGenomes-Tr; EBT00001626106.
DR   EnsemblGenomes-Tr; EBT00001626107.
DR   EnsemblGenomes-Tr; EBT00001626108.
DR   EnsemblGenomes-Tr; EBT00001626109.
DR   EnsemblGenomes-Tr; EBT00001626110.
DR   EnsemblGenomes-Tr; EBT00001626111.
DR   EnsemblGenomes-Tr; EBT00001626112.
DR   EnsemblGenomes-Tr; EBT00001626113.
DR   EnsemblGenomes-Tr; EBT00001626114.
DR   EnsemblGenomes-Tr; EBT00001626115.
DR   EnsemblGenomes-Tr; EBT00001626116.
DR   EnsemblGenomes-Tr; EBT00001626117.
DR   EnsemblGenomes-Tr; EBT00001626118.
DR   EnsemblGenomes-Tr; EBT00001626119.
DR   EnsemblGenomes-Tr; EBT00001626120.
DR   EnsemblGenomes-Tr; EBT00001626121.
DR   EnsemblGenomes-Tr; EBT00001626122.
DR   EnsemblGenomes-Tr; EBT00001626123.
DR   EnsemblGenomes-Tr; EBT00001626124.
DR   EnsemblGenomes-Tr; EBT00001626125.
DR   EnsemblGenomes-Tr; EBT00001626126.
DR   EnsemblGenomes-Tr; EBT00001626127.
DR   EnsemblGenomes-Tr; EBT00001626128.
DR   EnsemblGenomes-Tr; EBT00001626129.
DR   EnsemblGenomes-Tr; EBT00001626130.
DR   EnsemblGenomes-Tr; EBT00001626131.
DR   EnsemblGenomes-Tr; EBT00001626132.
DR   EnsemblGenomes-Tr; EBT00001626133.
DR   EnsemblGenomes-Tr; EBT00001626134.
DR   EnsemblGenomes-Tr; EBT00001626135.
DR   EnsemblGenomes-Tr; Lebu_R0001-1.
DR   EnsemblGenomes-Tr; Lebu_R0002-1.
DR   EnsemblGenomes-Tr; Lebu_R0003-1.
DR   EnsemblGenomes-Tr; Lebu_R0004-1.
DR   EnsemblGenomes-Tr; Lebu_R0005-1.
DR   EnsemblGenomes-Tr; Lebu_R0006-1.
DR   EnsemblGenomes-Tr; Lebu_R0007-1.
DR   EnsemblGenomes-Tr; Lebu_R0008-1.
DR   EnsemblGenomes-Tr; Lebu_R0009-1.
DR   EnsemblGenomes-Tr; Lebu_R0010-1.
DR   EnsemblGenomes-Tr; Lebu_R0011-1.
DR   EnsemblGenomes-Tr; Lebu_R0012-1.
DR   EnsemblGenomes-Tr; Lebu_R0013-1.
DR   EnsemblGenomes-Tr; Lebu_R0014-1.
DR   EnsemblGenomes-Tr; Lebu_R0015-1.
DR   EnsemblGenomes-Tr; Lebu_R0016-1.
DR   EnsemblGenomes-Tr; Lebu_R0017-1.
DR   EnsemblGenomes-Tr; Lebu_R0018-1.
DR   EnsemblGenomes-Tr; Lebu_R0019-1.
DR   EnsemblGenomes-Tr; Lebu_R0020-1.
DR   EnsemblGenomes-Tr; Lebu_R0021-1.
DR   EnsemblGenomes-Tr; Lebu_R0022-1.
DR   EnsemblGenomes-Tr; Lebu_R0023-1.
DR   EnsemblGenomes-Tr; Lebu_R0024-1.
DR   EnsemblGenomes-Tr; Lebu_R0025-1.
DR   EnsemblGenomes-Tr; Lebu_R0026-1.
DR   EnsemblGenomes-Tr; Lebu_R0027-1.
DR   EnsemblGenomes-Tr; Lebu_R0028-1.
DR   EnsemblGenomes-Tr; Lebu_R0029-1.
DR   EnsemblGenomes-Tr; Lebu_R0030-1.
DR   EnsemblGenomes-Tr; Lebu_R0031-1.
DR   EnsemblGenomes-Tr; Lebu_R0032-1.
DR   EnsemblGenomes-Tr; Lebu_R0033-1.
DR   EnsemblGenomes-Tr; Lebu_R0034-1.
DR   EnsemblGenomes-Tr; Lebu_R0035-1.
DR   EnsemblGenomes-Tr; Lebu_R0036-1.
DR   EnsemblGenomes-Tr; Lebu_R0037-1.
DR   EnsemblGenomes-Tr; Lebu_R0038-1.
DR   EnsemblGenomes-Tr; Lebu_R0039-1.
DR   EnsemblGenomes-Tr; Lebu_R0040-1.
DR   EnsemblGenomes-Tr; Lebu_R0041-1.
DR   EnsemblGenomes-Tr; Lebu_R0042-1.
DR   EnsemblGenomes-Tr; Lebu_R0043-1.
DR   EnsemblGenomes-Tr; Lebu_R0044-1.
DR   EnsemblGenomes-Tr; Lebu_R0045-1.
DR   EnsemblGenomes-Tr; Lebu_R0046-1.
DR   EnsemblGenomes-Tr; Lebu_R0047-1.
DR   EnsemblGenomes-Tr; Lebu_R0048-1.
DR   EnsemblGenomes-Tr; Lebu_R0049-1.
DR   EnsemblGenomes-Tr; Lebu_R0050-1.
DR   EnsemblGenomes-Tr; Lebu_R0051-1.
DR   EnsemblGenomes-Tr; Lebu_R0052-1.
DR   EnsemblGenomes-Tr; Lebu_R0053-1.
DR   EnsemblGenomes-Tr; Lebu_R0054-1.
DR   EnsemblGenomes-Tr; Lebu_R0055-1.
DR   EnsemblGenomes-Tr; Lebu_R0056-1.
DR   EnsemblGenomes-Tr; Lebu_R0057-1.
DR   EnsemblGenomes-Tr; Lebu_R0058-1.
DR   EnsemblGenomes-Tr; Lebu_R0059-1.
DR   EnsemblGenomes-Tr; Lebu_R0060-1.
DR   EnsemblGenomes-Tr; Lebu_R0061-1.
DR   EnsemblGenomes-Tr; Lebu_R0062-1.
DR   EnsemblGenomes-Tr; Lebu_R0063-1.
DR   EnsemblGenomes-Tr; Lebu_R0064-1.
DR   EuropePMC; PMC4726753; 26858724.
DR   EuropePMC; PMC5093955; 27809782.
DR   EuropePMC; PMC5414144; 28464950.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01320; CRISPR-DR7.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001685.
DR   SILVA-SSU; CP001685.
DR   StrainInfo; 138118; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082970
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Leptotrichia buccalis C-1013-b, DSM 1135
CC   Culture Collection ID :: DSM 1135, ATCC 14201, JCM 12969, NCTC
CC                            10249
CC   GOLD Stamp ID         :: Gi02240
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Supragingival calculus
CC   Host Name             :: Homo sapiens
CC   Body Sample Site      :: Oral
CC   Body Sample SubSite   :: Dental plaque
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Bacteremia, Cavitary pneumonia,
CC                            Endocarditis, Septicemia
CC   Habitat               :: Blood, Human oral microflora
CC   Phenotypes            :: Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2465610
FT                   /organism="Leptotrichia buccalis C-1013-b"
FT                   /strain="DSM 1135"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Leptotrichia buccalis DSM 1135"
FT                   /db_xref="taxon:523794"
FT   gene            687..2042
FT                   /locus_tag="Lebu_0001"
FT   CDS_pept        687..2042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cbh:CLC_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37938"
FT                   /db_xref="GOA:C7NC96"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7NC96"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACV37938.1"
FT                   /translation="MNVGKLWEKIKKIMKKRVSEAEFEAFFKNVEATKLEDNKLTLVCN
FT                   SKLIQQNVGKYKGQMEEIAEIITDEIITIDFEIKKQDIMSYKPEIHSFSRESKEKSSAI
FT                   YTGLNPKHRFDNFIVGENSKLAYNACLAVVNNPTPVYNPLFIYGSSGLGKTHLMQAVGN
FT                   EILENNPNKRVYYSTSEEFANEFFKVLNGGRIQHFRDTFRALDVLLLDDIQFFEKVFGR
FT                   GEGTVEEEFFHTFNKLQELGKQIIMISDKSPKEIKNLSKRLESRFLSGLTVEIQSPGFE
FT                   TRMMILKNMAKTQDIEIDDSILEYISDSLNTNVRELEGTLTNLNARAKLLNEKITLQLV
FT                   QEMLMHNVKREQSKITAKKVMEQISSQYGVSINDMISKKRQKKVVETRQIAMYLLKNND
FT                   DLDLSLTAIGGLFGGKDHSTVISSIRKVEKKTREDVLFKKEIDMLNKKIFKV"
FT   gene            2732..2959
FT                   /locus_tag="Lebu_0002"
FT   CDS_pept        2732..2959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0002"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding
FT                   S4 domain protein; KEGG: cac:CAC0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37939"
FT                   /db_xref="GOA:C7NC97"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7NC97"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ACV37939.1"
FT                   /translation="MENKIEEVVINTEFIKLDQLLKWANFTGSGVEAKMFIQNGEVKVN
FT                   DAVETRRGKKIYDGDVVEFAGEKVAVRAKH"
FT   gene            3032..4669
FT                   /locus_tag="Lebu_0003"
FT   CDS_pept        3032..4669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0003"
FT                   /product="protein of unknown function DUF1703"
FT                   /note="PFAM: protein of unknown function DUF1703; KEGG:
FT                   fnu:FN1654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37940"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:C7NC98"
FT                   /inference="protein motif:PFAM:PF08011"
FT                   /protein_id="ACV37940.1"
FT                   /translation="MKKGIGIGVEDFSEVIKENCYYIDKTKWIGEILEDKSKIKLFTRP
FT                   RRFGKTLNMSMLKYFFDIENKEENKKLFSELDIEKSEYMSEQGQYPVIFISLKSIKAKT
FT                   WEEAIQEIRLLVLELFSEYKYLLEDLDEYDLPRFKKYLLGNADFSELKNALLFLTRILF
FT                   QKYKKEVILLIDEYDSPLISAYEHHYYSDAIAFFKVFYGEALKTNQYLKMGVMTGIIRV
FT                   IKAGIFSDLNNLNVYSILENEYSEFFGFNQDEIEETLEYFDVKYELFDVKNWYDGYKFG
FT                   DSDVYNPWSILKFLKSKKIGSHWIDTSGNFLINQILKNTDSEIMETLEALFNGETVEEN
FT                   ISGNSDLSSLLGQEEIWELLLFSGYLTINEKIGEDYEDVYSLRLPNREVREFFRKKFID
FT                   VNFGESMFRKAMEGLKNLKFDIFQKYLQNILLKSTSFMDTKNEDFYHGLVLGMMFYLDN
FT                   HYYVKSNEESGLGRYDVVIEPKNKNNRGFILEFKVVKNEDNLEKVSEEAIEQITEKKYD
FT                   IGLRDRGIKDVTFVGVAFCGKVVKVSYR"
FT   gene            4697..5785
FT                   /locus_tag="Lebu_0004"
FT   CDS_pept        4697..5785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: fnu:FN2128 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37941"
FT                   /db_xref="GOA:C7NC99"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7NC99"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACV37941.1"
FT                   /translation="MYLDQISFNNFRCLVDGKLKFDRYFNLIYGKNGQGKTSLIEAVHF
FT                   LATGKSFRTKKVKEIRKYNLNRLIVFGKYRHKDLSENIIAIDVNEDKKDFYIDREKNKY
FT                   INYVGLLNIISFIPEDIELIIGNPGIRRNFFNYEISQAKKEYLQSIVNFEKILKVRNKL
FT                   IKEKKTGEEIYKIYNEKFIEEGLNIVLNRREFIKKLSILLNLNYRKLFDENSELKLKYD
FT                   CFLGDVEKKTREELKEKFEILCRRKSEREKFLGYSLLGPQKDDFVFELNGKNAKAYSSQ
FT                   GEKKSIIFSLKISEIDILIKEKKEYPIFIMDDIASYFDEVRKKSILSYFVNKKIQCFIT
FT                   STEDLGIEGKKFIVEKGKIINE"
FT   gene            5800..6843
FT                   /locus_tag="Lebu_0005"
FT   CDS_pept        5800..6843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   aae:aq_629 chromosome assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37942"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACV37942.1"
FT                   /translation="MDGIKDLKNLALEAIEKRSSLLKNEKYILWKIKKNWTHIVNGPIG
FT                   EKTYPKSLFNGNLVVVINDGIIYHTTIMYAENIKDKINTFLNGKFLESIEFTKVNYKIK
FT                   RDLLDELIENEEKRGTIRVGEIPRGNVKEKRGNAGSENKITEKVKDIVLSAQEIKEIHE
FT                   NIDKIDKKYEDIARRLEKIVIKLKKREKYLKNNGYIECENCKILFFPESKEKICFECRM
FT                   EEENRKFQNMSNLIRNNPYISEKQAVRMTNTDKSTYYKARDILAQQTYNDMLYYCLEKN
FT                   KEISLNEDYKFEIRSESREDVEKFIKNYVDYKIGSDNEDVFKIERKWALRKLRKDMKFR
FT                   IENNRKY"
FT   gene            7045..7836
FT                   /locus_tag="Lebu_0006"
FT   CDS_pept        7045..7836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37943"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA1"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_2672"
FT                   /protein_id="ACV37943.1"
FT                   /translation="MKKIFLIIGMLLGINGFSDKNVNKNNVKIKQSVIATTYTYPDGKN
FT                   SFWSDVLTLGKEKVPYVLINPNNGAGKKMEVNYAAQIKKNKEAGIKNIAYIATTYQRRN
FT                   IKEVKAEVDRYFEFYGTDSINGFFFDEIASSTSQQVSYMKEIFDYVKSKSKNNLVIANP
FT                   GAPITDAISPYADIFVTSEVSTNTYIKKFEKPKSNFENNQSNAKHIWHIVHSAAPKEYA
FT                   EIIRLSRERNAGWLMITDDIMPNPYDRKPSKFIEMVNMINN"
FT   gene            7915..8952
FT                   /locus_tag="Lebu_0007"
FT   CDS_pept        7915..8952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0007"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: cth:Cthe_2680 peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37944"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA2"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACV37944.1"
FT                   /translation="MYIEELLKEADKAMENYKYEDALVYLKSVLEIDESNYSALMTLSK
FT                   IYSDFGMFEEAREYAEKLQKKYPDSKDTLFTLGFVYQSLGRLKKAISLYKKFLEIEKNY
FT                   FVYLNMGMSYALLKYYRKAIENIDKAIEMEPESSEAYIEKGDCLTMMGKYNEAISEYEK
FT                   LLNSKFNQVEEFLLYARMGDTMAYANDIKAVIKYYNIAINCENVEDYIFEDYYEILFRA
FT                   EEFEEIKLLLLNYENATYENKRLSRIKMLNLQGRFFVKTEDYENAQKVCDKMIILEPEN
FT                   IRHYVNLVYVLELQHKYDEALEYVAKMAKFTEDKEFLKELKKRLRKNKRKFEKANEKSL
FT                   ENKEK"
FT   gene            8979..9893
FT                   /locus_tag="Lebu_0008"
FT   CDS_pept        8979..9893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37945"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA3"
FT                   /inference="similar to AA sequence:KEGG:Fjoh_2518"
FT                   /protein_id="ACV37945.1"
FT                   /translation="MEEKNYEVNKKYDEKILINILKNFDKTGEYVVEPGRNEIKKFEIY
FT                   IENNLKKGNEKKKKNNNIENTETKKMVNVKKFKQKDFITNFFYKFKGSKAKRSYEYAKK
FT                   LLECKIKTPEPIAYFDDFVNENNKKNSYYISEELKYDFTCREVFWPEDIERDKAEQGEN
FT                   YKISEETERMLAKVEKNREKIIRQFAKFSFDLHENGVEFEDYSPGNVLIKDKSGNYEFY
FT                   LVDLNRMKFGAKLNLDKRMKNVSRMMEDEKIANIFSNEYAKYYKQREDLVFRYLRYYIR
FT                   KHKRYVYFKDITRPVRNVFKKKK"
FT   gene            10638..12530
FT                   /locus_tag="Lebu_0009"
FT   CDS_pept        10638..12530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0009"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: fnu:FN0007 tRNA
FT                   uridine 5- carboxymethylaminomethyl modification enzyme
FT                   GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37946"
FT                   /db_xref="GOA:C7NCA4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA4"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACV37946.1"
FT                   /translation="MKNYDIIVVGAGHAGVEAALAAARHGLKTALFTIYLDNIAMMSCN
FT                   PSVGGPGKSHLVSELGMLGGEMARHIDNYNLQLKNLNHTKGLASRITRAQADKYWYRIK
FT                   MREIIEKQENLDLVQGIVVDLIVENKKVMGVEDNLGIKYGAKAVVLCTGTFLDGEYVMG
FT                   DVKYSSGRQGEPASVDLPDRLVEYGFELDRYQTATPPRIDKSSIDFSKTEELKGEDKPR
FT                   YFSYETKKEYNSTLPTWLTFTTPETIRVGQEMLKYSPIVTGIVSTKGPRHCPSLDRKIM
FT                   NFPEKTNHQIFLEQESVESDEIYINGFTTAMPPFAQEAMLKTISGLENAKIVRYGYAVE
FT                   YNFVPAYQLKLTLETKVLDGLYTAGTINGTSGYEEAACQGFMAGVNAARKILGKKEIVI
FT                   DRSEGYIGVLIDDIINKKTPEPYRVLPSRAEYRLTLRQDNIFIRLLEKAKEIGLLNAEK
FT                   LTELENTCQEIENEIERLKSITVYPTKENNEKLLEIVEKQNQSESAEIEKTSKNSMNSP
FT                   VSAFEFLARKEINYNNLSEFVKTVKLSDLAKEQVEINAKYNVFIEREKAQIEKFKKLEK
FT                   MIIPKDFDYESVKGLSNIAISGLIYGQPETIGQASRISGVTYNDISLLIAILKN"
FT   gene            12752..13609
FT                   /locus_tag="Lebu_0010"
FT   CDS_pept        12752..13609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0010"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cbb:CLD_3667 DMT family permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37947"
FT                   /db_xref="GOA:C7NCA5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV37947.1"
FT                   /translation="MWIVFAFASAIFAGLTAILAKIGVKNVDSNVATAIRTVVIVIFAG
FT                   FMAFMIKGYESELTLKSLTFLILSGISTGLSWLCYFKALQVGDVNKVAPIDKSSTVLTM
FT                   ILAFLFLREALTVIKIVGILMIGTGTYLMIEKKENTSYENTGKKSWLFYAILSAVFAAL
FT                   TSILGKVGITGIESNYGTAIRSVVVLVMAWIVVFTAKKQIEVKNIDKKTFIFLVLSGIT
FT                   TGLSWLTMYRALQDGQASVVVAIDKLSILFTVAFSYVAFKEKLNIKSFAGLIGITVGTL
FT                   ILLI"
FT   sig_peptide     12752..12814
FT                   /locus_tag="Lebu_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.786 at
FT                   residue 21"
FT   gene            13617..14594
FT                   /locus_tag="Lebu_0011"
FT   CDS_pept        13617..14594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0011"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bcl:ABC2895 enterochelin ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37948"
FT                   /db_xref="GOA:C7NCA6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA6"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV37948.1"
FT                   /translation="MEVTKIKGNNKNIIFLIIILVILSIVSLLTGVQKFTLENLLLGKE
FT                   TQLLIISRIPRLVSILVTGASLGIAGIIVQTISSNKFVSPSTIGTMDWAKFGIMISLIF
FT                   LGDKSTLLKMTVAFIFALFGTMLFMKVLSKMKIKNVVMIPLIGIMLGNVVNSITGFVAY
FT                   KFDLIQNIGSWMQGNFALVVKGRYELIYIGIPFLVLAYIYTDKFTIVGIGKDFSANLGL
FT                   NREKITFIGLIIVSVITASIVVTIGTIPYVGLIIPNIVSIYKGDNMKKSLPDTAILGAL
FT                   FVLICDIAGRIVMYPYEVSISVIMSIVGSLIFLILIFRRYKYAN"
FT   sig_peptide     13617..13709
FT                   /locus_tag="Lebu_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.690) with cleavage site probability 0.357 at
FT                   residue 31"
FT   gene            14584..15555
FT                   /locus_tag="Lebu_0012"
FT   CDS_pept        14584..15555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0012"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bay:RBAM_004060 YclO"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37949"
FT                   /db_xref="GOA:C7NCA7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA7"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV37949.1"
FT                   /translation="MPIKNLDKSSQMKKIIILMALSLLGMLLFILFGLTFDNMSFNLPR
FT                   RALKVLAIAIVSFSIGYSSIVFQTITGNRILTPGIMGLDSLYMFIQTVVVYFFGSRQLA
FT                   MMTDTFQFFFSGIIMVGASLLLYVFLFNGKMKNIYFLVLIGIIFGGFFNGLSNFMQMML
FT                   DPNEFLVLQGKMFASFSAINVKLIGVCLVLIIFCIISIIPDLKRLNVLSLGEDHAINLG
FT                   INCKRLIRKQMIVISVLISVSTVLVGPVTFLGLLVASLAREVVKGYKHRIMIIIAFLIG
FT                   NIALIYSLFIVERLLNFSATINVIIDFIGGIYFIYLITRNQA"
FT   sig_peptide     14584..14685
FT                   /locus_tag="Lebu_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.474 at
FT                   residue 34"
FT   gene            15606..16361
FT                   /locus_tag="Lebu_0013"
FT   CDS_pept        15606..16361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0013"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpy:Cphy_0733 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37950"
FT                   /db_xref="GOA:C7NCA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV37950.1"
FT                   /translation="MIKVDNIFKKYGEKEILSDVSLELPKKKIISFIGSNGVGKSTLLS
FT                   IITRTLSRDSGNVVIENKNLEEWRTEELAKVLSILKQSNHLNIRLTVKELVSFGRYPYS
FT                   KGKLTLEDEEKVEQAIEYMGLKNLENRFIDELSGGQRQMAYIAMVIAQDTEYIFLDEPL
FT                   NNLDMKHSVQIMKILRNLVDEKGKTIIIVIHDINFVANYSDYIVALKDGKMVRHGNTEE
FT                   IMKNEVLKDIYGMEIPIYEIENRKFCLYY"
FT   gene            16394..17332
FT                   /locus_tag="Lebu_0014"
FT   CDS_pept        16394..17332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0014"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bcy:Bcer98_0362 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37951"
FT                   /db_xref="GOA:C7NCA9"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCA9"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV37951.1"
FT                   /translation="MIKKTGKILVLIALSIIFIVGCSKSGNEKAGNGKQLTISTVKGDV
FT                   KVPENPKKVAVFDYAALDVIGTLGVKPELALPASNVPEGLKQYAQGAVDAGDVKEPNLE
FT                   KISEFKPDLIIISGRQTKFYDELSKIAPTIFLETDTKNFISSSNENAKKIASIFGKEKE
FT                   ADEQIAKINSEINDIKNIAKNYNKKALVTLTNDGKISAFGANSRFGFIFTDLGLKNIDD
FT                   SIKASTHGQEINYEYIAEKNPDIIFYVDRTKIVGGSKAGADVLKNELVANTNAGKTNKV
FT                   VALDAENWYLVSGGLATIQKQLEEIKTAITK"
FT   sig_peptide     16394..16471
FT                   /locus_tag="Lebu_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.482 at
FT                   residue 26"
FT   gene            17639..19042
FT                   /locus_tag="Lebu_0015"
FT   CDS_pept        17639..19042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0015"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: fnu:FN0944 Na+
FT                   driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37952"
FT                   /db_xref="GOA:C7NCB0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB0"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV37952.1"
FT                   /translation="MEESIKEKNSLADNKKMRFGTESIPKLLVSLAVPAIIANLVNALY
FT                   NVVDQIFIGQKIGFLGNAATNVAFPLTTICLAIGLMTGVGAATNFNLELGRKRPKRAKS
FT                   VAGTAVTMLLLGGIVLCILINIFLRPMLTAFGATNQIFDYAIEYTQITSLGIPFLLFAI
FT                   GANPLVRADGNAFYSMLAIVVGSLVNTILDPLFMFGFDMGMDGAAWATVIGQFVSAVIL
FT                   ALYFFKFKSVKFEVKDFKIKIREIGILFALGTSPFIFQCSALIIQIVTNNLLKIYGAKS
FT                   IYGSEIPIAVAGIVMKINVIFIAIVLGLTQGAQPIAGFNYGAKKFKRVREILNLTLKVA
FT                   FVISLVAFAIFQFFPVQIISIFGSGSELYFKYGTKYMRVFLFFIFLNGVQGAITMFLTS
FT                   IGRAFQGAFLSLVRQIISLLPLLIILPYFMGVDGIMFAFPLADLAAFVVSVIVLRREMK
FT                   KIPLENEED"
FT   gene            19100..20242
FT                   /locus_tag="Lebu_0016"
FT   CDS_pept        19100..20242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0016"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: fnu:FN0651
FT                   ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37953"
FT                   /db_xref="GOA:C7NCB1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB1"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACV37953.1"
FT                   /translation="MKKFRIEKEHQRMKISQYLREVQNYSGRSLRNVEVFLNGKQVRLT
FT                   KKLPSHGNLRVVEKKKGTDIKPIKLPLDIIFEDEDILVVNKEPFLLTHPTQKKADFTLA
FT                   NGIVNHFFEKYGEVRVPRFYNRLDMNTSGLIIIAKNSFAQAFLQNFSIFEKKYLAIVNG
FT                   IIDDKGIARINEELAKDGEKHKIQDLEKENLKSEVEKINFGKVKKYEEIEKIESNLNVE
FT                   NEDSKIAENTNFDNKDNNLNLANKSNFENENLKENKTKIIIERRIFRDGENLERIIDTR
FT                   GQYAKTAIKVLKVYPEKNVTLVECELFTGRTHQIRVHLKSIGHTIVGDELYGNGLNKEL
FT                   GINRQFLHAYKVKFIHPALKKEIELEIPMFKDMKEFLENK"
FT   gene            20386..21729
FT                   /locus_tag="Lebu_0017"
FT   CDS_pept        20386..21729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0017"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: spx:SPG_1848
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37954"
FT                   /db_xref="GOA:C7NCB2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB2"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV37954.1"
FT                   /translation="MKKFNFSVDLINDNILKSLLIFSIPILVSNIFQQLYNMADIAIVG
FT                   HTLGDNSLAAIGASAAIFELIFGFALGIGNGLSMVTARNYGANNKNLLKKSVAGSIVIG
FT                   IWITVGVMILSRFILMPLLKILHTPENIINEAFEYINIITMFIGVTFSYNLSSGLLRAI
FT                   GNSFMSLVFLVIASILNIFLDIYFITSLKMGIGGAAIATVIAQAISVILSIIYIYVKEP
FT                   ILIPRKKHFRFDKKLYKELLGQGLSMGFMIAIVLMGTLILQYAINGFGYLIIAGHTSAR
FT                   KLMGFCNIPLTTIALALATFVSQNKGANKVDRIQKGVFYANMMDIIFAIGIIIFVYLFS
FT                   KNMIHLMSGSESEIVLHNGSTYLKIASPFFTILGILFNLRYALQALGEKLIPLVSSVIE
FT                   FLGKIIFVIFVVPKLGYFGVMICEPLIWIVMVGQLGIAFYGNGYVKNY"
FT   gene            21894..23357
FT                   /locus_tag="Lebu_0018"
FT   CDS_pept        21894..23357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: see:SNSL254_B0002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37955"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37955.1"
FT                   /translation="MKKEIIKILKLEGPMLSGELAKKIKMKYNTTNENARQIISRAKSP
FT                   VQKLKTINFSNRQRYVYLEEQYNKEKYKDNLYEALKKAAKNYYQILIAIENNGGFISKK
FT                   VLASYVSAPVKDLKGHLRYDKLIENLINLGFIDEFDDEYYQLLYPLTKLNISRTKALEF
FT                   AQKQVISDLNNLMRNLNLVAYNSSKTFFQEAEFAKFQWAFSSPSYITGLFNKKNNKPGF
FT                   FICDIKIGKKLIEEDIKFFIDKLDIIKNFKKLSNFTPIIVASSYDKETHQKLKEKGIVV
FT                   STVKDLFSEKYVELLEKLIEIMTNSAAIISKNPKILEELAKENELLKGKMGNLFGDLFE
FT                   ISVGYYFFNLGCKYLDMNKIIEFQKENEIKKTKREIDIYVEKNNKLIIVECKGRKNYLN
FT                   FEETEKYLKEKIPIIYKGLRKNNSNQEIEFELWSTGGFSEEALKLLEEYKEKTKKYKIS
FT                   YFNKNEIEEKAKKSNCEILKKSIKSIFSK"
FT   gene            complement(23523..23936)
FT                   /locus_tag="Lebu_0019"
FT   CDS_pept        complement(23523..23936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37956"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37956.1"
FT                   /translation="MKKIIFTLFLLTFSLSFSDSDIDIISKEVWRCPHSVDRTFKGLTY
FT                   IKFLNENGKPSISVSILDNRAALKTGKVSLELSQLDYEVKENENSIYFTNLNDKTQVFS
FT                   NYKLSYSFDKKNRPKMDLYRISDNKKLCSLITN"
FT   sig_peptide     complement(23880..23936)
FT                   /locus_tag="Lebu_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.843 at
FT                   residue 19"
FT   gene            24126..25337
FT                   /locus_tag="Lebu_0020"
FT   CDS_pept        24126..25337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0020"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37957"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB5"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ACV37957.1"
FT                   /translation="MIRISNFSSLVKTFFKNIFSFRLPFEQQFKLFVTKAFETLFRVYV
FT                   KRVDDYFFHSNERKNKFKSKGFVKRTVTTAFGHVTFERRKYVNKKTGIHYYIDEKIGLK
FT                   RYRQLSEEMIFTILFEYQHTTASFLAKTYGISRATVYNLVNSFQMPKLNIERFERDDNS
FT                   PVYMEIDEDHMKCRRSKNTYMRMVVIHRGIEEISRDRNKLIDKHTIMFPTSVSLEEVSE
FT                   YVLNYLEKRYNMDKKKLIVNSDGGIWIDSFVRELGIYKPIHIYDKFHLVKAIAEISKRD
FT                   KEISKNLYKWLKGDDFKELENFYENFKEKENVSQRRKDQTKMLFNQYEKIRRIYTKEDY
FT                   IGSRTEALVSHECSRFLSSRPKAFSRRKIKARALYYTLLSLQTMEKTGKRRMNCTLAAK
FT                   ERVH"
FT   gene            25352..25474
FT                   /locus_tag="Lebu_0021"
FT   CDS_pept        25352..25474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37958"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37958.1"
FT                   /translation="MECLPEIVNETGKNTNMPYLRGGECPTREVLKEISQSKIF"
FT   gene            25868..26608
FT                   /locus_tag="Lebu_0022"
FT   CDS_pept        25868..26608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0022"
FT                   /product="anaerobic cobalt chelatase"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG:
FT                   cpy:Cphy_1387 anaerobic cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37959"
FT                   /db_xref="GOA:C7NCB7"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB7"
FT                   /inference="protein motif:PFAM:PF06180"
FT                   /protein_id="ACV37959.1"
FT                   /translation="MEKAVLVTSFGTSHKDTREKCLDSIENKVKAKYGSERVERAYTSG
FT                   VIRQIVKKKEGIHIFDQNEGLEALKNKGYDEIVTMSLHILDGIEYAKLNDKYGKISKPL
FT                   LVTDEDFRKVVNDEEFNSTEGNDAIVFMGHGSESSADSTYQRLQEEYVKAGKDNIFIAT
FT                   VEGQVTIEDVIQKLKGRGFSKILLKPFMIVAGDHAKNDMASDEEDSWKTILQNEGYEVT
FT                   PVLKGMGEYKFIHNMFMDKLQEVY"
FT   misc_binding    26638..26819
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 87.68"
FT   gene            26971..27912
FT                   /locus_tag="Lebu_0023"
FT   CDS_pept        26971..27912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0023"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fnu:FN1521 peptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37960"
FT                   /db_xref="GOA:C7NCB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV37960.1"
FT                   /translation="MKNNKKLIKYLIQILVVLFGISFFTFCLMYISPGDPAQVMLTECG
FT                   HLPTPELLAQTRAELGLDKPFYIQYWKWLFGVLQGDFGKSYSLRVPVIQKIGQAFIPTL
FT                   SLSFMALFLMCVISIPTGILAAVKENKWQDYLIRMMTFMGMSVPSFWLGLVFLSIFGVQ
FT                   LRLVSVSGGNADFGSMILPALTIAIAMSAKYIRQIRHIFLEELNKSYVTGARMRGIKER
FT                   DILWKHVLPNAMLPIITLLGLSLGSLLGGTAVVEIVYNWPGMGRMAVKAISAQDYPLIQ
FT                   SYVLIIAFLYLIVNIAVDISYKYLDARVEEVI"
FT   gene            27915..28736
FT                   /locus_tag="Lebu_0024"
FT   CDS_pept        27915..28736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0024"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fnu:FN1522 peptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37961"
FT                   /db_xref="GOA:C7NCB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCB9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV37961.1"
FT                   /translation="MNKLKFMGKNTQLKIFLALAIIVVLIAIFAPFIVPNDPFKQLGPS
FT                   LLRPSKQYIFGTDQLGRDLFSRVIYGSRYSIFMTLTLMFIIFAVGTILGVLAGYFGGIV
FT                   DTVIMRLGDMMIAFPGLILAIAIAGLLNPSVKNSIIAIAAVTWTKYARLARSMVLKIKQ
FT                   ELYVEAAKITGSRDYSIIFKYIIPNMITTMIVTAVSDMGTLMLEIAALSFLGFGAQPPT
FT                   PEWGAMLNEGRTTLSRAPWMMMYPGLAIVIVVIIFNMLGDSVRDLVDVKSE"
FT   gene            28788..30347
FT                   /locus_tag="Lebu_0025"
FT   CDS_pept        28788..30347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0025"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: fnu:FN1523 dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37962"
FT                   /db_xref="GOA:C7NCC0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV37962.1"
FT                   /translation="MLKNRKSKFLVLIMALLTLLVACGGKSAKSKSNPDELVVGVTSFA
FT                   DTLEPTDQYFSWVVTRYGVGENLTIFDEKGNLKPLLAENWKLSNDKLEWTFKIRDGVTF
FT                   SNGHPLTAEAVKKSIERVFAKNKRAESFFKYTSIEASGQELKIKTKEPVAILPESLADP
FT                   LFLIVDTSVNTDEFAQKGPISTGPFVVQEFKPGEQTVVVRNENYWNGKAKLAKVTFKDI
FT                   NDQNTRALSLKSGEIDVAYNLKVTNKADFEGDKNIVINELKSLRSTYAFMNQTKGLKDK
FT                   ALREAIIRGANRENYTQNLLQGGATPGKAPVPPTLDFGFNELKDENAYNRESAKKILAD
FT                   AGYKDVDGDGFVERPDGSKIDLNFVIYTSREELQIYAQAFQTDMKEIGIKVTLKPVSYE
FT                   TVLSMRDDSNFDMLIWNVLAANTGDPEKYLHENWYSKAETNKTGYSNPEVDKMLDELSK
FT                   EFDKAKRKDLVVKIQQLIMNDAATLFFGYETTFLYSNKVVTGLKMYPMDYYWITKDVAK
FT                   AN"
FT   sig_peptide     28788..28880
FT                   /locus_tag="Lebu_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.624 at
FT                   residue 31"
FT   gene            30357..31142
FT                   /locus_tag="Lebu_0026"
FT   CDS_pept        30357..31142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0026"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fnu:FN1524 peptide ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37963"
FT                   /db_xref="GOA:C7NCC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV37963.1"
FT                   /translation="MLEIKDLTIQYGDKPPVVENFSLSLKKGEIITIVGESGSGKSTVL
FT                   SSILGLLPNGGKIISGDIIYNGESMLSKSLNQWRELRGTEITMISQDSGGTLNPIRKIG
FT                   KQFVEYIQTHSKMSAKEAEEKAKDMFSKVNLPDPEIIMKSYPHQLSGGMKQRVGIAMAL
FT                   TFHPKIILGDEPTSALDVITQAQIVKEIMDLRKKFDTSIIMVTHNLGVAAYISDKIIVM
FT                   QNGKIVDAGNKNEVIENPKSDYTKKLLAAVPEIGGERLV"
FT   gene            31135..31932
FT                   /locus_tag="Lebu_0027"
FT   CDS_pept        31135..31932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0027"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fnu:FN1525 peptide ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37964"
FT                   /db_xref="GOA:C7NCC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV37964.1"
FT                   /translation="MSNINDVILETKNLTKIYEKPNDKKVVACNNVNLKIHKGKTLGIV
FT                   GESGSGKTTLVNMLMDLEKPTSGEILYHGRDISKFTKQEVWENRQNIQIVFQDPWSAFN
FT                   PKMNVMQILTEPLMNYGRLKKSERKQKAEELLKMVDLPEEFVTKYPQNMSGGQRQRLGI
FT                   ARAISLEPEILICDEATSALDVSIQKNIVELLVKLQKEKNITMIFICHDIALIESFAHE
FT                   IVVMYHGDVVEVIEGGQISEKAKHPYTKSLLSAIFPVRGKLMK"
FT   gene            complement(32091..33578)
FT                   /locus_tag="Lebu_0028"
FT   CDS_pept        complement(32091..33578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0028"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   KEGG: fnu:FN0644 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37965"
FT                   /db_xref="GOA:C7NCC3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC3"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ACV37965.1"
FT                   /translation="MRKGKVYIAGAGCGDEGLITLKLKNVIEKADCIVYDRLVNENILQ
FT                   YAKSDVEMIYMGKENTAGGKLQAEINKKLVEKGKEGLAVLRLKGGDPFVFGRGGEEIEA
FT                   LVAENIDFEVIPGITSSIAVPAYAGIPVTHRGINTSFHVFTGHTQFNGIELDFPVIAKL
FT                   EGTLVFLMGLSNLEKIAENLINNGKNPKTPVAIIKDGTTTRQKTYTGTLETIVNTVKEH
FT                   NVKSPAIILIGEVVNLRENMKWFENKPLFGKNILVTRNREKQGNISNKINELGGQALSL
FT                   PFINIEYVDFEMPDLKEYSTLLFNSINSVIGFMRKVKDIRSLGNVKIGVVGEKTAEEIE
FT                   KYKIIPDFYPEEYTVERLANESVNFTKEGEKILFIVSDISPVNEKKYSNLYNRNYEKLV
FT                   VYKTQKVEVEKEKAEKYIKESDILMFLSSSTFKAFADSINLSENEEIKEILKNKIIASI
FT                   GPVTTKTIEKYGLKVEIEPKKYTEEGLFEKILKFINN"
FT   gene            complement(33565..34533)
FT                   /locus_tag="Lebu_0029"
FT   CDS_pept        complement(33565..34533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0029"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: fnu:FN0645 porphobilinogen deaminase; TIGRFAM:
FT                   porphobilinogen deaminase; PFAM: Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37966"
FT                   /db_xref="GOA:C7NCC4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC4"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ACV37966.1"
FT                   /translation="MKSNKIIIGTRGSILALAQAEKVKEMLIKKYDELRENENFCEIEG
FT                   FDKKNPLEIELKVIVTKGDKDLRDFTKIKGTTQKDLFVKEIEKEMLENKIDLAVHSLKD
FT                   MPQNTPEGLLNACFPMREDNRDVLVSKNGKKLKELDENSVIGTGSIRREKELLNLRNDV
FT                   KIKAIRGNIHTRLKKLDDGEYDAIVLAAAGLKRVGLENRITEYFDKDSFMPAPGQGILC
FT                   IQCRENDNKIRHLLKIINDDEVTIMCKAEREFSKIFDGGCHTPIGCSSVIEGNTLKLKG
FT                   MFNDNGIRIFKEVEGNRENPKETAQKLAEEIKKEEMKNEKR"
FT   gene            complement(34530..35570)
FT                   /locus_tag="Lebu_0030"
FT   CDS_pept        complement(34530..35570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0030"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like; Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   fnu:FN0646 glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37967"
FT                   /db_xref="GOA:C7NCC5"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC5"
FT                   /inference="protein motif:PRIAM:1.2.1.70"
FT                   /protein_id="ACV37967.1"
FT                   /translation="MKENLVKNFYILSFSYKNLSLEEREKFVKEGYRHVLREYLEKRII
FT                   KGYVAVETCLRIELYLDVSKEFEIEKLKRDFKIEKMKDYRGTEAVDYLLRVICGLDSII
FT                   KGEDQILVQLKKAYFDALDKNITSSFLNIMFNQAIETGKRFRAESKINEKNISLDSIAV
FT                   KFIRTKFESLENKKIFVIGVGDLSQSILTLLHKMNNCHLTMTNRSLRKSIELQKVYPDV
FT                   QTAEFNEKYNVIKNMDIVISATSAPHLILETAKIQNILNDGKKRFFLDLAVPRDIEASI
FT                   GESENASLYHLEDIWDEYNKNVEKRDEIVEKYSYIIEEQLKKIAEKLEKRRKYTNQKNI
FT                   EIGENR"
FT   gene            complement(35594..35791)
FT                   /locus_tag="Lebu_0031"
FT   CDS_pept        complement(35594..35791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37968"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37968.1"
FT                   /translation="MAMKTIEILNLNQKKLCESRKSFIYQNSSRKEGKIVINIENLKYI
FT                   TKFPTLKEFLLKNLKSATEK"
FT   gene            complement(35798..36211)
FT                   /locus_tag="Lebu_0032"
FT   CDS_pept        complement(35798..36211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37969"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37969.1"
FT                   /translation="MLKVDKNDEPKFFAEFKKKSNPKSWKDFDFEIKDKLKEYMLENEQ
FT                   KIDGIYFCPYCERQISVEKSQIEHIKPKDKFPKLFHNYSNFLTGCLENQTCGSIKGNKW
FT                   DDNFVNPVEYNPRDYFEYSISTGEIIPKYENGI"
FT   gene            complement(36195..37457)
FT                   /locus_tag="Lebu_0033"
FT   CDS_pept        complement(36195..37457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0033"
FT                   /product="ATP-binding protein involved in virulence-like
FT                   protein"
FT                   /note="KEGG: mar:MAE_39710 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37970"
FT                   /db_xref="GOA:C7NCC8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC8"
FT                   /inference="protein motif:COG:COG3950"
FT                   /protein_id="ACV37970.1"
FT                   /translation="MKIKNLHIEEYNGLENLDINFESEGKVLDLIVLAGINGSGKTRVL
FT                   ESIRYWFEMFRSKAVNVELFYEENEREVLESLMNSEGLTEVEKEAQKDIEFTDCLKNIK
FT                   FYNYDYRHNKTENQNYNSKIISRSFRKLKIFPKIIYVPTEINFEEIKKAQTNLKKEYSF
FT                   INIVDSYEIKDIPSYIATRISKVANEEEDLTMGQVRKKVFEEINGIFEILELDVKLSEI
FT                   SKDENSMPIFTNSSGKKFGINELSSGEKQLFLRTLAIKMLEPENSIIMIDEPELSLHPK
FT                   WQQKIIDVYKKIGKNNQIILATHSPHILGSVEKESIILLVKNKNGVVEVRTGENFGNSY
FT                   GQTMERILEDIMGLETDRNPSVHELLNQVREMVKNDNYESSEFERKYSKIKDILGEDDR
FT                   DLFLVDMDLQIKKGRKNAESR"
FT   gene            complement(37491..41249)
FT                   /pseudo
FT                   /locus_tag="Lebu_0034"
FT   gene            complement(38835..38990)
FT                   /pseudo
FT                   /locus_tag="Lebu_0035"
FT   gene            41670..42026
FT                   /locus_tag="Lebu_0036"
FT   CDS_pept        41670..42026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0036"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /note="KEGG: spd:SPD_0716 IS630-Spn1, transposase Orf1"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37971"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCC9"
FT                   /inference="similar to AA sequence:KEGG:SPD_0716"
FT                   /protein_id="ACV37971.1"
FT                   /translation="MAYEKDYRKRILNFYYENGKTKTLFQFNISSSTLYGWIKLKKETG
FT                   DLSSRTRKRKFKVLDPEKLDEYMKEPKNADKYIREIAKDFGCGKETVRVALKKLGYTRK
FT                   KTDKIQGAGREKSK"
FT   gene            42067..42544
FT                   /pseudo
FT                   /locus_tag="Lebu_0037"
FT   gene            42717..43535
FT                   /locus_tag="Lebu_0038"
FT   CDS_pept        42717..43535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37972"
FT                   /db_xref="GOA:C7NCD0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCD0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37972.1"
FT                   /translation="MKINDLNEKFEDFEKENISSVFQGLMKITGIVVLAVFLVLFKRMI
FT                   YMQYYLSFIMKFRSTDVKEKITMLAAIFTLFSLIVIIVSAIIFIKMIKDYFNENSMELS
FT                   HKIKYYVIIFIGILIIINSIIGTSEVLKQMKLNFTFIQKIMLFLFSGIPSGVIATSATA
FT                   FFSVVFLFSVKTYEKKLYEHRIIGIIYTAIVSIIGLLGINFIMELSNLYKNYSFKVGHE
FT                   FKLFIHFLKFVLRYKNLYIEIFNMYFCVNLFVIIFLGILLIFAKKNREGE"
FT   gene            43537..45231
FT                   /locus_tag="Lebu_0039"
FT   CDS_pept        43537..45231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0039"
FT                   /product="4-phytase"
FT                   /EC_number="3.1.3.26"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tte:TTE0208 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37973"
FT                   /db_xref="GOA:C7NCQ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ3"
FT                   /inference="protein motif:PRIAM:3.1.3.26"
FT                   /protein_id="ACV37973.1"
FT                   /translation="MKKMYTIFILLLGVFNLSCSESKTGTYSENKTEKNIFNTIVDTIS
FT                   GAKFEYNVAESTPDTFNLVHLFLPESYDAQLLNDKHPENIRNYEAADIFDLLFEGLVRI
FT                   DENGKIVPGLAEKWETGKDKTKWTFHLRKGLKYSDGTPIKAEDFKTALLRMLNPEIISP
FT                   NTDVLFLIKNGREFYEGKVKAENVGIKILDNNETIELELTKPIGYFDMLMTKVEFSPLN
FT                   QEFFGKLGEKYGKIPENILYSGPYIIKSIGKRKLLLEKNKNYWNGNSIKMNKINVYGGL
FT                   WDGDDYKRIAESKGIDATVVYSQFFSRTKLKNDMKETQRLSTGSSHYYVFNTKVKALSN
FT                   PKVRKAIDAVMAGETRKEYGFVPEYISINGKNFSALAAKNGKTESESYHYKNIKELLDE
FT                   GLKELGINKMPVLNIVIKENSIDGFSENLKKHLGIDVEVTRMSYKDLILKSRKKDFDII
FT                   ENEILLGFNDPILYLERFVSDSPYNYGSYSNSEYDKLIKIASETKDINIRTDALIKAEN
FT                   IYEKENPAAKMGYGEITHIILERPGIKELKLVPYGGILYLRNVNKAK"
FT   sig_peptide     43537..43599
FT                   /locus_tag="Lebu_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.363 at
FT                   residue 21"
FT   gene            complement(45984..46703)
FT                   /locus_tag="Lebu_0040"
FT   CDS_pept        complement(45984..46703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37974"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ4"
FT                   /inference="similar to AA sequence:KEGG:FN0721"
FT                   /protein_id="ACV37974.1"
FT                   /translation="MKRGLLFILSVFLICSLFALGENFPDNAKNVNGFVPAGWKTILSA
FT                   KGDLNNDKLEDTVVVIEKDDKANIVKNENLGSEYLNLNPRILLVLFKQKNGNYILVSKN
FT                   DKGFIKSAGDKENPALMDTLDNISIKNNILKIKFNYFLSAGSWSVTQNTYTFRFQNKKF
FT                   ELIGFDNNSYMRNSGNQEEFSINFSTNKVKITTGGNMFDEKANKPKEEWKTIKANKKYV
FT                   LDEMTSDIVDEIAKYVY"
FT   sig_peptide     complement(46638..46703)
FT                   /locus_tag="Lebu_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(46726..47832)
FT                   /locus_tag="Lebu_0041"
FT   CDS_pept        complement(46726..47832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0041"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   fnu:FN0973 threonine-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37975"
FT                   /db_xref="GOA:C7NCQ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV37975.1"
FT                   /translation="MDFHGGNIYKIFREKNITEILDYSSNINPYGVPESLKQKIAENIG
FT                   ILERYPDPDYVELREKLAWLNKVELENIVLGNGATEAIFLFIKVIKPKKVLVVSPTFGE
FT                   YERAVRACKNSESQKIEIEYFELEEKEEFRLNIGKLKKELEKKYDLVIICNPNNPTGKF
FT                   LKMAETEEILRECNRYDTKLFIDEAFIEFLEDGLKESIVNSGENKKNLFVTRAFTKFFA
FT                   IPGLRLGYGIYFDKNLENKIAEKKEPWSVNNIAEMAGITVLDDTEYIEKTLNWITEEKR
FT                   YMYERLNEISGIKPYKTEINFICVKIKDELISKGLNVKKLREKMMEEGILIRDASNFKF
FT                   LDERFFRLAIKDRKSNDRVIKALKKILE"
FT   gene            complement(48098..49069)
FT                   /locus_tag="Lebu_0042"
FT   CDS_pept        complement(48098..49069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0042"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: fnu:FN0975 CbiB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37976"
FT                   /db_xref="GOA:C7NCQ6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ6"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ACV37976.1"
FT                   /translation="MNRLIFFIKILIAYVLDLIFGDPQNVVHPVQVIGKIISAGEKVLL
FT                   RKKYKFLAGAALNIFTVSITYTSMYLISKSVKISVFFMIIEIYLMYTIFSINSLAREGN
FT                   RVYRILKEGDIERARKDLSYLVSRDTETMDEKMIIRSTMETISENTVDGIVAPMFYMFL
FT                   GGMPLAMTYKAINTLDSMVGYKNEKYMDFGKFSAKVDDVANFIPARITGILIVLASMIL
FT                   GYDYKNSLKIFLRDRKNHSSPNSAHSEASVAGALGVQFGGKVSYFGKEIDKPTIGDKTK
FT                   EFELEDIRKNIRIMYVTSFLSLVIFSLIFTGAYFFIKILNIK"
FT   gene            complement(49062..50567)
FT                   /locus_tag="Lebu_0043"
FT   CDS_pept        complement(49062..50567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0043"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ
FT                   domain protein glutamine amidotransferase; Cobyrinic acid
FT                   ac-diamide synthase; KEGG: fnu:FN0977 cobyric acid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37977"
FT                   /db_xref="GOA:C7NCQ7"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ7"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ACV37977.1"
FT                   /translation="MERKHKNIMLLGTGSNVGKSIINAGFCRIFYQDGYSVVPFKSQNM
FT                   ALNSFITKDGKEMGRAQVVQAEAANIEPQAFMNPILLKPTTDRKSQVIVNGKVYKNMDA
FT                   REYFAYKHNLKKDIMAAYNHIRDNFDICVLEGAGSPAEINLKEDDIVNTGMAEMADSPV
FT                   ILVADIDRGGVFAAIYGTIMLLEESERKRIKGVIINKFRGDKSLLTPGIEMIEELTNVP
FT                   VLGVVPFVPLGIEEEDSLGIDKYNVKKEGKIRISVIKLKHISNFTDIDALSHYSDVSLK
FT                   YVTKSSELGDEDIIIIPGSKNTVEDMKDLIDKNISREIIRLAKRGTIVFGICGGFQIMG
FT                   QKIMDPQNIESNLKEISGLDLLDIETVMETAKTTTQYEKKIKNADGILAGMDGIEIKGY
FT                   EIHQGYSYPVNEEKTEIKCIFDDEKLKGAVKGNVGGTYIHGIFDNSEFTNHFLNEVRKL
FT                   KGLDKVNEDFSFKEYKNQEYDKLAQILRENVDIEKIYEIMGCE"
FT   gene            complement(50917..52734)
FT                   /locus_tag="Lebu_0044"
FT   CDS_pept        complement(50917..52734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37978"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ8"
FT                   /inference="similar to AA sequence:KEGG:Amet_2984"
FT                   /protein_id="ACV37978.1"
FT                   /translation="MKRYCYANSIENFLNEEKSNWLNKMKKNFRENYNLELGELQIKAW
FT                   DDSFEQLKKILVKIEEIKKNFNIIFEYELPYEGGRRIDVIILSNEKVFILEFKMKKNFL
FT                   VEDIDQTVAYFRDIQEYHFESRNKKIIPILVLTKSENKKTKRKKSITICSINYLSEVIQ
FT                   RVVTKENKMNGKSLKNWIYSKYEPLPTIIEAARVIMKNEELPNIRRVSSTRIPAAMENL
FT                   QNITIDAKKKKKHILVFVTGVPGAGKTYLGLQYVYDICESIKSINSIYLSGNGSLIKVL
FT                   SNTLGKNSNVFVKSIHKVINEYLEKGATDFDKNVIVFDEGQRAWDKERMNFKKKINRSE
FT                   PDILIEMTEKRLDWGVLVVLVGEGQEIYNGESSNLAHWNEAISKSEKKWEVICPERLTS
FT                   IFKSSSNIIKNDNFDLDISLRSHLANKVSQFVNFLLNSDIEKAKELAPSILNSGFNMYV
FT                   THSFGKAKKYCFKRYSKNEKKYYGVMASSQAKYSENFKNKKNNTDINVVKWFNDNDFNY
FT                   RIEQAISEFQCQGLEIDMPIIGWGEDMLWNEKERKWENFDKNNAGDSLYRVNSYRVLLT
FT                   RGRDGFIIYVPKKLSPVYEVLVGVGMEIL"
FT   gene            complement(52919..53413)
FT                   /locus_tag="Lebu_0045"
FT   CDS_pept        complement(52919..53413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD1266 putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37979"
FT                   /db_xref="GOA:C7NCQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37979.1"
FT                   /translation="MEKNTNKLVRKPNNFLGLILFTIIYFLVQSVIYPVLAYLFWFIFT
FT                   LFSTGILLEAPEQILKIFVIVFSLFCLIIILGIMYFLGYLCKRFLKKMNKKVLILVMIV
FT                   IFIYFVFRAIFENEYSSIMSRLTNGRKYIFCILSHVSFVIGVFYSDKVKKVLDRIKSKR
FT                   K"
FT   sig_peptide     complement(53321..53413)
FT                   /locus_tag="Lebu_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.657 at
FT                   residue 31"
FT   gene            complement(53432..53938)
FT                   /locus_tag="Lebu_0046"
FT   CDS_pept        complement(53432..53938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37980"
FT                   /db_xref="GOA:C7NCR0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37980.1"
FT                   /translation="MEKNTNKLVRKPNNFLGLILFAIIYFLVQNVIYPLLGFLFWFSFT
FT                   LIFGGIADALGILKIKEIQVILTYLFYCVCLVILSGFMCYLGYLCKDFLGKMNKIGLNT
FT                   VMIVILIYFLYKTVAGDQNSIIDALIDEKKYIFCTIFHISYIMGAFHSDKVKKILDRIK
FT                   FKRKK"
FT   gene            complement(53957..54448)
FT                   /locus_tag="Lebu_0047"
FT   CDS_pept        complement(53957..54448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37981"
FT                   /db_xref="GOA:C7NCR1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37981.1"
FT                   /translation="MSKAKSFLVLVLFTVIYFFFQKTIYPALALLFWLVFAMSSAGIIL
FT                   NTLEFLHLPQVAMTTIAVVISGIALIMVLILVFYLGYLCSKFLKKMDKTVLGSVMTAIL
FT                   IYFLYKVFTETDESTAMFAPTAREIHIFCTASHIFYTVGVFFSDKVKKILDRIKFKRKK
FT                   "
FT   sig_peptide     complement(54323..54448)
FT                   /locus_tag="Lebu_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.591 at
FT                   residue 42"
FT   gene            complement(54478..55206)
FT                   /locus_tag="Lebu_0048"
FT   CDS_pept        complement(54478..55206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37982"
FT                   /db_xref="GOA:C7NCR2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV37982.1"
FT                   /translation="MLTDTNIIWGFALLSPFIIPVLILLTFWFFVSKRKFNFLIAFTIL
FT                   SLLFVRYLRFPYDTVNRNSEIKISKNFLIKRTLSSDLEHEVYKLVDKTKLEDLILYLNG
FT                   LAKINNTWVGYIEETDSYEGKYGVKPETYFFINDNKIEYNLDEKTLEKRLGLKEIKLQD
FT                   AEYFVDKFGSKKEILYQYQLDKTGDLDENISLNSELSKKLEINYKKDRAFYLMFWSVML
FT                   LMEIIYLFIKNRKITKSNKD"
FT   gene            complement(55242..55631)
FT                   /locus_tag="Lebu_0049"
FT   CDS_pept        complement(55242..55631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0049"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: cbe:Cbei_2373 putative transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37983"
FT                   /db_xref="GOA:C7NCR3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR3"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV37983.1"
FT                   /translation="MKKNEQKIMQIKEFSEKTGLTPYTIRFYEKKELFRVKRDEKNRRI
FT                   YDETDIEWIKMLKRLKDMGMKLSEIKKYSDLRYEGNGTIKERIKILTNHKKYVNIEIEK
FT                   WQKYLQNLDDKLEIYESFLKSISEK"
FT   gene            55718..56497
FT                   /locus_tag="Lebu_0050"
FT   CDS_pept        55718..56497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0050"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   lin:lin0805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37984"
FT                   /db_xref="GOA:C7NCR4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV37984.1"
FT                   /translation="MKTKYTVITGASSGIGRAVALKFAERNKNLILIARRKNLLKDLKS
FT                   DILKKNPNLDILVIDFDLTDVGKIPELYSKLKNYHIETLINNAGFGMYGDVKEQPLNKI
FT                   SDMLHINVEALTLLSSLYVQDYYNEKGSQLINISSAGGYTIVPNGIVYCATKFYVNAFT
FT                   EGLALELKQNNAQLKAKILAPAATKTNFGNVATGKTDFDYDKSYPNYHTSEEMANFLIQ
FT                   LYESDKTVGYISRETFEFNLSDGFFQNAFSSKNNVKF"
FT   sig_peptide     55718..55780
FT                   /locus_tag="Lebu_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.497 at
FT                   residue 21"
FT   gene            56619..57962
FT                   /locus_tag="Lebu_0051"
FT   CDS_pept        56619..57962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0051"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37985"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR5"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ACV37985.1"
FT                   /translation="MIRISNFFSLVKTFFKNIFSFRLPFEQQFKLFVTKAFEMLFRVYV
FT                   KRVDDHFFHSNERKDKFKSKGFVKRTVTTAFGDVTFERRKYVNKKTGIHYYIDEKIGLK
FT                   RYRRLSEEMIFTILFEYQYTTASFLAKTYGVSRATVYNLVNSFQMPKLDIERFERDDNS
FT                   PVYMEIDEDHMKCRRSKNTYMRMVVIHRGIEEICTDRNKLIDKHTIMFPTSVSLEEVSE
FT                   YVLNYLEKRYNMDKKKLIVNSDGGIWIDSFVRELGIYKPIHIYDKFHLVKAIAEISKRD
FT                   KEISKNLYKWLKGGDFKELENFYENFKEKENVSQRRKDYTKMLFNQYEKIRRIYTEEDY
FT                   IGSRTEALVSHECSRFLSSRPKAFSRRKIKARALYHTFFANYGKNREKAYELYFSGKRT
FT                   SSLEKAIEMECLTEIVNETGKSTNLPYLRGGECTLREVLKEVSQSKIF"
FT   gene            58163..58987
FT                   /locus_tag="Lebu_0052"
FT   CDS_pept        58163..58987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0052"
FT                   /product="putative transposase IS891/IS1136/IS1341 family"
FT                   /note="PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; KEGG: bat:BAS3471 IS605 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37986"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR6"
FT                   /inference="protein motif:PFAM:PF01385"
FT                   /protein_id="ACV37986.1"
FT                   /translation="MKYNLAFKYRIYPNKEQELLINKTFGCVRFVYNTILYTANKIYEE
FT                   TGENKIITPARLKSENQFLKEVDSLALSNAQLNVKRSFTNFFQKRAKFPRFKSKKNNIK
FT                   SYTTNCVNNSIRIEENKYLVLPKLKRVKLKYHREIPGNYRIKLVTLTNSNGNYYVSVLT
FT                   EFEKEIQKNPSNDKVIGLDFSMSELFISSENQRADYPRYFRMLEKKLKKLQKSLSRKVR
FT                   FSKNWYKQKIKISKLHEYIKNCRRDFLHKLSKKLSEAYNAVELKLIEITMRH"
FT   gene            complement(59145..59873)
FT                   /locus_tag="Lebu_0053"
FT   CDS_pept        complement(59145..59873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0053"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: fnu:FN0912
FT                   cobalamin [5'-phosphate] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37987"
FT                   /db_xref="GOA:C7NCR7"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR7"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ACV37987.1"
FT                   /translation="MIKEFIILMQFMTRLPIPVNMEYDEEKLGKSVKYFPLVGAIIGVF
FT                   LFAVNFLAGKITGNRQIIAIALIIAEILITGLIHIDGLADTADGLFSYAKKEKMLEIMK
FT                   DSRIGTNGTVILILYFIAKFVFLSQVKSGYLLLYPIISRLSTSMNAGFGEYARKDGMSN
FT                   GIIDQNGKKEAIISIIIVAVLSFGIMKIKGLTILLLAIIFILWFMQNVKRKIGGITGDT
FT                   MGASLELTALLVLFAGIILN"
FT   gene            complement(60163..60678)
FT                   /locus_tag="Lebu_0054"
FT   CDS_pept        complement(60163..60678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0054"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   aoe:Clos_0675 redoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37988"
FT                   /db_xref="GOA:C7NCR8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR8"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACV37988.1"
FT                   /translation="MSEIKNKVTFKGNPVTLVGNEVKAGDVAPDFTVLSAELKEVKLSD
FT                   YKGKVVVIAVFPSVDTGVCALQLSRFNQEAANFGDDVQLLSISVDLPFALGRYCADKGI
FT                   KNALTTSDHKELDFGTKYGFVIKELRLLSRGTVIVDKDGIIRYVEYVPEIGEHPDYEKA
FT                   LEVIKELV"
FT   gene            61360..62982
FT                   /locus_tag="Lebu_0055"
FT   CDS_pept        61360..62982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0055"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /EC_number="3.6.3.24"
FT                   /note="KEGG: ssa:SSA_0499 ABC-type dipeptide transport
FT                   system, periplasmic component, putative; TIGRFAM: nickel
FT                   ABC transporter, periplasmic nickel- binding protein; PFAM:
FT                   extracellular solute-binding protein family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37989"
FT                   /db_xref="GOA:C7NCR9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCR9"
FT                   /inference="protein motif:TFAM:TIGR02294"
FT                   /protein_id="ACV37989.1"
FT                   /translation="MKNSFKTIIVMLMMGLIFACQPKQKDAAKGKTEKSGKITLAFNQE
FT                   PTGNLNPHEYLPSQFITQDMVYDGLVSYGENGKIKPMLAESWDISKDGKTYTFKLRKNV
FT                   KFSDGSDFNAKNVVKNFDTVFSKENKSNHSWFAFTNHLKSYRAIDDYTFEIVLDTAYTA
FT                   TLYDLAMIRPIRFLGDAGFPDNGDTSKGIKKPIGTGAWVLKEHKNNEYSVFVRNEYYWG
FT                   EKPAASEVVIKAIPDSETLALQFESGDIDLIYGNGLISLDRFETYRQDKKYTTATSEPM
FT                   STRMILLNTTSPILKDLKVRQALSHAVDKQSIAKNIFGGIEKPADTIFAPNVPHTNVEV
FT                   TKYNFDLAKAQALLDEAGWKKGADGMREKDGKKMILSFPYISSKVTDKNVGEYIQGEWK
FT                   KIGIQVDLKAMEEKAYWENATTKNYDLMSDYSWGAPWDPHAYLTAMADDSVNGTNPAYA
FT                   AQLGLPMKAELDKTIRALLIEPDQTKLNEMYKYVLTTLQEQAVYIPISYQALLSVYRTG
FT                   ELEGVKFMPEENRLPVWTTVKVK"
FT   sig_peptide     61360..61419
FT                   /locus_tag="Lebu_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.814 at
FT                   residue 20"
FT   gene            63111..64151
FT                   /locus_tag="Lebu_0056"
FT   CDS_pept        63111..64151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0056"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fnu:FN1503 nickel transport
FT                   system permease protein NikB"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37990"
FT                   /db_xref="GOA:C7NCS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV37990.1"
FT                   /translation="MLKRIYNKTIILTRNSSILKRLNIYSILRDDFVIKKLISLFSIFL
FT                   AISVITFFLVKLSPGDPAQNYLRASHVSITTETLAATRKNLGLDKPLHIQYFNWLTDIL
FT                   KGDFGTSYTKKAPVTELVNEAIVPTFQLGIFSFVILIILSPLLGILSAIKRNTAFDYII
FT                   QVLSYTGVSLPTFWLGYILIIFFSVSLKILPVSGRGDWKNFILPCITLVLPLIAQTTFF
FT                   IRKNILEEMEKAHVENAIIRGVSKKRIILNHLLRNTSIPIITVLSSNIMYLLTGSVLIE
FT                   EIFAWPGIGKLFTTAVKTGDFPLIQICLLFFGVMSIIVNEFTQVLVKYMDPRLRIKEKS
FT                   KAGGVL"
FT   sig_peptide     63111..63281
FT                   /locus_tag="Lebu_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.338 at
FT                   residue 57"
FT   gene            64154..64966
FT                   /locus_tag="Lebu_0057"
FT   CDS_pept        64154..64966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0057"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: san:gbs1575 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37991"
FT                   /db_xref="GOA:C7NCS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV37991.1"
FT                   /translation="MKKRKLFCFSVSLLAVLIFIAIFAPLLAPYDPQFTDISQKLQLPS
FT                   KIHKLGTDHMGRDVLSRLIYGTRLSLMISALITVVTLCISFPVGILAGWFGGKLDKIFL
FT                   WIVNVFMAFPSFLLSMAFVGILGQGIGNIVIAVSAVEWIYYARILRNTVSSVKQQEYVQ
FT                   AAQAIGASPFFIIRKHILPFVFKPVLIAALMNIGNIILMISGFSFLGIGVQPNISEWGM
FT                   MLNDAKPYFRRIPGLVLYPGLAIFITVLTFNLLGETFDNKGIKKLWKN"
FT   sig_peptide     64154..64237
FT                   /locus_tag="Lebu_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.799 at
FT                   residue 28"
FT   gene            64954..65739
FT                   /locus_tag="Lebu_0058"
FT   CDS_pept        64954..65739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0058"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ssa:SSA_0503 peptide ABC transporter, ATP- binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37992"
FT                   /db_xref="GOA:C7NCS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV37992.1"
FT                   /translation="MEKLNINALKVSIDNKTILNDISFTLLKGETLIIIGESGSGKTML
FT                   SRLLIGIKPDNASINGNIFFDGKDLLKISEKEWNEYRGKKISYISQNPMAVFNPFQNVE
FT                   SHAVELFQSRLGLSRKECIDKMIEEMKKLNLPNPEALMKKYPFQLSGGMLQRIMFSMMI
FT                   QLEPELLIADEPTSALDYYNTEKVTELLKNLQSQNTSLIVITHDYNLAKELGGKIIIMK
FT                   NGNLIEKGNTFDMLKNPQSDYGKSLILRKRYTRYKKEGI"
FT   gene            65741..66511
FT                   /locus_tag="Lebu_0059"
FT   CDS_pept        65741..66511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0059"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ssa:SSA_0504 peptide ABC transporter, ATP- binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37993"
FT                   /db_xref="GOA:C7NCS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV37993.1"
FT                   /translation="MKKLVIENVSKYYDKKAILSKINLFVSQNECLGIMGESGSGKSTL
FT                   AKLIVGLEPFDEGNIIFNKISYKNINKKQLSLIHRKIQLVFQNAFGAVNPKYTVEEVLT
FT                   EPLKIHYKKEISYEEMKKRAKNFLKKVGLDPEFMSQKSIQLSGGQLQRVCIARALILEP
FT                   EIIIFDESVSGLDPIIQEQILELLGSLKETMNLTYIFVSHDFEACYCLCDKIAIFENGE
FT                   IADIIENLDSPIIVKNERIKRILGKAVDFIETIQ"
FT   gene            complement(66602..67072)
FT                   /locus_tag="Lebu_0060"
FT   CDS_pept        complement(66602..67072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0060"
FT                   /product="Ethanolamine utilisation EutQ family protein"
FT                   /note="PFAM: Ethanolamine utilisation EutQ family protein;
FT                   protein of unknown function DUF861 cupin_3; KEGG:
FT                   ctc:CTC02163 ethanolamine utilization protein
FT                   (transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37994"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS4"
FT                   /inference="protein motif:PFAM:PF06249"
FT                   /protein_id="ACV37994.1"
FT                   /translation="MDLKNLDRETLEKILRKVVQEELKKKVGGFEKHIDKSGVGVVKIP
FT                   TVKPEKFDTGNPNDKVFLTDVFSIEESGRLSCGVMEMEESTFDWELNYDEIDYVIDGTL
FT                   EIIVDGNKVTGNRGDAILIPKGSKIKFSAPNFARFLYVIYPANWEETIKKIV"
FT   gene            complement(67098..68243)
FT                   /pseudo
FT                   /locus_tag="Lebu_0061"
FT   gene            complement(68278..69375)
FT                   /locus_tag="Lebu_0062"
FT   CDS_pept        complement(68278..69375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0062"
FT                   /product="Ethanolamine utilisation protein EutH"
FT                   /note="PFAM: Ethanolamine utilisation protein EutH; KEGG:
FT                   fnu:FN0089 ethanolamine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37995"
FT                   /db_xref="GOA:C7NCS5"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS5"
FT                   /inference="protein motif:PFAM:PF04346"
FT                   /protein_id="ACV37995.1"
FT                   /translation="MGIDKIIIIIMTIFMAIGGIDKIFGNKLGYGEKFEEGIMAMGSLA
FT                   VAMVGIISLAPVLKNLLTPIVGPIYSALGADPAMFATTLLANDMGGAPLALEMAKNPEA
FT                   GRLAAFILGSMMGPTIVFTIPVALGIIEKDDKPFLAKGILAGITTIPLGVLAGGLVSGF
FT                   PIGLILVNLIPIIIVATLIILGLIFMPEKMTKGFEVFGQAVVIIITIGLVAAIIQKLTG
FT                   FVVIPGMKSIDVGLETVGGIAIVLAGAYPLVHFITKVFGKPLEVLGKGLGMNEVGAAGL
FT                   VATLANNIPMFGILKDMDANGKVMNIAFAVSAAFVFGDHLGFTAGFEGGKYTQMIFPMI
FT                   VGKLVAGVTAIVVAKVLFCKKESAK"
FT   gene            complement(69639..70292)
FT                   /locus_tag="Lebu_0063"
FT   CDS_pept        complement(69639..70292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0063"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: fnu:FN0081
FT                   ethanolamine utilization protein EutL"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37996"
FT                   /db_xref="GOA:C7NCS6"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="PDB:3U27"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS6"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV37996.1"
FT                   /translation="MKGDRLKANVLAVRLIPNVDSDMAKELGLPNEHRSIGILTADCDD
FT                   VTYTALDEATKKAVVDVAYGKSFYGGAANANTKLAGEVIGILSGPTPAEVKSGLAAAVD
FT                   FIENEAAFISANDDDSIAYFAHCISRTGTYLSKTAGIPEGESLAYLIAPPLEAMYALDV
FT                   ALKAADVRLVAFYGPPSETNFGGGLLTGSQSACKAACDAFAEAVKFVADNPLNY"
FT   gene            complement(70355..71296)
FT                   /locus_tag="Lebu_0064"
FT   CDS_pept        complement(70355..71296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0064"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   fnu:FN0080 ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37997"
FT                   /db_xref="GOA:C7NCS7"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS7"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ACV37997.1"
FT                   /translation="MLSERELKDVIEKIISEIKIEETPAKETPVTVMEEKTPVVSTSST
FT                   YDQDENPRENPHIVNGEVRDIGKINVKEQMLVDNPEDREEYMKLKQKTSARLGIGRAGT
FT                   RMRTEVLLRLRADHAAAQDAVFNDVPTEFLDELGLFEITTECESRDQYITRPDLGRKIS
FT                   QEGIKIIEEKCKKNPTVQIVVSDGLSSTAIEANAKNIIPAMLNGLKGYGIDTGTPFFIK
FT                   YGRVGAGDHVGEILNAEVVCILIGERPGLTTAESMSAYITYKARPGISEAKRTVVSNIH
FT                   KDGTPSAEAGAHVATLIKKIIDAKASGQDLKL"
FT   gene            complement(71310..72674)
FT                   /locus_tag="Lebu_0065"
FT   CDS_pept        complement(71310..72674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0065"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: ctc:CTC02176 ethanolamine ammonia-lyase heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37998"
FT                   /db_xref="GOA:C7NCS8"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS8"
FT                   /inference="protein motif:PFAM:PF06751"
FT                   /protein_id="ACV37998.1"
FT                   /translation="MVLKTKLFGHTYEFKSVKDVQNKASEFRSGDELAGVSASTAEERV
FT                   AAKAVLAELTLRDLRNNPAVPYEEDEVTRIIQDAVNEKIYGEIKNWTVSELREWILDSH
FT                   TSGDDIKRISKGLTSEMVAAVAKLMSNMDLIQGASKIRIKKFCNTEIGGDGILATRLQP
FT                   NHTTDDPDGIMLSTYEGLSFGQGDALLGLNPVDDSVDSVMRVLHRFHEIKTKWEIPTQI
FT                   CVLAHVTTQMEAVRRGAPTDLIFQSIAGSEKGNEAFGITGDMIQEARELALKHGTATGP
FT                   NVMYFETGQGSELSSDAHHGCDQVTMEARCYGFAKKFDPFIVNTVVGFIGPEYLYNSKQ
FT                   VIRAGLEDHFMGKLTGISMGVDACYTNHMKADQNDIENLKILLTVAGCNYFMAIPAGDD
FT                   IMLNYQTSSYHDDATLRDICNRRPIKPFEQWLEKMGIMKDGKLTDRAGDASIFLK"
FT   gene            complement(72705..74135)
FT                   /locus_tag="Lebu_0066"
FT   CDS_pept        complement(72705..74135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0066"
FT                   /product="Ethanolamine utilisation EutA"
FT                   /note="PFAM: Ethanolamine utilisation EutA; KEGG:
FT                   fnu:FN0078 reactivating factor for ethanolamine ammonia
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37999"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCS9"
FT                   /inference="protein motif:PFAM:PF06277"
FT                   /protein_id="ACV37999.1"
FT                   /translation="MIEEILSVGIDIGTSTTQLIFSKIYIENRGTAFTAPQLKIIGKEV
FT                   VYRSEIYITPLENETKIDAKKVKEIIESEYRKANIQYKDVSTGAVIITGDTARKENAKE
FT                   VLQILSGMAGDFVVATAGPDLESIIAGKGSGAYGYSEQKNTSIVNFDIGGGTTNIVVFN
FT                   RGEVEDTTCLDIGGRLIKFDENGNTRYIFKKMYDIADDVNIKLELGRKINEQDLRKITR
FT                   RMAQLVLESIELLPKTDLYHKIVTYKDFRKHNNNIEHYSFTGGVADFVYGKTEKDLYKY
FT                   NDIGVVLGEELVKVLKELNIEPLKLSETIGATVVGAGSHTTEISGSTITYTEGIFPIKN
FT                   IPVLKLSESDESLPHNELGKVIEGKLNWFNSENEIENVALAFKGKHNMAYTDIMELSSV
FT                   ISDVIKRKHNKTHPVIVIVENDMAKVLGQCMKLALDGYDIICIDSVKVRDGDYIDIGAP
FT                   LGNGNVLPVVIKTLVFSY"
FT   gene            complement(74181..75584)
FT                   /locus_tag="Lebu_0067"
FT   CDS_pept        complement(74181..75584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0067"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation/phosphoacceptor;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   ctc:CTC02178 ethanolamine utilization sensory transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38000"
FT                   /db_xref="GOA:C7NCT0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT0"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACV38000.1"
FT                   /translation="MLRTICKQYTNLSNKDIEKLEKICEGLPVMSKLLKADVFIDCMTE
FT                   NRDTAIVVAEANPRKGSSYTQSVVGKFAYRKNEPAVLRTLETGHPSRDYKALTQENKSV
FT                   TQNVVPIRSDRTNGEVIAVLIVEEGMNEENINKELSFLNNATDDILMSSVGMLRERKII
FT                   DYINDGIIIFNEEGVCIYANSRAKYVYRKIGYKDFFLGEKFDNIVIDNVEFEDVLSGQV
FT                   KEKSDINISNMVLSLEYILVKETKNVKNVVLFIKDITEIKIKEKELVLKSVVIKEIHHR
FT                   VKNNLQTIASLLRIQARKTEDKAVKAAFSDSINRILSISVTHELLAQNGLDELKIKEVI
FT                   NKILKNSVRENLEGHLKLKIDVIGDNFEINSDKATTIALIVNELVENCIKHAFKKRDKG
FT                   HITIKVKRGEMKSHISISDDGIGMDEKDFEKGSIGLRIVKSLVKEKLYGNLDIKTGKKG
FT                   TEISFGFEN"
FT   gene            complement(75577..76155)
FT                   /locus_tag="Lebu_0068"
FT   CDS_pept        complement(75577..76155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0068"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; SMART: response regulator receiver; KEGG:
FT                   amt:Amet_0252 response regulator receiver/ANTAR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38001"
FT                   /db_xref="GOA:C7NCT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV38001.1"
FT                   /translation="MRKIIVVDDEPITRMDICEILREANYDVVAEAGDGFDAIEQSRKY
FT                   KPDFVIMDIKMPILDGLKAAKVITKEKLSRGVVLLTAYSSKDFIEEAKNIGIIGYIVKP
FT                   IDEKSFIPNLEIIFNKQEEFEELEKKYLKTSQKLEDRKKIDIAKSILMKTRDFTEKEAY
FT                   EYIRTLSMNKRCDMGKISDIIILSGDENA"
FT   gene            complement(76177..77295)
FT                   /locus_tag="Lebu_0069"
FT   CDS_pept        complement(76177..77295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0069"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; 3-
FT                   dehydroquinate synthase; KEGG: fnu:FN0092 NADPH-dependent
FT                   butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38002"
FT                   /db_xref="GOA:C7NCT2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT2"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV38002.1"
FT                   /translation="MGLFQIKPDIHYGANSLDILRTLEMEKVFLVTDENMVKLKVINKV
FT                   TNILKSRGIEAKVYSDVKPDPTDEEIIKGMLELSAHDPDCIIALGGGSPIDACKSMIYF
FT                   TNQIKRAMGQNKKPKFIAIPTTSGTGSEVTSYAVVTTKDKKIPLSDSEMLPDIAILNPE
FT                   FIKTLSPSIIADTGMDVLTHAIEAYVSKSRNLFTNTFAIGAIKTVFADLVSNFENPQLE
FT                   KERINLQIASCMAGVAFSNAGLGINHSIAHSLGARFHKPHGRLNAVIMSEVIQFNARNK
FT                   NAAKYYREIVEALGFSPKEDVEGVEILAKAIKMRAAKMGIPNSLSELGIPKEQYFDEME
FT                   GIIDQIENDMCTGENPRRFSRIEMKQLLTDLY"
FT   gene            complement(77316..77612)
FT                   /locus_tag="Lebu_0070"
FT   CDS_pept        complement(77316..77612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38003"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38003.1"
FT                   /translation="MRKRLITVKNLFEYVQENELVIQADMIITPGAKDIIRDKGIGVKY
FT                   EKCCCESESKMKNEIKKDCQNFEKKVIDIITKEFKITDSETVQKILSKLKELL"
FT   gene            complement(77617..77886)
FT                   /locus_tag="Lebu_0071"
FT   CDS_pept        complement(77617..77886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0071"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   dde:Dde_3273 ethanolamine utilization protein EutN"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38004"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT4"
FT                   /inference="protein motif:PFAM:PF03319"
FT                   /protein_id="ACV38004.1"
FT                   /translation="MLIGKVVDNVWATRKDEKLKGLKLMVVEVEGTDEGRGSRKMVAAD
FT                   YIGAGQDDKVIIVTGSSARHIFDAETPVDATIVGIIDSLESEKE"
FT   gene            complement(77888..78532)
FT                   /locus_tag="Lebu_0072"
FT   CDS_pept        complement(77888..78532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38005"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT5"
FT                   /inference="similar to AA sequence:KEGG:FN0086"
FT                   /protein_id="ACV38005.1"
FT                   /translation="MDTQKLIEVLAREVLKEIAKRENQKLSENNEIISKKSVVTAFLGN
FT                   DEVLKDELKKEASFMENIKLDSTWEEIGQCENKKRLVVSTLGINELIELSQGRKSVITE
FT                   FLFNDGEVVLVEEGLEYKKYTKPAALINLYDGYLDKVREFGIKVVKRTEVKNVFCTKEK
FT                   VYLKGLVTERRLRKLKLKNQTLEVDAKSKITSLAMDYIKENSIELCYERRQ"
FT   gene            complement(78552..79187)
FT                   /locus_tag="Lebu_0073"
FT   CDS_pept        complement(78552..79187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0073"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   ssa:SSA_0527 propanediol utilization protein PduL"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38006"
FT                   /db_xref="GOA:C7NCT6"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7NCT6"
FT                   /inference="protein motif:PFAM:PF06130"
FT                   /protein_id="ACV38006.1"
FT                   /translation="MDRNELERIIREKLQEILGAEKDDTFMVEASGRHVHLTKEHVEAL
FT                   FGKGYELTPAKDLSQPGQFAAKERVRVIGPKGEFSNVVVLGPCRSFSQVELSLTDCRQI
FT                   GVKGVIRESGKIEGTPGILLGVGDKYVQLDKGVIVAKRHIHMTNEDAKRLSVKDGETVK
FT                   VKIHSDRPLIFDDVLIRVRDSFRLSMHIDFDEANSCGYTSGMTGSIEK"
FT   gene            complement(79209..79991)
FT                   /locus_tag="Lebu_0074"
FT   CDS_pept        complement(79209..79991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0074"
FT                   /product="cobalamin adenosyltransferase"
FT                   /note="PFAM: cobalamin adenosyltransferase; KEGG:
FT                   ctc:CTC02171 cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38007"
FT                   /db_xref="GOA:C7NCT7"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT7"
FT                   /inference="protein motif:PFAM:PF01923"
FT                   /protein_id="ACV38007.1"
FT                   /translation="MPVITEGMLRKLEKEGHLEKVRITEKDILTPSAREYLNVKKIDYR
FT                   IKKSQEKAIEKKENDEKKSEVSQVKKSEEKISPKRQYRDYFTGAIYDKKPEYMTQLFGD
FT                   NLVVKNHKRIILRGKFDILQAEIIKYWKKYEKNKKLESDFAQTYRFVRDLFISEMTDME
FT                   FQERNVLGYDIDTLKDITHNTVKYFKTGHLFEINIDYDESVIDLNYLRALSRECELAAV
FT                   EAFYKEGKVERLDMLKALNRLSSILYLMMLKANNGDYK"
FT   gene            complement(80009..81487)
FT                   /locus_tag="Lebu_0075"
FT   CDS_pept        complement(80009..81487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0075"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /note="TIGRFAM: acetaldehyde dehydrogenase (acetylating);
FT                   KEGG: cno:NT01CX_0488 acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38008"
FT                   /db_xref="GOA:C7NCT8"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT8"
FT                   /inference="protein motif:TFAM:TIGR02518"
FT                   /protein_id="ACV38008.1"
FT                   /translation="MDKDLQSIQEVRDLLAAASKAFEEYSQFSQSQIDEIVKEICEEAQ
FT                   KHEVELAKLANEETGFGRWEDKVLKNRLASVGVYETIKDLKTRGIINDDKEKRITEIGV
FT                   PMGIIAALIPSTNPTSTTIYKIMISLKAGNAVIVSPHPNAKDSILKTAEYLIRAAERKG
FT                   APKGLIGVIKTPTLQATQELMKHKKTSLILATGGEAMVKAAYSSGTPAIGVGPGNGPSF
FT                   IERSADIRKAVKRIIDSKTFDNGVICASEQSIVTEEVIKHQVADELKRQGAYFLNKDER
FT                   EKVGKILMRANNTMNPKIVGKTALYVAAMAGITVPVTTKVLISEETEVSHFNPYSREKL
FT                   CPVLGFYTEETWEKACEKCIEILQNEGIGHTMSMHTNNENIIREFSLKKPVSRLLVNTP
FT                   AALGGVGATTNLIPAFTLGCGTVGGSATSDNIGPLNLINIRRVAYGTKELEELKNEGVC
FT                   TCACELNTDTSNSKVSENDIESIIRQVLDGIYKK"
FT   gene            complement(81528..81833)
FT                   /locus_tag="Lebu_0076"
FT   CDS_pept        complement(81528..81833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0076"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: fnu:FN0083
FT                   ethanolamine utilization protein EutM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38009"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCT9"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV38009.1"
FT                   /translation="MATLNALGMIETKGLVAAIEAADAMVKAANVTLIGKEHVGGGLVT
FT                   VLVRGDVGAVKAATDAGAAAAERVGELISIHVIPRPHTEIEAILPKAKTVEEAVTE"
FT   gene            complement(81821..82555)
FT                   /locus_tag="Lebu_0077"
FT   CDS_pept        complement(81821..82555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0077"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: cpf:CPF_0894
FT                   ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38010"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU0"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV38010.1"
FT                   /translation="MDSYGYVETLGLVTAIEAADAALKAANVTLMNCYYVKGGIVTIEV
FT                   AGDVSAVTAAVDAATESAKRLGNFLSSNVIARIDSETKKILISDLGNKEKKQKIENKSV
FT                   VKDTTIEKKATEKISTEEITEEIINESKNENFDEEQNKEINEKVTEIAEVYEKVENPAE
FT                   KLDQNNDIQEKIEVFEIEVEKEDDEAEKLKKQYQGMKVIDLKKMVNSCKLGYTWNQIKT
FT                   MPKKKLIEILIKNNKEEAQWQH"
FT   gene            complement(82570..83004)
FT                   /locus_tag="Lebu_0078"
FT   CDS_pept        complement(82570..83004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0078"
FT                   /product="ethanolamine utilization protein, EutP"
FT                   /note="TIGRFAM: ethanolamine utilization protein, EutP;
FT                   KEGG: amt:Amet_0251 ethanolamine utilization protein, EutP"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38011"
FT                   /db_xref="GOA:C7NCU1"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU1"
FT                   /inference="protein motif:TFAM:TIGR02528"
FT                   /protein_id="ACV38011.1"
FT                   /translation="MKKILLIGKSMCGKTTLTQRIHGLDIEYEKTQMLTYSNDILDTPG
FT                   EYMENRMLYKALIVSSYDCDVVGMVQACDEERNIFPPNFATAFSKPVIGIVTKTDLGGN
FT                   PEKAKEILEMAGAEKVFIVSAYENKGIEELVKYLEEDSES"
FT   gene            complement(83007..83357)
FT                   /locus_tag="Lebu_0079"
FT   CDS_pept        complement(83007..83357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0079"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: cdf:CD1908
FT                   putative ethanolamine/propanediol utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38012"
FT                   /db_xref="GOA:C7NCU2"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU2"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV38012.1"
FT                   /translation="MEEEKKQRMIQEYVPGRQLTLAHIIANPQRDLSKKIGLHENKVNA
FT                   IGILTITPGEAAIIAADLATKSAEVEIGFVDRFTGSVVISGDVGSIEAAVNEVVSYFQN
FT                   VLRFSITQITRS"
FT   gene            complement(83384..83659)
FT                   /locus_tag="Lebu_0080"
FT   CDS_pept        complement(83384..83659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0080"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: fnu:FN0083
FT                   ethanolamine utilization protein EutM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38013"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU3"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV38013.1"
FT                   /translation="MATLNALGMIETKGLVAAIEAADAMVKAANVTLIGKEHVGGGLVT
FT                   VLVRGDVGAVKAATDAGAAAAERVGELISIHVIPRPHSEVETILPR"
FT   gene            complement(83727..84002)
FT                   /locus_tag="Lebu_0081"
FT   CDS_pept        complement(83727..84002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0081"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: fnu:FN0083
FT                   ethanolamine utilization protein EutM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38014"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU4"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACV38014.1"
FT                   /translation="MATLNALGMIETKGLVAAIEAADAMVKAANVTLIGKEHVGGGLVT
FT                   VLVRGDVGAVKAATDAGAAAAERVGELVSIHVIPRPHSEVETILPR"
FT   misc_binding    84447..84621
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 90.24"
FT   gene            84637..84813
FT                   /pseudo
FT                   /locus_tag="Lebu_0082"
FT   gene            84831..85097
FT                   /pseudo
FT                   /locus_tag="Lebu_0083"
FT   gene            85231..85485
FT                   /locus_tag="Lebu_0084"
FT   CDS_pept        85231..85485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fma:FMG_1585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38015"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU5"
FT                   /inference="similar to AA sequence:KEGG:FMG_1585"
FT                   /protein_id="ACV38015.1"
FT                   /translation="MSKTTYAFKLDDNLKFDLENVCEELGITLPVFFTMAAKKLVRERK
FT                   LEIDLSEKDDYFYSEENITRLLKAKEQIEKTGGTVHEVL"
FT   gene            85485..85748
FT                   /locus_tag="Lebu_0085"
FT   CDS_pept        85485..85748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0085"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; KEGG: cyt:cce_4261
FT                   putative addiction module toxin, Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38016"
FT                   /db_xref="GOA:C7NCU6"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU6"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ACV38016.1"
FT                   /translation="MVKRWSDEAWEDFLFWQKNDKKVFKKILELIKDIDRNGYTGIGKP
FT                   EGLKHELSGYWSRRINEGNRIVYKIENGEIWFLQCGSHYKKK"
FT   gene            86427..87746
FT                   /locus_tag="Lebu_0086"
FT   CDS_pept        86427..87746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0086"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: smu:SMU.121
FT                   putative DinF, damage-inducible protein; cation efflux pump
FT                   (multidrug resistance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38017"
FT                   /db_xref="GOA:C7NCU7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU7"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV38017.1"
FT                   /translation="MKDLTKGNELKTIIYFSLPILIGNLFQQIYNISDTIIVGNFLGKE
FT                   SLAAVGSSYQINVLIIAVSIGISLGTSILISQYFGAKDMDNLKITANTGFIFSIILSLI
FT                   VTTLGFLLSNNILILINVPQKLLLEANIYLKIIFIGVVPTFGYNSLTNTLKGVGDSKTP
FT                   TYILITAVILNIILDIFFVAVLNSGVAGAAIATVISQFVSFFLCLFYIKFKYPNLIFQK
FT                   HYFNLNFNILKEILIIGMPAMLQQVLISLGFIVIQILVNGFGTDCIAAFISASRIDSFA
FT                   ELPSINLGQALMTFTAQNYGAKKMDRIIKGGKDSLILGISFSIIISIIIFIFPAFFISI
FT                   FNRNPEVIFIGNQYLRIISAFYVIFCTMQILNGLLLGYGKSLVPLIASITSFCMFQVPL
FT                   AILLSKTSLGYNGIWIAAPIGWTGGLLIRVWYFIKISKKI"
FT   gene            87830..88144
FT                   /locus_tag="Lebu_0087"
FT   CDS_pept        87830..88144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0087"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: cac:CAC3399
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38018"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU8"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACV38018.1"
FT                   /translation="MEEKIYTCPLELTQKILSKKWTVIILWLLRHGKVRTKDFKNQIKG
FT                   SNEKMIIKHLNYLIKEKLIEKREYNVYPKKTEYILSEKGKDLLPILELMQSYGKKYYAK
FT                   "
FT   gene            88433..88780
FT                   /locus_tag="Lebu_0088"
FT   CDS_pept        88433..88780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38019"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38019.1"
FT                   /translation="MTLCENKKLKLSNTYSIGIDVNKKVNAIHGGKIFDNFDKERGYTM
FT                   ITCACYFPSGSMAIHFQALGDIFLEFDLKDVFFLNDVKEFYEISELEYKESDEINNQDY
FT                   NEITAIICGKK"
FT   gene            88928..89155
FT                   /locus_tag="Lebu_0089"
FT   CDS_pept        88928..89155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esi:Exig_1265 CopG/DNA-binding domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38020"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38020.1"
FT                   /translation="MPTLSLRMEKEDLEFLKEYASINNLNMSSFVRNLILDKIYDEITE
FT                   EDEKRILKRWKNSKSEKTASAEEVFKRLGL"
FT   gene            89155..89472
FT                   /locus_tag="Lebu_0090"
FT   CDS_pept        89155..89472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0090"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: fnu:FN0211
FT                   plasmid addiction system poison protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38021"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV1"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACV38021.1"
FT                   /translation="MEKRFYEVKFTESAEKDLKKLIKSNKAIAKLIKKWISDNLIDTQN
FT                   PKQRGKALTGNLKGLWRYRIGSYRIVAEIKGKVLLILIIEISDRKETYKNKKTYKDSKL
FT                   K"
FT   gene            89960..90667
FT                   /locus_tag="Lebu_0091"
FT   CDS_pept        89960..90667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0091"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   cbb:CLD_3643 cobalamin biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38022"
FT                   /db_xref="GOA:C7NCV2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV2"
FT                   /inference="protein motif:TFAM:TIGR00123"
FT                   /protein_id="ACV38022.1"
FT                   /translation="MKKRTLLFLVLTSMLLIGVNGYSMHIMEGFLPLNWVIVWFAVCIP
FT                   FWIIGIKKLQSVSKGSVREKMTLALAGAFIFVLSALKIPSVTGSSSHPTGVGLSAILYG
FT                   PFVTSILGTIVLIFQAGLLAHGGFTTLGANAVSMAIAGPIVSYLVYKGFEKKNKALAVF
FT                   LAAALGDLATYVVTSIQLALAYPSPQGGVVASFIKFGAVFAVTQVPLAVIEGLLTNVVM
FT                   NILEKYNVKEVEA"
FT   sig_peptide     89960..90025
FT                   /locus_tag="Lebu_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.588 at
FT                   residue 22"
FT   gene            90667..90969
FT                   /locus_tag="Lebu_0092"
FT   CDS_pept        90667..90969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0092"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   cno:NT01CX_1330 cobalt transport protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38023"
FT                   /db_xref="GOA:C7NCV3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV3"
FT                   /inference="protein motif:PFAM:PF02553"
FT                   /protein_id="ACV38023.1"
FT                   /translation="MSENKNKSVFKKNIILIIAIILIGVIPLFLVKSEFGGSDDKGEEV
FT                   IKTIKPDYEPWAKNLIELPGDETESLLFALQAALGAGIVGYVLGYFKGERKNANR"
FT   sig_peptide     90667..90765
FT                   /locus_tag="Lebu_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.575 at
FT                   residue 33"
FT   gene            90956..91648
FT                   /locus_tag="Lebu_0093"
FT   CDS_pept        90956..91648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0093"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   cno:NT01CX_1331 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38024"
FT                   /db_xref="GOA:C7NCV4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV4"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ACV38024.1"
FT                   /translation="MLIDKVSYTNPIKNINPGVKFILSMTTLVFLLYTGSKIVFVFNFI
FT                   LFNLLLLFVVKVKIGDLLKLNFIPALFILTTVISLLFIKADIWTFLLRSFSSIAVVYFL
FT                   ICSTPIIDLDYIFAKLKFPKIFREMFLLIYRYIFLLFENKEKLHNAQEVRLGYSSFKNG
FT                   MKSFPMLVVAILKKTYYYNLNSIKAVESRMGKEFIFSHRKYKKIGFEIIFVIIIVIINL
FT                   YLVVKYNA"
FT   gene            91641..92447
FT                   /locus_tag="Lebu_0094"
FT   CDS_pept        91641..92447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0094"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: mbu:Mbur_1697 cobalt ABC transporter, ATPase
FT                   subunit; TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38025"
FT                   /db_xref="GOA:C7NCV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV5"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ACV38025.1"
FT                   /translation="MLRLENITFSYDEETEALKDVTLNIEKGKKTLFLGENGSGKSTLF
FT                   LIMNGLLKAQKGNIYFEEKKIEHKKKNLEELRKKVGIIFQDPEIQIFAPLVFQEVAYGP
FT                   ENLGYSKEEVEKNVNRAMKEINITDLKDRPCHHLSYGQKKRVSIAAITAMEPELLILDE
FT                   PTAWLDSKNTKRVSEILDNFSKAGKTMVVSTHDTDFAYEFADYIYVLEKGRIVRQGSRD
FT                   EVFEDFEFLKKLNLNIPNVLKIKSYLKYKNLDENDYYKFLEEKNLL"
FT   gene            92444..93787
FT                   /locus_tag="Lebu_0095"
FT   CDS_pept        92444..93787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0095"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; KEGG: fnu:FN0972
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38026"
FT                   /db_xref="GOA:C7NCV6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV6"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ACV38026.1"
FT                   /translation="MKKLLISGAMSGSGKTTVSSILMSAFENVAPFKVGPDYIDPGYHE
FT                   LFTGNKSRNLDAFMFDDKTLRHIFETGAKGSNIAIVEGVMGLYDGIGHEKDNFSTAHVS
FT                   RILDIPVILVVNAKGISTSIAAEVLGFKLFDENVKVKGIILNNVSSEKLYLNLKEAVER
FT                   FTGIECVGYLPKNEKLSVESRHLGLKQAFELKGSKELEEKKQLFKEIAQNCLDLEKIYE
FT                   IAEEFETKSSMDSFEPIMDLKNKYKGKRVGVAKDGAFSFYYESNLELMRFSGLEIVEFS
FT                   PVKDEKIPENLDMIYFGGGYPELYWKELSENVSMKESIRQAYENGVKIYGECGGFIYLT
FT                   NKLNLLDGNSGNFCGIIDVEISMKNRLNIGRFGYINIKTENGIHTKGHEFHYSEISVDN
FT                   EKEKFYKIEKNDGRNWVCGYRKNSLLAGYPHISFYSNIKFFKYLIEKL"
FT   gene            94046..94690
FT                   /locus_tag="Lebu_0096"
FT   CDS_pept        94046..94690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0096"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   fnu:FN0970 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38027"
FT                   /db_xref="GOA:C7NCV7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV7"
FT                   /inference="protein motif:PFAM:PF02570"
FT                   /protein_id="ACV38027.1"
FT                   /translation="MSYIKDPKGIEVRSFEMITEGLGNKVDHFAENEKPIVKRLVHTTG
FT                   DFGYADITEFHNDAVNSAMEAIKSGCKIYCDTNMIVTGLNKIGLAKFGCSAYCLVNDEE
FT                   VAKEAKERGITRSMVGIERAVKDKDTKIFLIGNAPTALFKLLEEISKEGAEKPKLIAGV
FT                   PVGFVGCPESKAALSDYDVPFIRTNGTKGGSTVAVAVLHGILYQMFERDRY"
FT   gene            94722..95846
FT                   /locus_tag="Lebu_0097"
FT   CDS_pept        94722..95846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0097"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   amt:Amet_0070 cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38028"
FT                   /db_xref="GOA:C7NCV8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV8"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ACV38028.1"
FT                   /translation="MEEYVYFNGRKLRYGYTTGSSATAATKAALMYLLQDGEQDIPEVT
FT                   IGLPSGKSITIKVDSLKKADNYALASVLKDGGDDPDVTHGLQIFSKVSLRDDAKINIFG
FT                   GIGVGKVTKKGLPISPGNSAINPTPLKMIRAAVESVLPTGKGADIEIFVPKGEETAKKT
FT                   LNAKLGIIGGISILGTTGIVKPMSEDAWKASLAIELKMALENAENGEAIFLFGNRGKKY
FT                   LTDNFEDNTSLSVVISNFVGYMFDRACEFEARKIYFIGELGKFVKVAGGIFHTHSRVSD
FT                   AKMEILAANALLVGESMENLKKIMASNTTEEATKYIEKTEVYDLLAKKAKQKCEEYCRR
FT                   NGWDLEVETLIISAERKELGSSKKFFDNFKRKGL"
FT   gene            96239..97477
FT                   /locus_tag="Lebu_0098"
FT   CDS_pept        96239..97477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_0984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38029"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCV9"
FT                   /inference="similar to AA sequence:KEGG:Swol_0984"
FT                   /protein_id="ACV38029.1"
FT                   /translation="MIRIDRKEYLDFLVKSKDRQIIKVVSGVRRCGKSTLFEIYKDFLL
FT                   ENGVAKNQIISINFEDMDYEELTDYKKLYEYIKSKMIKDKRNYIFLDEIQHVDKFEKVV
FT                   DSLFIKENTDLYITGSNAYFMSSELATLLSGRYIELKMLPLSFKEYYQAKLEYEKLEQK
FT                   ENRTSKTLIQYYNEYIVNSSFPYTLQLDSDLKNIHEYLSGIYNSVLLKDIVARLKISDV
FT                   MRLESVVKYVFDNIGNLTSLSKIANTLTSMGRKTDAKTIEKYIRGLTDSLLVHEVSRYN
FT                   IKGKEFLSTLSKYYVADLGLRQMILGNRNIDMGHILENVIYLELLRRKGNVYVGQFDKN
FT                   EIDFVVINSNEIEYYQVALTVLDENTLKRELDTFKNIKDNYPKYLITLDDVMVNTDYDG
FT                   IKVVNALEWLLEV"
FT   gene            97484..97776
FT                   /pseudo
FT                   /locus_tag="Lebu_0099"
FT   gene            97787..98479
FT                   /locus_tag="Lebu_0100"
FT   CDS_pept        97787..98479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0100"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: fnu:FN0959 precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38030"
FT                   /db_xref="GOA:C7NCW0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW0"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ACV38030.1"
FT                   /translation="MASKLGKFYGIGVGVGDPENITVKATKRLHEVDVIVLPEAKSGEG
FT                   STAFNIVKEYVKPEVEQLFLEFPMIKDVEARKVFRKNNADVISAELEKGKNVAFLTIGD
FT                   PMTYSTYTYVLEHISDDVEVETIAGITSFNSIAARLNIPLMIGDEDLKVVSVNRKTDVY
FT                   KEIENNQNLVLMKISRDFEKIKKAIIETGNKENIVIVSNCGKENEEIITDIENVESVHY
FT                   FSTLILKK"
FT   gene            98491..99399
FT                   /locus_tag="Lebu_0101"
FT   CDS_pept        98491..99399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rty:RT0621 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38031"
FT                   /db_xref="GOA:C7NCW1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38031.1"
FT                   /translation="MEKISKSVKKLKPKIIIFIVLQILLFMYYFWIGKYDWDYGFDLPY
FT                   RIVFEGIFSVVVGVFFGLIFYLLGKSEEYENDKILKLPIFFIILSMILLFRIDIMGVIK
FT                   LCFFNGLFILGIFRSKIEIRSYLFKVSKITLWFVVMYFLIPIYIFFFPNAFMIFFAIIE
FT                   SIFGIDKSFSQYITLISFFITNFFFGFFIKKYFDKEEIEVVRILTIAACLIIMGIFIFM
FT                   GFNWYKEDYHAIIYTFPYKVLMYFEEGENSVEKFGIIKTLESRYFVYAMIVNMGFYLGT
FT                   LKINNKNKRKNCVENKIDGDI"
FT   gene            99466..100128
FT                   /locus_tag="Lebu_0102"
FT   CDS_pept        99466..100128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW2"
FT                   /inference="similar to AA sequence:KEGG:FN0958"
FT                   /protein_id="ACV38032.1"
FT                   /translation="MLLGVAIQGLAETIVKGTYDTKKKRYIELSQIFEKEINLSYVLPS
FT                   DKKNIVTYKTENYDILVRKSDLLELYNKNRDKKEKNIKNSISDKDKKLDYVRNYIAELV
FT                   ENNRAVIYERKTKKEIKNIVKVKYNNDIYYDAGRGSNYDGYKFYTDKSLSQEIMKFDII
FT                   TQFGVALHSSLGDNPYNRELTEKEKEYREKNGNHFEELKGLYEKAVQNPNVEQKISY"
FT   gene            100189..101256
FT                   /locus_tag="Lebu_0103"
FT   CDS_pept        100189..101256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0103"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   fma:FMG_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38033"
FT                   /db_xref="GOA:C7NCW3"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW3"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ACV38033.1"
FT                   /translation="MGKIEKGIESNMVYLQIKELMENARKQVSVKINNILVQTYWKIGK
FT                   IIIEDEQKNNERAEYGKKLLKELSKKLTKEYGKGFSKSNLFNMRKFYLKYQKFQTVSGK
FT                   LSWSHYCEILSISDDKERAFYERECENSRWSVRELKRQISTSLYQRLLLSSGEINKKKV
FT                   LELSKVGNVIQKPQDIIKDPYVFEFLGLPEDKSLLESDLEASLVKHIEKFLLELGKGFM
FT                   FVGSQYRITLGNNHYYADMVFYNKVLRSYVLIELKTSKLMPEAVGQMNMYLNYFKAEVN
FT                   DEFDNEPVGIILCTDKENGIQSEYALGGLSNQIFASKYTLYIPNKEVFENEVEKVLREY
FT                   NKKIKLKGIENDNYE"
FT   gene            101240..101581
FT                   /locus_tag="Lebu_0104"
FT   CDS_pept        101240..101581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0104"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: fnu:FN0589
FT                   MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38034"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW4"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACV38034.1"
FT                   /translation="MIIMNKKELPKCSVEITLSLISNKWKILIIRDLLDGTKRFGELRK
FT                   SINGISNKVLTYNLREMEEDNLLIRKIYPEVPPKVEYSLTETGYSLKPILESMDKWGIN
FT                   YREKQNTNN"
FT   gene            complement(101598..102011)
FT                   /locus_tag="Lebu_0105"
FT   CDS_pept        complement(101598..102011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38035"
FT                   /db_xref="GOA:C7NCW5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW5"
FT                   /inference="similar to AA sequence:KEGG:FN0390"
FT                   /protein_id="ACV38035.1"
FT                   /translation="MVDYNKILKENSYGILATLNDNKPKTRILQYLFSEKNNVYLATTN
FT                   NKNVYKQLKKCPYVSFLSHSKDYLSFISVNGNIHFTDDIDLKTRVLNEYPAIKELFKTP
FT                   DNPIFELFYINVEEIRTFDLKTYTNENFKIEKL"
FT   gene            102289..102426
FT                   /locus_tag="Lebu_0106"
FT   CDS_pept        102289..102426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38036"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38036.1"
FT                   /translation="MEIKKVYDDKDWYEEYIQVLKDGKEIHYGESFDLPKYENGNYVEI
FT                   "
FT   gene            102531..102935
FT                   /locus_tag="Lebu_0107"
FT   CDS_pept        102531..102935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38037"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38037.1"
FT                   /translation="MEFLENDIKEILENKEEINKIKKLTIKDILCEWVCNSQFREFCNS
FT                   FEDYQKKLVNEIYFVDNEIINNDISGKFEKIFEIKNKKIEKINVEEVEKLDKISVYLEN
FT                   GKVWEAFFKKDKKIYLNTEISVSFEINEIL"
FT   gene            102962..103723
FT                   /locus_tag="Lebu_0108"
FT   CDS_pept        102962..103723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0108"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: fnu:FN0957 precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38038"
FT                   /db_xref="GOA:C7NCW8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW8"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ACV38038.1"
FT                   /translation="MKKVYFIGAGPGDPELITVKGQRIVKEADVIIYAGSLVPKEVIDC
FT                   HKDGAEIYNSASMNLDEVMEVTIKAHKKGKLVARVHTGDPSIYGAIREQMDILDEYGIE
FT                   YEVIPGVSSFVAAAAAIKKEFTLPDVSQTIICTRLEGRTSVPEAESLESLASHKCSMAI
FT                   FLSVQMIDEVVKRLLKHYDKTTPIAIVQRATWEDQKIVMGTLETIAELVKKEKITKTAQ
FT                   ILVGNFMGNEYSKSKLYDKAFSHEFRKGIEE"
FT   gene            103723..103995
FT                   /locus_tag="Lebu_0109"
FT   CDS_pept        103723..103995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38039"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38039.1"
FT                   /translation="MKKLITIILFIFSMQIFAEQYQVIKQKNVTLSKEQIEVENKKIEK
FT                   MLYNYDNEKPKKILESKLPQLKNKFNKNAPMELSEFFPKIQKFKN"
FT   sig_peptide     103723..103779
FT                   /locus_tag="Lebu_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 19"
FT   gene            104044..105072
FT                   /locus_tag="Lebu_0110"
FT   CDS_pept        104044..105072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38040"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38040.1"
FT                   /translation="MKIIKLENQKNDSFFEAECFLHIGEAEEDKNYVAFDLRREDDPLY
FT                   SCSYYDFEKEKGDKIFHCFDGQDYSWKCYENEVTNDEKLKNEILGNYDILRNSTIRYLK
FT                   EIIHKNKVVFSKKLIELLEKIKAGEKINKKEFRVELKKVGLYKSIWKEKTEIFDDVVKR
FT                   EIGFEKIIKFIEKNNVNRIVFDNNEFLENEEIGKFIKEYTIVEFRDFKPIKDFDMIKMT
FT                   LEEWNNLKKWKKLEVENNIIEIEEKDFEKDVPIYRLNGRKINAKIEITDFVEIKNNFLC
FT                   YFNKWFSKGKNDNLIEKAVIKGVIRDGRKFYNWIFFDRNNKIVTREEYDEFGKRCDLKN
FT                   KS"
FT   gene            complement(105144..105602)
FT                   /locus_tag="Lebu_0111"
FT   CDS_pept        complement(105144..105602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0111"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: lsa:LSA0263 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38041"
FT                   /db_xref="GOA:C7NCX1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX1"
FT                   /inference="similar to AA sequence:KEGG:LSA0263"
FT                   /protein_id="ACV38041.1"
FT                   /translation="MPRNKKEGIIFGVTMCFLMVCGMSAYNLALVGKLSFAKFAIGLIP
FT                   GFIVAFFFDTVIVGPVAKKIAFKFPIDKNIKLQIILAISLLMVIGMVTFMSIFGLLMRP
FT                   EIPQNIVSAYFIGWGMNFIAALPLQLLIVGPISRLKLQMLQRYFDSKI"
FT   sig_peptide     complement(105513..105602)
FT                   /locus_tag="Lebu_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.600 at
FT                   residue 30"
FT   gene            105758..106444
FT                   /locus_tag="Lebu_0112"
FT   CDS_pept        105758..106444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38042"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38042.1"
FT                   /translation="MKKVLFALMLVIMGNTFTATVSRNLKTAARVSENERKEMENAIQK
FT                   EIQPFVHFVMNAGISEARKQLSEEAFDKLFGKDYVISNSLKNEITEKYIDEIVKFTLKG
FT                   VEPRVVIKKIDYVSQNEVQVNYDIKIKNLEKFWDILELDDGTERKIIKKMGIKNEDEIE
FT                   RVMKNKGNDELKRKYYYIFLEEMVNFINEKAKGFKEEETLLEDMSVTVKKVNNKWKIEN
FT                   LENNFN"
FT   sig_peptide     105758..105814
FT                   /locus_tag="Lebu_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.984 at
FT                   residue 19"
FT   gene            106500..107165
FT                   /locus_tag="Lebu_0113"
FT   CDS_pept        106500..107165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38043"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38043.1"
FT                   /translation="MKKILFLIMLVVLGNSFAAPSKNSKIGSVSNEITANEKKEVERVL
FT                   QKELQSIMNEIVGAELSEIAKIIGNQIFDKESNISASAKNRIIQKFSKEYISMALNNID
FT                   TKIDIKQFKNLPNNKVQVFYDIKIKDISKISLESKKEMEEKVLKNLGYKSQDEIKKILM
FT                   SSSNDAKKEKIYESILQESLKIVGEKMKNIKAEAFLVKDAATTFVKRNGVWKIEGLNN"
FT   sig_peptide     106500..106556
FT                   /locus_tag="Lebu_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            107370..107444
FT                   /locus_tag="Lebu_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            107370..107444
FT                   /locus_tag="Lebu_R0001"
FT                   /product="tRNA-Gln"
FT   gene            107672..108685
FT                   /locus_tag="Lebu_0114"
FT   CDS_pept        107672..108685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0114"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: cac:CAC0709 glyceraldehyde 3-phosphate
FT                   dehydrogenase, gene GapC; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38044"
FT                   /db_xref="GOA:C7NCX4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX4"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACV38044.1"
FT                   /translation="MAVKVAINGFGRIGRLALRLMAEQTDKFEVVAINDLTDAKMLAHL
FT                   FKYDSSQGRFNGTIEVKEGAFVVNGNEIKVFAEADPEKLPWGDLGVDVVLEATGFFATK
FT                   EKAEKHVKAGAKKVVITAPGGNDVKTVVYNVNHEILDGSETVISGASCTTNCLAPMAKA
FT                   LNDKFGIVTGTMTTIHAYTGDQNTLDAPHRKGDLRRARAAAVNIVPNSTGAAKAIGLVV
FT                   PELNGKLDGAAQRVPVPTGSLTELVSILNKKVTVDEVNAAMKEAANESFGYTEEPLVSS
FT                   DIVGIHFGSLFDATQTKIVQNGDAQLVKTVSWYDNEMSYTSQLIRTLGYFASKIAK"
FT   gene            108934..109701
FT                   /locus_tag="Lebu_0115"
FT   CDS_pept        108934..109701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0115"
FT                   /product="anaerobic cobalt chelatase"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG: tde:TDE2656
FT                   cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38045"
FT                   /db_xref="GOA:C7NCX5"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX5"
FT                   /inference="protein motif:PFAM:PF06180"
FT                   /protein_id="ACV38045.1"
FT                   /translation="MEKGIVVASYGTVHTETLKKTIEVIENNVKKKYGEKNFERAFTSK
FT                   RVCHKLKTEKNYLVFNYEEALNALKNKGFNNIVTLSLHILDGVEYKKLNNKYGKISEPL
FT                   LFVEEDYEKIVENEEFNDTKGNDAIIFVGHGSEDISDKSYEKLQKKYEKAGKNNIFIGT
FT                   IEGKIQISDILEKLQNTDYKKILIKPFLIVAGKHAKKDIMSDTENSWKTILEKNGYTVE
FT                   TELVGMGEYQFIQEMFMKKLEKILYINKGEIYG"
FT   gene            109694..110368
FT                   /locus_tag="Lebu_0116"
FT   CDS_pept        109694..110368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0116"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   fnu:FN1305 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38046"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:3RNS"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX6"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACV38046.1"
FT                   /translation="MVKIEVAKPINFNRLITSKEAEVVSMRILNQPNSYISLFSLAKDE
FT                   EITAEAMLGNRYYYCFNGNGEIFIENNKKTISNGDFLEITANHNYSIEARDNLKLIEIG
FT                   EKIGDGNMENKTLKMLESASAFNLAEVVEYQEGKIVSKNLVAKPNLVMTIMSFWKGESL
FT                   DPHKAPGDALVTVLDGEGKYYVDGKPFIVKKGESAVLPANIPHAVEAETENFKMLLILV
FT                   KE"
FT   gene            110929..111348
FT                   /locus_tag="Lebu_0117"
FT   CDS_pept        110929..111348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0117"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: fma:FMG_0285 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38047"
FT                   /db_xref="GOA:C7NCX7"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV38047.1"
FT                   /translation="MENKKNMKKFYDTIAEKYDFIFSLSDVQKNFFQKYITGKKVLDVG
FT                   AATGNLSKFLKNEGYDVISIDINEKLIEQAREKNVDVKNLDMMRIDELRKFDTIINVGN
FT                   TLPHLNSKDEIFLFLKKAYSQLENNGKLIIQLGRV"
FT   gene            111553..111804
FT                   /locus_tag="Lebu_0118"
FT   CDS_pept        111553..111804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0118"
FT                   /product="putative methyltransferase"
FT                   /note="KEGG: fma:FMG_0285 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38048"
FT                   /db_xref="GOA:C7NCX8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX8"
FT                   /inference="similar to AA sequence:KEGG:FMG_0285"
FT                   /protein_id="ACV38048.1"
FT                   /translation="MIENENVKFERYYYKNSDNNVIFKTILDDKFENDEILTNVNYFDF
FT                   MKFFEQLGISNVKVFGGFNESEFILEKSQPLIFVITKK"
FT   gene            111973..112488
FT                   /locus_tag="Lebu_0119"
FT   CDS_pept        111973..112488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0119"
FT                   /product="putative small multi-drug export"
FT                   /note="PFAM: putative small multi-drug export; KEGG:
FT                   cbf:CLI_1102 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38049"
FT                   /db_xref="GOA:C7NCX9"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCX9"
FT                   /inference="protein motif:PFAM:PF06695"
FT                   /protein_id="ACV38049.1"
FT                   /translation="MMESFKNFIKVTLIGAPLLNKMIGIFLISMLPIIELRGAIPIGAA
FT                   IGLPWYLNMIVSIIGNMLPVPFILLFSVKAFEFMKKHNIMVKFIEKIENRAKKRSEGLA
FT                   TGEFIGLMLFVAIPFPGTGAWTGALIAALLQFNRKRSFFYIGLGVVIASVIMTLASYGV
FT                   ISLFVPKH"
FT   gene            112563..112900
FT                   /gene="ssrA"
FT                   /locus_tag="Lebu_R0002"
FT   tmRNA           112563..112900
FT                   /gene="ssrA"
FT                   /locus_tag="Lebu_R0002"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 187.97"
FT   gene            113102..115024
FT                   /locus_tag="Lebu_0120"
FT   CDS_pept        113102..115024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0120"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: fnu:FN1723 tRNA
FT                   uridine 5- carboxymethylaminomethyl modification enzyme
FT                   GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38050"
FT                   /db_xref="GOA:C7NCY0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY0"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACV38050.1"
FT                   /translation="MRNYDVIVVGAGHAGIEAALASARLGLKTAVFTITLDNIGVMSCN
FT                   PSVGGPAKSHLAKEVDALGGEIGRNMDKSFVQMRILNTKKGPAVRSLRAQADRKIYARE
FT                   MKKTIENQQNLDTVQDIVTELIVEEIEILEGNSKRIEKVIKGIRTKTGMEFFAKAVVLA
FT                   TGTFLRGLLYIGDKRVKGGRMGELSADDLTDSLKSLGFKMDRFKTGTPPRLDIRTLNLE
FT                   KLEEQPGITDIPLKFSMRTPNDEVLEKPQLSCYLTRTNETTHKIILDNLDKAPMYNGSI
FT                   SSTGPRYCPSIEDKVVKFNDKDSHHLFLEPEGFDTAEVYISGLSTSYPASLQQKIVNTI
FT                   EGLENAHIMRYGYAVEYDIVDPSELDYTLETRKVKGLYLSGQLNGTSGYEEAAAQGIIA
FT                   GINAALKIKGQEPFILDRESSYIGTMIDDLINKELFEPYRMFTARSEFRLILREDNADI
FT                   RLSEKAYKIGLLDKKYYDIVQEKKKNVKKTIENLENIKLGSSNQRLMEILDKYNESLKS
FT                   GTTLKEILRRPKVTYQDIKYIAEIIENVPNLNFDDETEYQIEVQTKYEGYIAKAIQIME
FT                   KQQKLDDKKIPKNFDYDSMKGITREAKQRLKENRPYNVGQASRMSGVTPADISVLLMYL
FT                   DGVLK"
FT   gene            115090..115812
FT                   /locus_tag="Lebu_0121"
FT   CDS_pept        115090..115812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0121"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: fnu:FN1722 glucose
FT                   inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38051"
FT                   /db_xref="GOA:C7NCY1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY1"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACV38051.1"
FT                   /translation="MENINEEANLREYFLNLLSKSEIKMPNEKITQMLKFLELLYNKNQ
FT                   IMNLTAIRDKKGMLEKHFIDSLLLTKVINDDEKSFIDVGTGAGFPGLVLAIYYPEKKYL
FT                   LVDSVRKKIEFINEVIKELNLQNVTTSFERSEELIKDKRESFDVALCRGVANLRIILEY
FT                   MIPFIKVNGRFLPQKLNLNEVEESKNALKILNSKINKTFEFKLPESKDTRIILEIIKLQ
FT                   KTNVKYPRKVGIPVKKPL"
FT   gene            116037..117541
FT                   /locus_tag="Lebu_R0003"
FT   rRNA            116037..117541
FT                   /locus_tag="Lebu_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            117883..120462
FT                   /locus_tag="Lebu_R0004"
FT   rRNA            117883..120462
FT                   /locus_tag="Lebu_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            120620..120732
FT                   /locus_tag="Lebu_R0005"
FT   rRNA            120620..120732
FT                   /locus_tag="Lebu_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 57.58"
FT   gene            120748..120824
FT                   /locus_tag="Lebu_R0006"
FT                   /note="tRNA-Asn1"
FT   tRNA            120748..120824
FT                   /locus_tag="Lebu_R0006"
FT                   /product="tRNA-Asn"
FT   gene            121095..122789
FT                   /locus_tag="Lebu_0122"
FT   CDS_pept        121095..122789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0122"
FT                   /product="oligoendopeptidase, M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F; KEGG:
FT                   bce:BC1338 oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38052"
FT                   /db_xref="GOA:C7NCY2"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011976"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY2"
FT                   /inference="protein motif:TFAM:TIGR02289"
FT                   /protein_id="ACV38052.1"
FT                   /translation="MKFNEYEYEHLDLEKIKENFSELIESFGKAENVEVQIEAFDKIIK
FT                   LRNHIETMQTLVSIRHSIDTNDEFYDKENEYMDEISPILFGFTNDFYKALVNSKFKDEL
FT                   IKKYGKLLFDLAENTLKVFSNEIIPDAQEENRLSSKYSKLIASAKIDFDGKELNLSQMV
FT                   PYTQSKDRNVRIEAAKKVAHFFAENQEKFDNIYDSLVKVRTKMAQKMGYKNYVEFGYKQ
FT                   LSRLEYDAKMVEGYRKQVLENIVPLHTELRKRQEKRLGVEKLRFYDEAIKFNSGNADPH
FT                   GSPEWILSHGKMMYKELSKETDEFFTFMTENNLLDLLSKKGKMSGGYCTYIPEHKAPFI
FT                   FANFNGTAHDIDVLTHEAGHAFQVYQSRGFDVPEYLWPTYEACEIHSMSMEFLTWPWMD
FT                   LFFENDTEKYKFIHLSEALLFIPYGVTVDEFQHWVYENPDVTPQQRREKWLEIEKKYLP
FT                   TRDYGEIEELKNGIFWFRQGHIFSSPFYYIDYTLAQVCAFQFWIKSREDKEKAWQDYLN
FT                   LCKLGGSKSFFGLMKSANLKNPFEEGTIAAVIPKIKEYLDSVDDMNL"
FT   gene            123114..124967
FT                   /locus_tag="Lebu_0123"
FT   CDS_pept        123114..124967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38053"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38053.1"
FT                   /translation="MNHSTLILKVKNIINSNDTTAYINKLGTILRNKKIDEKDMSISES
FT                   QVKAWKDCFKFLKENLTGINKNIDLLFEYSLPGTIHERPDVIILTEKKLIILEFKRKKR
FT                   PENEDISQVLRYKEWIKNFHSTTKERNLKIKEYIVCTFPYSNPYQERGVNILTSENFND
FT                   TLKKELEREKETTPSIINKWIHSSMTIMPDMLKAIELLYKENKLPYISDVNKQCLNTVK
FT                   EYMREVYQNSKIKKKNTKLVIVVDGVPGAGKTALGFNIIHTANKKGKLNAVYITGNGPL
FT                   VDVLSYQLNNIIENRAAAPNIIRSMKNFKSKHNNNNDDKNVKILVFDEAQRAWNKHENN
FT                   ESEPKILLEAGNQIANKYGYAIILVLFGNKQYIYKGEEGGLSLWLKAIEESEDWNILLS
FT                   DNLNKQIDKNEFTKKERRRVDKRLYLSTSIRGNSNDCSKWVNKIISDESIEDIKKEFEK
FT                   INNTSFTIYLTRSQEKVKSYCEKLDENKSFGIFVSNFSSEKNIIFNNRDNTAYGKWFLG
FT                   ESKNLSTYCSVFGCQGLELDYPIIKFSDDYTRKNGKWIYGGKKYENAINSKIYQNPEDI
FT                   VENNYRVLLTRGRYGMILFIPENKIFDETYEYFKSMGIKEL"
FT   gene            125234..126151
FT                   /locus_tag="Lebu_0124"
FT   CDS_pept        125234..126151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0124"
FT                   /product="cysteine synthase"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: cbe:Cbei_0577 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38054"
FT                   /db_xref="GOA:C7NCY4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY4"
FT                   /inference="protein motif:TFAM:TIGR01136"
FT                   /protein_id="ACV38054.1"
FT                   /translation="MIYENILDLIGNTPVVKLNFLNEENVADIYVKLEKYNIGGSVKDR
FT                   AALGMIEAAEKEGKLQPGGTIVEPTSGNTGIALALIGKAKGYRVVIVMPDSMSVERRSI
FT                   LAAYGAELILTEGAKGMKGAIAEAEKLAAENGYFLPQQFENSANPAKHYETTAKEILDD
FT                   FPQIDAFISGVGTAGTLSGVGKRLKEERPGVQVFAVEPATSAVLSGEQPGKHFQQGLGA
FT                   GFIPGNYDPKLVDEIIKITNEEAIEFATRASKENGLFIGISSGTAIAAAYKVAKKLGKG
FT                   KKVLAILPDGGEKYLSVEAFRNSL"
FT   gene            126293..126841
FT                   /locus_tag="Lebu_0125"
FT   CDS_pept        126293..126841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0125"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   ctc:CTC00351 serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38055"
FT                   /db_xref="GOA:C7NCY5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY5"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACV38055.1"
FT                   /translation="MILIFKWLRSEINNIAEKDPAVRYKVEVFLYPSLHAIINHKIAHF
FT                   FQKRKFFLLARLISQISRFFTGIEIHPGARLGNRIFFDHGMGIVVGETAEIGDNCVIYH
FT                   GVTLGGVSTSKTKRHPTLKENVTVGTGAKLLGNIVVGKNVKVGANSVVLRDVPDNAVAV
FT                   GIPARIIPKTEEDYYMWHI"
FT   gene            127057..127551
FT                   /locus_tag="Lebu_0126"
FT   CDS_pept        127057..127551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0126"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: syf:Synpcc7942_1541 flavodoxin FldA"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38056"
FT                   /db_xref="GOA:C7NCY6"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY6"
FT                   /inference="protein motif:TFAM:TIGR01752"
FT                   /protein_id="ACV38056.1"
FT                   /translation="MAKVGIFYGSTTGVTEDIAHKIAEKIDGAEIFNIDGNEDKLEDFD
FT                   VLLLGTSTWGFGDLQDDWAAVVDDLASKDLSGKKVGYFGSGDQGTFSDTFMDGIAIIDE
FT                   EIQKTGATIIGKTSTEGYEFNESRAVKNNEFLGLALDEVNQSELTDERIDVWVEQIKKE
FT                   F"
FT   gene            complement(127790..128494)
FT                   /locus_tag="Lebu_0127"
FT   CDS_pept        complement(127790..128494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0127"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: fnu:FN1921 biotin
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38057"
FT                   /db_xref="GOA:C7NCY7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY7"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACV38057.1"
FT                   /translation="MKFKFFDEINSTNEYLRRHLRIEEFEVIVAKKQTDGKGRRERVWI
FT                   SNEGAALFSFAVSDNTELDEKITVFAGYIVYNVLKEYVESKEKLTFKWPNDIYYEDKKI
FT                   CGILCEKVRDYIIVGIGININNTDFGMFRDKAISLVEITGKTHSIQEIIEKTVSNFEEQ
FT                   FYSLNRNWENILNVVNENSYLKDRKIIIKQNGKFLEKEYKFLRIDRRGNLSLIGKGDED
FT                   EIKFTSLEFKVI"
FT   gene            complement(128542..131046)
FT                   /locus_tag="Lebu_0128"
FT   CDS_pept        complement(128542..131046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0128"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: Dak phosphatase;
FT                   DegV family protein; KEGG: fnu:FN1927 DegV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38058"
FT                   /db_xref="GOA:C7NCY8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY8"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ACV38058.1"
FT                   /translation="MAIKYLDAKRLKLVFIGGGKWVTKHEELLNELNVYPVPDGDTGSN
FT                   MSMTLNSMINDLEEKTNDKIKMPELIEVVEEAVLMGARGNSGTILSQVITGFLKGIGEK
FT                   AKLLPIDVAKALVSAKETAYSAVSEPIEGTMLTVIRKISEKAMECASKFEDLVEFLKEI
FT                   VEAGEKAVEETPEMLPKLKEAGVVDAGGKGLFFFFEGFYKVTTELNLLAKLQKAQVKEN
FT                   EFDKTIANIDHDPESIRFQYCTEYIILNGDFDTEEYKKRVLELGDSAVFAQTSKKFKTH
FT                   IHTNHPGKAMEIALEYGPLEKMKVENMKLQHDNLQIFSEKDEAKIFVNPKIDKTKAAFI
FT                   ILADSENLKDEFLKLGADVAILGGQSKNPSVLEILNAIDKTKKETVYILPNNKNVITTA
FT                   KMAAEKAKKTVIVLSTKTMLDGYYFLKNKENDIDEVKESASRNYSVEITKAVRDTKVEN
FT                   LTIQKDDFIGLVNGKIKFAKKSLKEITDEILRNLINKNTITAIVVSGNEKDEAAQKNIE
FT                   QKLSEIKTTFINGNQENYHYYLYIENKDPNMPEIAILTDSVSDLTNEDIEGLPIKIVPL
FT                   KIDINGELYKDGVEITKAEFWHQMLDNNAKIKTSQPSPQEFLNAYNKLFEKGYKKIISI
FT                   HPSSKLSGTIQAAKVGRSLTNRENDIELVDSLGASLLQGFLALGAAGKSIRGESFTEIL
FT                   NWINNFRNKGKLLMIIPDLKYLEKGGRIGKASSTIAGALNMKPILTVNQGEVTVEKKVL
FT                   GERNAQKYIEKYIERESKKQSIVLMSGWGGTPTELENVVRIYSEVENNPKISSLILNRE
FT                   IGAVIGAHAGPVYGIFIFPRLS"
FT   gene            complement(131117..131611)
FT                   /locus_tag="Lebu_0129"
FT   CDS_pept        complement(131117..131611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0129"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: fnu:FN0213
FT                   N-acylneuraminate-9-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38059"
FT                   /db_xref="GOA:C7NCY9"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCY9"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACV38059.1"
FT                   /translation="MIKLILLDVDGTLTDGGIYLGNSGEELKKFNVKDGYAIVNSQKVG
FT                   IEFGIITGAESELLKNRAKKLKIKYLYQGISEKTLVLKEIMKNLNLKKEEIAYMGDDLN
FT                   DIKIMKMAGFCGTPLDGANELKEFADFISTKNGGDGAVREFIETILKKENLFQKFLENV
FT                   E"
FT   gene            131814..133037
FT                   /locus_tag="Lebu_0130"
FT   CDS_pept        131814..133037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0130"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: dps:DP0755 serine protease DegQ [precursor];
FT                   PFAM: peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF
FT                   domain protein; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38060"
FT                   /db_xref="GOA:C7NCZ0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ0"
FT                   /inference="protein motif:PRIAM:1.3.1.74"
FT                   /protein_id="ACV38060.1"
FT                   /translation="MKKINFMKKGNKKFALFSILFLILSCSNKNDTKSNSTENMANVEQ
FT                   TKSISQEELQKYTKNAVQTQDAFVSVHNSVKDSIVNIRTKKTVTVNTYNPLEEMLFGRS
FT                   GGQEKRESGSLGSGFVVSKDGYIVTNNHVIDGADEIYVKFSNGREYRTKLVGTSPEVDI
FT                   AVLKIDSNETFKPLEFANSDQVQIGQWSIAFGNPLGLNDSMTVGIVSAAGRSSLGIEQI
FT                   ENFIQTDAAINQGNSGGPLIDITGKVIGVNTAIYSQSGGSVGIGFAIPANLAMTVKDSI
FT                   IATGKFERPYIGVYLGTLDSDKVKALNLKSSNGVFVADVVPNGPAAAAGITKNDVIIAV
FT                   DGKEVNSSGAFVGEIAAKKVGQNVKLTVIRNGKTIQVGVNLVKTPNALQQQQIIQQRQQ
FT                   QQQQEFGR"
FT   sig_peptide     131814..131903
FT                   /locus_tag="Lebu_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.589 at
FT                   residue 30"
FT   gene            133083..133379
FT                   /locus_tag="Lebu_0131"
FT   CDS_pept        133083..133379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0131"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: cbe:Cbei_3842
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38061"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ1"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACV38061.1"
FT                   /translation="MKKIFVVSTTYTKSLEEVGKFRNDHFEFIQKYIDAGKFIAGGRQN
FT                   PPTGGLILAYNVTKEELEEILKEDPYYKNDLIETVITEFTPALLNKSFEKFSN"
FT   gene            133681..136161
FT                   /locus_tag="Lebu_0132"
FT   CDS_pept        133681..136161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0132"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   phospholipid/glycerol acyltransferase; phosphopantetheine-
FT                   binding; SMART: phospholipid/glycerol acyltransferase;
FT                   KEGG: aae:aq_999 long-chain-fatty-acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38062"
FT                   /db_xref="GOA:C7NCZ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACV38062.1"
FT                   /translation="MFLERTERLALVDFDNKHINYIDLINNIKYFSEYVVELEKEKFGL
FT                   IVMENRPEWIYSFFAVWDKKSAGIALDANSNSGEILYVLEDSHPNVIFCSNETEKTVFE
FT                   AVEKYSSKNTVKIINVDKITVEHEKMNAIKNMEFELENPTGDETAAMLYTSGTTGSPKG
FT                   VMLSFNNLNTEMEGLYEKGIFDYRDQILAILPFHHVLPLTATVLLMLKYQTSIVFVEKI
FT                   ASKEIFDALEKNRVTAIIGVPRVFKLFYDGIKQQIDAKFITRFIYKMMSNVKSLKIKRK
FT                   VFAKVHKKFGGHLDFIVVGGAKMDPEISRFYETLGFYALEGYGLTETAPVIAVNSKKER
FT                   KIGTVGKRLYNVEIKTVDEELWVKGPIVMKGYYNKPEKTTEVITEDGWFKTGDLAAIDE
FT                   EGYVTIRGRKNTMIVLSNGKNIDPETLENRVIAQSNGLIKEIGIFNYKNKLAAIIVPDL
FT                   LEFRKRGITNTKAYIKNVVEDYNLKAHNYEKVLDYKLFEEELPKTRVGKTRRFMLPDLY
FT                   EKNEIVKKEKTPEPTDEAYKILKEYVKKNKGIEPQPEENLELEIGMDSLDIVEFFAFIE
FT                   NSFGIQLDEEKFAGMPNLKLLSEYINQKATKFEDNDIDWKQIISETKPIEDNKNRWVTK
FT                   FLKIFQPIVDLYFRVKKIDRKKLTDNPQIFVSNHQSFVDPLILGSLFPNKIVFNTLFLA
FT                   IDWYFKKGVMKLLVSNGNVVLIDINKNIRKSVEEIVGYLKGGKSIVIFPEGARTKDGKV
FT                   AQFKKVFAIIAKELNVDVQCLGIKGAFEAYSRYMKFPKSKKIEVAVLEKFSPEGSYDEI
FT                   TQKAEKIIREYVEN"
FT   gene            136427..136678
FT                   /locus_tag="Lebu_0133"
FT   CDS_pept        136427..136678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38063.1"
FT                   /translation="MKKLVVTMFLVFGVLGFSRFIEECRITSKGRGYLNCVSLQSGKNF
FT                   NFTRGYISGPAYGSVYRIYFQGNGYRRLYLEGYEYLYN"
FT   gene            complement(136798..138282)
FT                   /locus_tag="Lebu_0134"
FT   CDS_pept        complement(136798..138282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0134"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: chy:CHY_2365 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38064"
FT                   /db_xref="GOA:C7NCZ4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ4"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACV38064.1"
FT                   /translation="MSNQNHNDNGIIKEKLKKVEELKEIGVEPYGRKYAKLNEIAEINQ
FT                   YDETCEKIFKTAGRIVAFRRMGKNGFGQIQDPTGKIQYYVKKDEVGEEQYKIYKKMGLG
FT                   DFIGLEGKLFRTNTGELTLRVDSFEVLSKNVRPLPEKFHGLTNIETRYRQRYVDLVMNR
FT                   EVMETMKKRFQIIRFFRSYLEKHGFTEVETPMMHPVAGGATARPFVTHHNALDMELFLR
FT                   IAPELYLKRLLVGGFEKVFEINRSFRNEGISIKHNPEFTMMELYQAYADFNDMMDLTED
FT                   LISSLTFELHGKYEIEYEDKTINMAKPWRRVTMKDIVKETTGFDFDTISSDEDAINKAK
FT                   EMNIPLEKDKTYTKYGILNLIFEEKVEETLLNPTFITEYPKEISPLSKNQKGETEWVDR
FT                   FELFISGREFANAYSELNDPRDQKERFEEQVKLREAGDDEAQGMDLDYIRALEYGMPPA
FT                   GGLGIGIDRLVMLQTNSASIRDVILFPTLRKEDIEL"
FT   gene            complement(138614..138985)
FT                   /locus_tag="Lebu_0135"
FT   CDS_pept        complement(138614..138985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38065"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38065.1"
FT                   /translation="MKIKIKSLDNFKQNYEKLFELEKIINLEEKKEYHYKDEYGNCKII
FT                   DKIDSIEIYRHGEINSKQIFKNNKNTSFTYITTKFRGKYEIFTKKFEKENGKIVLEYDI
FT                   IHSNEIINSINLEIQLINI"
FT   gene            complement(139011..139430)
FT                   /locus_tag="Lebu_0136"
FT   CDS_pept        complement(139011..139430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP2154A flagella accessory protein FlaCE"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38066"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38066.1"
FT                   /translation="MYSAGEEFERINNEGDVEGYTCLSNVTVGDKEYLVCDSETGEKKV
FT                   FYYDSIEEELYDLDEDEEDQVLEIWNDEYYGSDKDYMYWNEDFGEYDKNENVDGEYDES
FT                   NFDALNDGTDFFDNEDEDDEDLSEFLDDFFNDEDE"
FT   gene            complement(139443..139913)
FT                   /locus_tag="Lebu_0137"
FT   CDS_pept        complement(139443..139913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0137"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   fnu:FN0463 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38067"
FT                   /db_xref="GOA:C7NCZ7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ7"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACV38067.1"
FT                   /translation="MIRISVVCIGKIKDKYIKEGIAEFSKRLSKYIKLDITELAEEDDN
FT                   KGIENAVNSETERIINAISKKNYSYNILLDLNGKMLSSEEMADKIEKISMTNSEINFII
FT                   GGSNGVNDKLRKIVDFRLCFSPMTFPHQLMRLILTEQIYRWISINNNIKYHK"
FT   gene            complement(139975..142050)
FT                   /locus_tag="Lebu_0138"
FT   CDS_pept        complement(139975..142050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0138"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; KEGG: fnu:FN0462 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38068"
FT                   /db_xref="GOA:C7NCZ8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ8"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACV38068.1"
FT                   /translation="MGYIKILDEKVSNIIAAGEVVENPASMIKEMIENSLDAKATMIKI
FT                   EVFKAGTDVKVSDNGIGMDKDDTLLSVERHATSKIKEKEDVFNLNTYGFRGEALSSIAA
FT                   VSKLTITTRSENSPVGYKIGCYGGVVRKFEEVSRNVGTEMEVRDLFYNTPARRKFLRKM
FT                   STEYGKIRDIVLKEALSNSNVAFSLELDGKSTIKTSGKGIDNTILELFGKSVLRNLKKF
FT                   EYGYLGNVEILRSSKDFMFTFVNNRYVKSATIERAVIDGYYTKLMKGKYPFAIIFYNTD
FT                   PKEIDVNVHPSKKIIKFSNDKIVYNEIKSAIDDFFYYNDRENWQPNIDLIKKNININEN
FT                   VSLEKDDLFSDDVLKGENQKVISLETFDGKILENTKNSNEKDNFSAINFNKNDRNSEFS
FT                   DNSENITYNTFSSDKNFVNNKNENSSKLDEIWNKMNKNSNKIVENNVENFEIEDKFQTK
FT                   KWKHNSNFKNYKNSGEHRNFDIINENTENKSYYKVGTFEKHVGKQFHYDILGQIFDTYI
FT                   LVRRDEELEIYDQHIIHERILYEELKDKFYNKKLESQHLLLPLKMGITGIEKNIIFENI
FT                   EIFRDFGFDVDEFSEDEIVIRAVPAFDFRDSIENVFLQLLMDLKNEVEIKDLRENIIIS
FT                   MSCKGAVKAGQKLDMFEMQNMVRRIHEVGKYTCPHGRPIIVKLSKNDLDKMFGRRK"
FT   gene            complement(142123..142713)
FT                   /locus_tag="Lebu_0139"
FT   CDS_pept        complement(142123..142713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A2357 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NCZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38069.1"
FT                   /translation="MKKEEEEINMKKILSIIVGLILISTITSCQNDKKIIENDLKNLIE
FT                   FTRNGGYKSSNHDKMAAITFEAIDEGYKKMSYKINKTTEENKNKIIVNITIKYPDLSGA
FT                   IEIFKNKILEERQRLLKSPNPTVRSDDEMIKLTTQFLKESVNEKLNDPNLRYFEETFDI
FT                   VYVKHNDNWEMQDSPQFNKAMLFNLHFNSFTQN"
FT   gene            complement(142713..143270)
FT                   /locus_tag="Lebu_0140"
FT   CDS_pept        complement(142713..143270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_3139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38070"
FT                   /db_xref="GOA:C7ND00"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND00"
FT                   /inference="similar to AA sequence:KEGG:Cthe_3139"
FT                   /protein_id="ACV38070.1"
FT                   /translation="MDKLRKFDIVIGILFGITTIILIHLFFSNDIFFMWVFQRHHNMLS
FT                   WYTRPLFIIPIIWSAYKKLFSGISISIFGLFTSMFWFPKPNITNPEIVKFLNFEANYLK
FT                   SGWTIDKIVLLFTVIIFFVFIIVSTWTKNWKLLLLILIATAILKIFNSYLLTGKSALSM
FT                   LKPAVTGLIVCMIAVFYLKKKN"
FT   gene            complement(143387..144370)
FT                   /locus_tag="Lebu_0141"
FT   CDS_pept        complement(143387..144370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0141"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /note="TIGRFAM: diphosphomevalonate decarboxylase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein; KEGG: sgo:SGO_0240
FT                   diphosphomevalonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38071"
FT                   /db_xref="GOA:C7ND01"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND01"
FT                   /inference="protein motif:TFAM:TIGR01240"
FT                   /protein_id="ACV38071.1"
FT                   /translation="MVKVKSYANIAIVKYWGKKNAEKMIPSTSSISLTLNDMFTETEME
FT                   FINDSDIKIAVEKEIKSENYKDKYSDMTDLFYLNGELQDSVHTEKISKVVDLFRGNRSQ
FT                   KVKISTTNNMPTAAGLSSSSSGLSAVIKACNELFGKNYTQSELAQISKFGSGSSSRSFF
FT                   GPVAAWDKDTGEIYEVKTDLKLAMIVLVLNENKKEISSRNGMELCAKTSTYFDEWVKQS
FT                   EIDFVNMKKYLAENDLEKVGILTEENALRMHKTTETANPPFSYFNEKTYEAMDFVKNLR
FT                   NNGEKCYFTMDAGPNVKVLCLEDDLEKLAGIFEEKYKIIVSKTVKL"
FT   gene            complement(144458..145348)
FT                   /locus_tag="Lebu_0142"
FT   CDS_pept        complement(144458..145348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0142"
FT                   /product="mevalonate kinase"
FT                   /note="TIGRFAM: mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: sak:SAK_1357 mevalonate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38072"
FT                   /db_xref="GOA:C7ND02"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND02"
FT                   /inference="protein motif:TFAM:TIGR00549"
FT                   /protein_id="ACV38072.1"
FT                   /translation="MKKGIGKSHSKIILIGEHSVVYGYPAIAIPLKKIGIECIVEEAKS
FT                   SCFHNKTDTLSVALFTALKYLKKENAKIKYKVTSQIPPKRGMGSSAAVSIVAIRAVFDY
FT                   FGENLEDELLEKLVHTAEIVAHSTPSGLDAKTCLSDKAIKFIKNKGFSYIDLNLDAYLV
FT                   IADTGIYGNTSEAIQNVKNLGSNADSSLKKLGKLTDEMAKILTENIQSKEEKVNKIGKI
FT                   MTKANIELRNLNITIEKTDLFVKTAIENGASGAKISGGGLGGCVIALAKNLDIVEKIKE
FT                   GLIKCGAENIWMEKI"
FT   gene            complement(145655..145906)
FT                   /locus_tag="Lebu_0143"
FT   CDS_pept        complement(145655..145906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38073"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38073.1"
FT                   /translation="MKKLILVGCLAFGALGFSRFVNECHVTSKTSRSVTCRSNESGRTF
FT                   QFTSGRLSSVSSGYTYKIYFEGNGYRGLRLTGAKLLAG"
FT   sig_peptide     complement(145835..145906)
FT                   /locus_tag="Lebu_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.715 at
FT                   residue 24"
FT   gene            complement(146198..147538)
FT                   /locus_tag="Lebu_0144"
FT   CDS_pept        complement(146198..147538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0144"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: fnu:FN1393 signal recognition particle,
FT                   subunit FFH/SRP54; TIGRFAM: signal recognition particle
FT                   protein; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38074"
FT                   /db_xref="GOA:C7ND04"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND04"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ACV38074.1"
FT                   /translation="MFNNLGDRFKDIFKKVSGQGKLTENNMKDALREVRLALLEADVNY
FT                   SVAKNFVAKIREKALGEQVISGVNPTQQFVKIVNDELVEVLGGSNVSIAKADKNPTIVM
FT                   LSGLQGAGKTTFSGKLAKHLRSKGEKPFLIGADVYRPAAKKQLKVLGEQVKVPVFTIDE
FT                   SIDPLEIVKQGIEASKTEHATYVIIDTAGRLHIDEQLMHELQDIKDCFNPNEILLVVDG
FT                   MTGQDAVNVAKEFNEQLDITGVVLTKLDGDTRGGAALSVKEVAGKPIKFISEGEKLDDI
FT                   APFHPDRLASRILGMGDVVSLVEKAQEAIDEKEAKKMEEKFRKNQFDFEDFLKQFKMIR
FT                   KMGSIAGIMKMIPGVDTSMIDMGMAEKEMKKVEAIIFSMTVQERRDPKLLKNGSRKMRI
FT                   AKGSGVQVNDVNKLIKQFEQMKQMMKMFNSGGIPGFGGGGFMRGRRR"
FT   gene            complement(147767..147862)
FT                   /pseudo
FT                   /locus_tag="Lebu_0145"
FT   gene            148277..151429
FT                   /locus_tag="Lebu_0146"
FT   CDS_pept        148277..151429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0146"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SMART: helicase
FT                   domain protein; DEAD-like helicases; KEGG: hmo:HM1_3006
FT                   SNF2 family RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38075"
FT                   /db_xref="GOA:C7ND05"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND05"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACV38075.1"
FT                   /translation="MENSAKKFIEKINEVLAEKENAVVNIINDKLTISVFTALEKNLKN
FT                   VKEINFIIRDTKFIPKNDEISREFEITPNDILYNSYDIKEKNKLKHFAEAKAMYDFIKN
FT                   NVNVRKVKPYQKVNGNILIIDDDFMIQGTSSLEIYEKRANRYDFDTTIKGEAEKSQILG
FT                   MSRIYDEIWNNNDVTQDYKQELLESLEFVYKNYNPEFLYYFTLNELFGDKLDSGVERFE
FT                   NDSDKFKKTEIWNSLFDFQKDCVVSAIQKLQKYGGCIIADSVGLGKTFEALAVIKYFEI
FT                   RNDNVLVLTPAKLYDNWRSFTGNYKDSFLNEMFNYKIMFHTDLSRTKGESKSGYELSRF
FT                   DWSKFDLVVIDESHNFRNRIAKYDENDELIMNRYFKLLHDVIKSGKNTKVLLLSATPVN
FT                   NSLVDLKNQISIITSDHDDAFSEQGISSVGYLLKKATQVINDWEKEGSQKKDELLDNLP
FT                   SDFYKLLEMMTISRSRKHITNYYGTKNIGKFPQKNKPITYYPEIDSQNQLLNFKNTNSI
FT                   LEELNLSVYTPTKFIKSEKLNYYINKYKLSGNRGGKMDFDTQSKGLVYLHRTNLFKRLE
FT                   SSVFSFSETLKRLIENIDQTIENLNKGQQIEENLDVENEDEIYIERSKYEIKVEDLRIN
FT                   AYLEELYNDRDIVKRIYDETLILLKEDRDNKIHELEKIVGNKVDNTPYNPGNRKILIFT
FT                   AFADTANYIYSKLLKKFERKNISIASVTGKGVKTSNKKVKEDFHSILSAFSPKSKLKIE
FT                   IPQDEQIDIIVATDCISEGQNLQDCDTVINFDIQWNPVSLIQRFGRIDRIGSKNDNIQM
FT                   INFFPNADLNEYLDLERRVKGKMTTLNIASTGDEDMLNPEMNDFNFRKRQLKKLKEEVI
FT                   DIEDTNENISLTDLNMNEYLYELSNYVNNHKEINKIPKGIYSVTEGEQKGVLFCFKHSK
FT                   NDAKPKNDSSLYPYYLIFVDNNKEILFKNSQAREVIKLFRQLCYEKNEVQEKILKEFFK
FT                   DTKNATEMGFYSELLNTAVNSIKGEEEEKAVQTVFDFSGFNNNFKDDTTDDFELISFLV
FT                   VG"
FT   gene            151430..152143
FT                   /locus_tag="Lebu_0147"
FT   CDS_pept        151430..152143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hmo:HM1_3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38076"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND06"
FT                   /inference="similar to AA sequence:KEGG:HM1_3005"
FT                   /protein_id="ACV38076.1"
FT                   /translation="MINMPERYEINQEIKLKNLILKEFKPIEKKKIKEYIKSVTLKYMI
FT                   NDEEIPSVEDEKYNFKVIQYFDFEITDIKKAGFLANLYQESIKSPCILRFYDNSKELYS
FT                   LALKRLNQNDRNEIVVTDTVMTETFDLSMSGSAKREVERVLDYSKILNRTNKVNFYSEI
FT                   FIKNYILKNRKYYQKSGNILESLIWYDRNKTINVFENFKNLVMYKEKIKSTIRNSEKVE
FT                   INKKIREIISELDKY"
FT   gene            152159..154120
FT                   /locus_tag="Lebu_0148"
FT   CDS_pept        152159..154120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0148"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tex:Teth514_1828 site-specific DNA- methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38077"
FT                   /db_xref="GOA:C7ND07"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND07"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACV38077.1"
FT                   /translation="MENNKIKKEINDIVNDNLKALEQLFPSAVKDGQLDIKALKEELGD
FT                   FEEVTTEKYELNWSGKQNAKKIVQQGIGNKTLKFVAKDSKNADTTENIYIEGDNLEVLK
FT                   LLRQNYYNSIKMIYIDPPYNTGNDFVYNDTFKMDKEESDKAEGIISENNEKLQKNQKST
FT                   NRYHANWLNMMYPRLKLARDLLTDDGVIFISIDDNEQANLKRLCDEIFGEENFVEIFSW
FT                   QKTSTPPNLSKKTKKSVEYILCYQKNECKTLKGLVKESKSTNGLMNQSNSIGTLVFPHE
FT                   SVETSIKNEKLEKGIYGTESYVIELLSDVEIRNGKFLNDIILKGKFKWSQDYLEEQIKL
FT                   GTKIFIKTKALSPSYEKEEYDPEKPWNIIDKNFGVGTNENASDELDNLFYKNFSDKLYP
FT                   KPTSLITYLLNMLELENNIILDFFSGSATTAHAIMQLNSEDDGNRKYIMVQLPETTDEK
FT                   SEAFKAGYKNIADIGKERIRRAGEKIKQEIEEYNSNLKLEEEPKKVPDIGFKVFKVDDT
FT                   NIKWYDLENFNEESQYSFDDPDSLDFVLGSNDIDIVYEIMLRQNDVPLSENLEVLTNIG
FT                   NRTYLYASTYLICLETEITEEMVEKLASLEPLPIKFVFRDSAFKDNISLKDETFRKLRS
FT                   LIERNSGESKVSYRVEFI"
FT   gene            154154..154861
FT                   /locus_tag="Lebu_0149"
FT   CDS_pept        154154..154861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hps:HPSH_07785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38078"
FT                   /db_xref="GOA:C7ND08"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38078.1"
FT                   /translation="MEENFEKKLENLLNEIQKFSDEVRFEYDLGTMKILVCETEKEFWE
FT                   KYYEFYNKNGNYAKFLEYKEKFKDINNELSNENKNIQINETIEKIYNTFDYITYILNIY
FT                   EKQLRENEIDYGLKKIKKYKNIFQNQRAQIEYLKKNYKKISDEQKEYDRKILEIMGVFL
FT                   TIFSVIGFGVSSIAKENTNISTVFMIYGVILMTMSSLFYLINFDKNFKEKLLKISVPLM
FT                   IGILLIIFGKYIL"
FT   gene            155052..155453
FT                   /locus_tag="Lebu_0150"
FT   CDS_pept        155052..155453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38079"
FT                   /db_xref="GOA:C7ND09"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38079.1"
FT                   /translation="MIVNLFMGLILMASTFLTGGLGLGIIYIMEYFRKKTKENTGKENE
FT                   LLFIILGLIIYMIYQFWFYIMLESEGIISFYWSTLGSWIYFEFSKIGMLENMKKTGGDT
FT                   SFLDKNKYLLYLILVIFCIINVIVYECIK"
FT   sig_peptide     155052..155111
FT                   /locus_tag="Lebu_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.543 at
FT                   residue 20"
FT   gene            155562..155822
FT                   /locus_tag="Lebu_0151"
FT   CDS_pept        155562..155822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0151"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: cco:CCC13826_1068
FT                   addiction module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38080"
FT                   /db_xref="GOA:C7ND10"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND10"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACV38080.1"
FT                   /translation="MAQAMINFRIDENIKKEMEKICREMGMSMTTAFTIFATKVTKEKR
FT                   IPFEITADPFYSESNMRYLEKVIADIESGKAKLVEHDLIEE"
FT   gene            155960..156127
FT                   /pseudo
FT                   /locus_tag="Lebu_0152"
FT   gene            156108..156710
FT                   /locus_tag="Lebu_0153"
FT   CDS_pept        156108..156710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0153"
FT                   /product="unknown phage protein"
FT                   /note="KEGG: spa:M6_Spy1340 unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38081"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND11"
FT                   /inference="similar to AA sequence:KEGG:M6_Spy1340"
FT                   /protein_id="ACV38081.1"
FT                   /translation="MDIKKKSETISLQKLREKLKDDDFIKEKILKTFRSRDRNSIEDFL
FT                   HNKAIDFEKKSLSATHIIYNKEGTEILGYFTFANKSLIIEKENFLSLSKTQQKRFSQSG
FT                   RRLKDGSYVVNSFLLAQIGKNYNVSDKNMITGNEIISLAHELLLIVKKIINTKYLWLEC
FT                   EDNSSLIRFYSNYGFNLIKEFSSENKLRTMILRLDNF"
FT   gene            156791..159859
FT                   /locus_tag="Lebu_0154"
FT   CDS_pept        156791..159859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0154"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: hmo:HM1_3003 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38082"
FT                   /db_xref="GOA:C7ND12"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND12"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACV38082.1"
FT                   /translation="MSNKIIFQFDDNLEYQKKAVNSVVELFRGLPKSLDNIYAERIRKT
FT                   RLMEKDPVRNIDIVRGNKLFQNLKKVQLKNGLFTNEKAYSKHERDFTVEMETGTGKTYV
FT                   YLRTILELHKEYGFKKFMIVVPSVAIRKGVEKSIEQLREHFKRLYNVDLSKYSFIYDSN
FT                   NLGKVNNFVEENNLSICVMNIQAFNKDTNKIRKDDEYDKNLWRDIKFVRPIVLIDEPQK
FT                   IEGTANKKSQSLKAIDELEPLFTLRYSATHKNLYNQVYKLDSYEAYKKDLVKKIRVKTI
FT                   NSVISKDFPYIRYTYFTKDYKARIEMFSQEQGQSIRFRSFDVENGFSLYELSGGLPQYK
FT                   DMFIAEQPHKEKALKIASVNGDIELKLGESNKKLEDKEIIRIQINLAIDNHFKKQFEIL
FT                   EEGKRIKSLTLFFIDEVKKVRDSGASDGRGVYLKIFDEEYLKIVQKYREKIEKYKNYFP
FT                   HYEDVNLVREGYFALDKKKKEVEVEYKKENEVKAKSQEDIDRGIELILEKKDELISFNE
FT                   PLAFIFSHSALREGWDNPNVFTLCTLKNGSSDIAKKQEIGRGLRLPVDVNGNRSLDKNV
FT                   NELTVIANDSYENFSRMLQEDFNKNINKNEVTSDLLLITLEKSGIPKIKITSELVDEFK
FT                   KELIENKVMDSNNVLLKKTEEIDVKKIEFSNETLKEHSIQIAENFVKYMVEKGSNRIEI
FT                   ANGDNEPIINKRRTFISEKDFENLFEELGTNLSKKAIYRCKIDNEKYIESSIKKINNYI
FT                   SNFDLKQIVEVAESKGDYDETGNFNLEKDSSDKEIEISKIEVAPKSDFEIANYIMYHTM
FT                   LPRLAILKIISGLEKEKREALNIQDVLENVTEILLENLNEMKAEKVFEYEVIDGYVTDT
FT                   EKIFEVDNKINEEDFENKRRLFQAKKGSRSLSDYYKLDSDGEKEFAEKLENDENVLLFT
FT                   KLKKGGFVIDTPYGNYSPDWAIIYRNSSENNENNVGIYFIVETKADKEEKDLTTVEKSK
FT                   IKCGKLHFEAISKEVKFNWVNNYDDFRRKFEIK"
FT   gene            160127..160339
FT                   /locus_tag="Lebu_0155"
FT   CDS_pept        160127..160339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38083"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38083.1"
FT                   /translation="MVINKKLSELRHLKEKILNIECNINTLKNIKEKFAFNIIKQKKAQ
FT                   LKQLKIEFQQVQQELHELLDKEMKL"
FT   gene            160406..160786
FT                   /locus_tag="Lebu_0156"
FT   CDS_pept        160406..160786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hps:HPSH_08020 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38084"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38084.1"
FT                   /translation="MENFKKRLYDYELTEIQQEMELAGYSDSFIFYVCTHFKSLFENAY
FT                   IENTTALKQLNYYSAVGSITYNADKSQMDLLEHYSDINIFFKNNSEYKKYGYLFFENVE
FT                   KFEVLIIEKLFNDYALKYDYEE"
FT   gene            161033..162943
FT                   /locus_tag="Lebu_0157"
FT   CDS_pept        161033..162943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0157"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); TGS domain protein;
FT                   Anticodon-binding domain protein; Threonyl/alanyl tRNA
FT                   synthetase SAD; KEGG: fnu:FN0611 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38085"
FT                   /db_xref="GOA:C7ND15"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND15"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ACV38085.1"
FT                   /translation="MIEMILPDGSKRQLENPMTVVEFAKSIGSSLGKATVGAIIDGVQV
FT                   DPSHIIDKSGTIEIITNTSEKGIEIIRHSAAHIMAQAVQRLFPNTKVTIGPVIENGFFY
FT                   DFDPEKPFTEEDLAKIEGEMAKIVKENYEFKRSEMTAEEAKKFFAEKGETYKVEIIEDL
FT                   GADKVSIYQQGEFIDLCRGTHIPSTGYLKAFKLMSTAGAYWRGDSNNKMLQRIYGVAFA
FT                   TKKELDDYLTMMEEAEKRDHRKLGKQLDLFFVDEHGPGFPFFMPKGVELFNKLQEIWRV
FT                   EHKKRGYQEIKTPIMLDKELWEISGHWFNYRENMYTSTIDEKEYAIKPMNCPGSIIAYK
FT                   NNLHSYKDLPLKYGEMGLVHRHEFSGALHGLMRVRAFTQDDAHVFCTKEQIEEQIIEII
FT                   DLYDKFYTVFGFEYHIELSTKPDKAIGSDEIWEMAEANLKSALEHKGINYKLNPGDGAF
FT                   YGPKIDFKMKDSIGRIWQCGTIQLDFNLPARFEMSYIGADGEKHEPVMIHRAMYGSLER
FT                   FIGILIEHYAGAFPTWLAPVQARILTISDEQVPFAKELFIKLQDAGIRVELDTRVEKIG
FT                   YKIREANGVQKIPVQLIIGKNEVANNEVNVRRFGSQDSKNVSVDEIIETLKQESHVPFS
FT                   K"
FT   gene            163218..163916
FT                   /locus_tag="Lebu_0158"
FT   CDS_pept        163218..163916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0158"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   fnu:FN0866 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38086"
FT                   /db_xref="GOA:C7ND16"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND16"
FT                   /inference="protein motif:PFAM:PF01027"
FT                   /protein_id="ACV38086.1"
FT                   /translation="MTMTYDDLDRLVSSKVRGSMMWMLLGLVITGLFGFFVYNGLMTGN
FT                   PIAIGIIRMYYVLAVIEVIVVVAFSALIYKAKSSTLKLMFLIYSALNGLTLSAIGIIYA
FT                   PSIVISAFLGTLVLFAVVAVYGYFTKENLTKFTPMLMIGLISIVLVSLVNIFLRNSGLD
FT                   LFVSVLGVIVFTIFIAVDVNRIKSNIIAYAVQEDSEILNKIEISGALSLYLDFVNLFLS
FT                   ILRISGRGRN"
FT   gene            164015..164614
FT                   /locus_tag="Lebu_0159"
FT   CDS_pept        164015..164614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmz:MmarC7_1361 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38087"
FT                   /db_xref="GOA:C7ND17"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38087.1"
FT                   /translation="MKNNKKIDNKTVHEIESFINEEILASRIWIFSGIAISILLCMILK
FT                   NYMIFELANIIQSLRKLKLPDGKGILFIILFILEILLSFVLPKILINKQKKNMKSALIV
FT                   LSLIKGLILSIFFGKLSFFVTQKTIIAGIMLVLALILLVFLIKKDIKNIQIKILKKVET
FT                   DSTEILEKTRFFSVVVLYSDIVKVVILYLLLMLIIR"
FT   gene            164636..165022
FT                   /locus_tag="Lebu_0160"
FT   CDS_pept        164636..165022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38088"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND18"
FT                   /inference="similar to AA sequence:KEGG:GFO_0498"
FT                   /protein_id="ACV38088.1"
FT                   /translation="MKRKIECVEEFHRIYKLGNSDKPIGKLENGLEKLRFDLMKEENDE
FT                   YLEAAKRGDVVEVADALGDMLYILCGTIIEHGMQDVIEDVFEEIHRSNLSKLDENGKPI
FT                   YREDGKVIKGPNYFPPNLKQFFEK"
FT   gene            165241..165498
FT                   /locus_tag="Lebu_0161"
FT   CDS_pept        165241..165498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0161"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: fnu:FN1437 50S ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38089"
FT                   /db_xref="GOA:C7ND19"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND19"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ACV38089.1"
FT                   /translation="MQRCEVFGKTVSHGNRVSHSHRATKRIWRPNLQTMLLTINNEEVR
FT                   VRVCTKAMKTLKGKNVDQVKKILLKNKETLSPKILKVLAK"
FT   gene            165525..165601
FT                   /locus_tag="Lebu_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            165525..165601
FT                   /locus_tag="Lebu_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(165711..166400)
FT                   /locus_tag="Lebu_0162"
FT   CDS_pept        complement(165711..166400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0162"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   cdf:CD0702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38090"
FT                   /db_xref="GOA:C7ND20"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C7ND20"
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /protein_id="ACV38090.1"
FT                   /translation="MARNIKKIFFNGEEYPPETFRLAMLLCMVGGFMDTYTFSTRGNVL
FT                   ANAQTGNIVFLAINLGKGNFGKAFYYFVPVFVFTMGILFSEFIRIKFEKHKIFRWQQIV
FT                   IFYQVIIMFFIAFVPSGKWNMPINIIMSFIAAIQYQGFKKIRGMAGATTICTGNLRSGM
FT                   ENLFKYINTKETSFLQNFWIYIGLDLFFLVGALLCMVLVGIYGELSLLACCILLIIVFS
FT                   VMFKEAI"
FT   gene            complement(166605..167294)
FT                   /locus_tag="Lebu_0163"
FT   CDS_pept        complement(166605..167294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0163"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dsy:DSY1198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38091"
FT                   /db_xref="GOA:C7NDC9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDC9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV38091.1"
FT                   /translation="MYKVLIADDNKQIVSILSEYCKKNNFIVSTVFNGEDALKEVEENK
FT                   FDIVLLDVMMPKKDGFDVCREVRKFSNVPIIMITARGEDYEKIMGLEIGADDYIVKPFS
FT                   PGEIIARINAILRRITPKNDDSEKIFSFDNLEIDLNNFTVKINNEIISLTKKEIEILWT
FT                   LATNQNKVFTRENLLDLIWGFDYFGESRTVDTHIKRLRAKMDNYEHKKWNIKTIWGVGY
FT                   KFDILEN"
FT   gene            167591..169660
FT                   /locus_tag="Lebu_0164"
FT   CDS_pept        167591..169660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0164"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: fnu:FN1660 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein; type
FT                   III restriction protein res subunit; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; SMART: DEAD-like helicases ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38092"
FT                   /db_xref="GOA:C7NDD0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD0"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACV38092.1"
FT                   /translation="MKTYNLLYENLENMKIKGVTKTNIPKFRKLGVFILYDLLYFFPRA
FT                   YENRSNHKKIAEILADEFVILQGTIVNVVNQYIKAGRTMFRAVLSDDSGMIELVWFNNR
FT                   FVKNGIHIGDEITVYGKVRKTVKFQLVNPEYKKINQASFDMHEQKQILPIYPSTESLRQ
FT                   QVIRKVMENALMDYGYLLQENLPKEFLQKEKLLGRKEAVLNIHFPESEEKQSKARKRFM
FT                   LEEILLLEMGILQNRFSVDKANKNLYKLEDNKSLVSKFIKSLDYELTKAQKRVIKEIYS
FT                   ELKAGKIVNRLIQGDVGSGKTIVSFIMLLYMVENNYQGVIMAPTEILATQHYLGIVDEF
FT                   MNLDIRVELLTRSVKGKKKEKLLNEIKEGLVDIVIGTHSLIEDNVIFKNLGLIVIDEQH
FT                   RFGVTQRKLLRDKGNIANLIVMSATPIPRSLALTIYGDLDVSIIDELPAGRSPIKTKWI
FT                   QNEIDRQKMYNFMEKKMKDGRQVYIVSPLIEESESLNVKSAQETYEEYISIFPNRKIGL
FT                   MHGRQTYKEKQKVMEQFKNHELDILVSTTVIEVGVNVPNASIMVIRDAQRFGLSSLHQL
FT                   RGRVGRGKYQSYCFLESETTNEISTKRLEVMEETTDGFKIAEEDLKLRNSGEILGTRQS
FT                   GVSDMLFTDIVKNVKEIKFVRDFVMEYLKKNDGKIENEFLKMDIYRKFFNNADD"
FT   gene            170020..170904
FT                   /locus_tag="Lebu_0165"
FT   CDS_pept        170020..170904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0165"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ckl:CKL_0691 transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38093"
FT                   /db_xref="GOA:C7NDD1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD1"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV38093.1"
FT                   /translation="MKQYLADFGLLFVGIFWGLGFVFVKIGLNTGVDPFYLSAVRFLVG
FT                   GLILYGIFFRKVGRFTKKDILAGLIVGIFQFFGYAFQTYGAMLTTASKNAFFTSINVII
FT                   VPYIFWFLHKKRPDIFAFLASVICVMGVAVISFDRKMNLANLNFGDILTIISAVFFAGQ
FT                   IATNGYFSKKVEPLKLVVMQMFVAGILFVINVFIFSDISKIEKPAGMTLVAIIYLTLFS
FT                   TAIPTVLQTFCQKYTTSTRASILMSTESLFAPLFAFFILSERLSLRVAAGASLVLFAVL
FT                   VSETKLGLKKIEE"
FT   gene            171005..171523
FT                   /locus_tag="Lebu_0166"
FT   CDS_pept        171005..171523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0166"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: mla:Mlab_0191 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38094"
FT                   /db_xref="GOA:C7NDD2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD2"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACV38094.1"
FT                   /translation="MKIVLYGHPTLRQKSEKVDVVDDNVRETLDEMVALMRKANGVGLA
FT                   ANQVDIAKRFFVLEHDGVVKKVINPEILEFSDEIVDMEEGCLSIPGVFKKVNRPAKIKV
FT                   KYLNENGKEVVEELEEMWSRAFQHEFDHIEGILFTDKLSVMNKRLVAKKLDVLKRDFTK
FT                   GRIYRDLDE"
FT   gene            171547..172497
FT                   /locus_tag="Lebu_0167"
FT   CDS_pept        171547..172497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0167"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: fnu:FN1489
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38095"
FT                   /db_xref="GOA:C7NDD3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD3"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACV38095.1"
FT                   /translation="MKTIFMGTPEFAIPSLEVVFKNTDLQLIFTKEDKINARGNKIIFS
FT                   PVKQFGIDNDIEIIQPKKMKDEEVINKIKEINPDLIVVVAYGKILPKEIIDIPKYGIIN
FT                   VHSSLLPKYRGASPIHSAILNGDTETGVSIMYIEEGLDSGDVILKEYCEITEDDTLGTL
FT                   HDKLKDLGAAGLTKALKLIENGEVQAEKQDDSKATLVKPITKEQAKIDWNSTKEVIYNQ
FT                   IRGLNPFPAAHTSNEKGENIKIYKSEKIDKNYKDENETEIENGTIVEIINKKGPVVKVA
FT                   NGGILILEAKFEGKKLQKGVDIINGRKMVIGEKLL"
FT   gene            172578..173243
FT                   /locus_tag="Lebu_0168"
FT   CDS_pept        172578..173243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0168"
FT                   /product="Rex DNA-binding domain protein"
FT                   /note="PFAM: Rex DNA-binding domain protein; CoA-binding
FT                   domain protein; KEGG: tpt:Tpet_0756 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38096"
FT                   /db_xref="GOA:C7NDD4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD4"
FT                   /inference="protein motif:PFAM:PF06971"
FT                   /protein_id="ACV38096.1"
FT                   /translation="MKLKKLEISERVVQRLTEYLSILKEARKRDDEINSIELAKIMNTT
FT                   SAQVRKDLSTFGEFGVRGKGYDIDNLIEIITKILGIDKINHVIIVGHGKMGEMLSSNVE
FT                   VLGEGFKIVGIFDKDENKIGKIAENNLVIQDVRNVEEFVKNMKNEFNIKIDTAILAVIK
FT                   EQAQFAAEELVKNGICAILNMTTYKLELNKNIKVVDMDISAKLQELNFWRINSPNEKI"
FT   gene            173268..174137
FT                   /locus_tag="Lebu_0169"
FT   CDS_pept        173268..174137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0169"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: sul:SYO3AOP1_1067 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38097"
FT                   /db_xref="GOA:C7NDD5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD5"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ACV38097.1"
FT                   /translation="MISSKGMTIIDGKMLSDKILKEIEEEHSELQTGVGRKAGLAVIIV
FT                   GENPASQIYVRNKIRACERVGFHSETIRLDEHITEENLLLEIEKLNNDNNIDGILVQLP
FT                   IPKHINELKVINAISAEKDVDGFHTTNIGKMMIGDETGFLPCTPAGVIQMFEEYNIDLE
FT                   GKDVLVIGQSNIVGKPMTLLLINKRATVQVCNSKTKNLPEKLQKADVVVAAAGSPKLVK
FT                   GSDVKEGVVVIDIGINRVDGKICGDVDFEEVSQKASYITPVPGGVGPMTIAMLIKNTFK
FT                   SYKQKVGK"
FT   gene            174174..174665
FT                   /locus_tag="Lebu_0170"
FT   CDS_pept        174174..174665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0170"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: ftn:FTN_0563 acetyl-CoA
FT                   carboxylase, biotin carboxy carrier protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38098"
FT                   /db_xref="GOA:C7NDD6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD6"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ACV38098.1"
FT                   /translation="MKDKIKFIEELAKSMNENKIEAVKYEDNNFEISLTKKRKERNVIL
FT                   SRALSQPQPLAQAPVSTEEEVKIEETAAPAEPKEVAPEEISGTKITSPMVGTFYASPSP
FT                   TAAPFVKEGDSVKEGQTLCIVEAMKLMNEVKSTVSGKIKKVLVKDKDSIKKGQALFIVE
FT                   "
FT   gene            174707..175990
FT                   /locus_tag="Lebu_0171"
FT   CDS_pept        174707..175990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0171"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: fnu:FN1486 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38099"
FT                   /db_xref="GOA:C7NDD7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD7"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACV38099.1"
FT                   /translation="MEEKRILLDVILLLVLLFFTSFLSAAESALSSLKQIHLKSDSKEK
FT                   EKTRESELLKFWLENPNELLTTLLFIKTISYSSMIFTGIYLIKKLYKENHYVGISFFVL
FT                   IMLILLFSEMIPRLIARNNIYGVSKTLIIPLNTLRIILRPLIRLFIYISRLIVGIFKIK
FT                   VKDQMFEITEDEILTFLKAGTESGVFEEGEEEMITSIFEFSETTVKEILTPRRDVFALE
FT                   AESKIDDVWNEILDQGFTRIPIYTETIDKIVGTVHMKDLLRYDKQTGENPPIKDFMKEA
FT                   YFVPITKPLVELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQEEE
FT                   NIQQIREKIFDIKGDTPIEEINDKLEIEIPLSEEYDTISGYIQDKLGKVADVFDQVKGD
FT                   NFVLKVTDVDNKRVERVRAVIIEQEKEE"
FT   sig_peptide     174707..174784
FT                   /locus_tag="Lebu_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.835 at
FT                   residue 26"
FT   gene            175987..176460
FT                   /locus_tag="Lebu_0172"
FT   CDS_pept        175987..176460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0172"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: lic:LIC20067 MutT-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38100"
FT                   /db_xref="GOA:C7NDD8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV38100.1"
FT                   /translation="MRKQGEKMEEVRPRIRVAGILVENNKILLIQHHKNNKKYWLIPGG
FT                   GNDWGETTKQALIREYKEETNLDIEVDEFLFFSETISPNKERHVLNLFFKVHRNNKNDD
FT                   NIQLGNEAVLTDLKFVTKDELKSITIYPNIKENLLKIVNGEKVGNYLGSLWND"
FT   gene            176528..177058
FT                   /locus_tag="Lebu_0173"
FT   CDS_pept        176528..177058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0173"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: cpr:CPR_1905 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38101"
FT                   /db_xref="GOA:C7NDD9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDD9"
FT                   /inference="protein motif:TFAM:TIGR01090"
FT                   /protein_id="ACV38101.1"
FT                   /translation="MTIEEKNKIENLIRSVEDFPEKGVIFRDITTALKDKEGLEIIIKD
FT                   FTDRYKDKGIDYVVGADARGFIFGAAIAYNIGAGFVPARKPGKLPAEVESVEYSLEYGK
FT                   NSIEIHKDAFKKGSKILIVDDLLATGGTAKAMVQLVEKLEAKVYELAFMIELTDLKGRE
FT                   LLEGYDVYSQLKY"
FT   gene            complement(177135..177293)
FT                   /locus_tag="Lebu_0174"
FT   CDS_pept        complement(177135..177293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38102"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38102.1"
FT                   /translation="MHNDNEMGLHFKYPVVLRRKEIWKEERREGKVKAKWSFSINKKTF
FT                   EISSFYF"
FT   gene            178176..179680
FT                   /locus_tag="Lebu_R0008"
FT   rRNA            178176..179680
FT                   /locus_tag="Lebu_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            180022..182607
FT                   /locus_tag="Lebu_R0009"
FT   rRNA            180022..182607
FT                   /locus_tag="Lebu_R0009"
FT                   /product="23S ribosomal RNA"
FT   gene            182759..182871
FT                   /locus_tag="Lebu_R0010"
FT   rRNA            182759..182871
FT                   /locus_tag="Lebu_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 54.08"
FT   gene            182888..182964
FT                   /locus_tag="Lebu_R0011"
FT                   /note="tRNA-Asn2"
FT   tRNA            182888..182964
FT                   /locus_tag="Lebu_R0011"
FT                   /product="tRNA-Asn"
FT   gene            183609..184055
FT                   /locus_tag="Lebu_0175"
FT   CDS_pept        183609..184055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38103.1"
FT                   /translation="MGGNGMDRIIDIYEMMKNVRRISFQAKSLEGSSTGWNYAGKGNVV
FT                   VREEGDRLYFIEEIILDNDIWYSDRKLWEFKENYIGFYRFRNGDYEKIFEFLFCDGEFM
FT                   MKKEYLCSSDLYYGEMKIWDNRICLLIKVKGEKKNEVLEYTYLT"
FT   gene            complement(184967..185518)
FT                   /locus_tag="Lebu_0176"
FT   CDS_pept        complement(184967..185518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0923 ankyrin repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38104"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="PDB:3T8K"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38104.1"
FT                   /translation="MSEYRTVSAAAMLGTYEDFLELFEKGYEDKESVLKSNILYDVLRN
FT                   NNDEARYKISMFLINKGADIKSRTKEGTTLFFPLFQGGGNDITGTTELCKIFLEKGADI
FT                   TALYKPYKIVVFKNIFNYFVDENEMIPLYKLIFSQSGLQLLIKDKWGLTALEFVKRCQK
FT                   PIALKMMEDYIKKYNLKENS"
FT   gene            complement(185608..186084)
FT                   /locus_tag="Lebu_0177"
FT   CDS_pept        complement(185608..186084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38105"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38105.1"
FT                   /translation="MNKFFKLLLLFTFIVAIGLFYKNHLKKARINVSDCPNNRYMANRK
FT                   EYYEKNYKIFKERQIKFYIDDENGKMREIANQDEFFASLREATDYAYEIVGKKWFYTKR
FT                   KLFGIAFGIDKEAKIQYISVPEKEKKNILKNIDKYPEKNIENRCVLVEVLKGNY"
FT   gene            complement(186188..187660)
FT                   /locus_tag="Lebu_0178"
FT   CDS_pept        complement(186188..187660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38106"
FT                   /db_xref="GOA:C7NDE4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38106.1"
FT                   /translation="MKELFKSKIIIIEFFKKYSIQKRKKELENEPELLNELNNKSTLLN
FT                   NKLKLKKTNKTKINKQLEKIQNIKNGKIQIINVNRYVLRFLLIVLFYISFLNLALNLKG
FT                   YNYFIYASAVIIIILSFLSMLITFIIKKKIFTAYFYDYSIKKIFLMAVIFFGVGYFLNS
FT                   YKNELEILNKKSILIKNAEINSIDELKNSTLEIVNKDGKTKWKVDKNLKILTYENSQKG
FT                   NINITDTVIDDNNNVNLSFINEKNETIWLKGKIIYFNWDTVKIKLKNKKIIEGEVYGKI
FT                   IKLETGETLILNNNFELRDESKKISDFGVMGTSLNIKKIINNFLFTFLIIFILIEYEYY
FT                   NFPFEEKEKIVSKLMLNEKNTLTIKKSVFSILRTIKLLMFPIALIQTLLIRDFIFSLFF
FT                   DKNLKKGYDIINVLVSYFSKSYLLIFIILLLPILTELFNILKLIKRYIILNKIDRFSYL
FT                   KKKRNYSRTMIYNSRKNNRYLNSFIKRTSKKE"
FT   gene            187976..188890
FT                   /locus_tag="Lebu_0179"
FT   CDS_pept        187976..188890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0179"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   fnu:FN0847 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE5"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACV38107.1"
FT                   /translation="MSEKEIKVDKIESKKQRIEELIEKREEYVNKGEIDKEIEVLRELR
FT                   ILFKSVFGVESEENIKVLTELGNSLKYIGKFKEAIRLLARAEKIIIKKYGENSMPFVTC
FT                   NANMAEVYRTMKNYDKVEEKYFKAIKTYKKNDFRNSYVFAGICNNLGLFYEEKGHYQDS
FT                   INWQKRSLEVLKDSRDRDSEIQSAVVLSNMVKSYIKLKDEELAEITMNETSEILKREMG
FT                   EYNTLYLNILNNWANVYFENKNYKKSLELLEKCEKLCRIMLGTENKNYGDILKRLKIVK
FT                   KEVDKKKIERYVWKNQVIKKIKN"
FT   gene            188923..189246
FT                   /locus_tag="Lebu_0180"
FT   CDS_pept        188923..189246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0180"
FT                   /product="putative helix-turn-helix protein YlxM/p13 family
FT                   protein"
FT                   /note="PFAM: putative helix-turn-helix protein YlxM/p13
FT                   family protein; KEGG: fnu:FN1394 signal recognition
FT                   particle associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38108"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE6"
FT                   /inference="protein motif:PFAM:PF04297"
FT                   /protein_id="ACV38108.1"
FT                   /translation="MDKLDDFLKYSVLFSYYGELFPKKKKQYLELYLEENSSLSEIAEQ
FT                   YGVTRQAVFDNIKKGVKKLDEYESKLRIFEKERELKKKLEYLKENFTKENLEKILEDFE
FT                   YTE"
FT   gene            189492..190352
FT                   /locus_tag="Lebu_0181"
FT   CDS_pept        189492..190352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0181"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: lac:LBA1577 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38109"
FT                   /db_xref="GOA:C7NDE7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE7"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ACV38109.1"
FT                   /translation="MIINKLEKKENFTNNEKEIADYILRHLEEIHLLSAENLAKKAFVS
FT                   KATVVRFCRKLGVERYREFQRRLDKEVEEMMKIKGLLSEEPVNSETKYDEIISIIPSLY
FT                   ERVIGATKLNLDTTVMEKIIEKLKNAKKIEIYGTGISYILAKLTSFKFMTLGIESAAYD
FT                   GLNEHYIISAEKGEKDIALIISLSGTNPYMIRIAEYLKKRNVFVVGIGNGSSEEIKKAC
FT                   SEYIEIHAPNYILSFEMVSLFTGINYVLDIFFTSLLVLNYYKNINTSLEVSKNYETNEP
FT                   KVSKK"
FT   gene            190491..191912
FT                   /locus_tag="Lebu_0182"
FT   CDS_pept        190491..191912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0182"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG: efa:EF0271
FT                   6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38110"
FT                   /db_xref="GOA:C7NDE8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE8"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACV38110.1"
FT                   /translation="MGFRKDFLWGGATAANQLEGAYNEDGRGLANVDLSPVGEDRFAVI
FT                   NGERKILEFDDEHFYPAKGAIDFYHRYKEDIALFAEMGFKTYRMSIAWTRIFPNGDEET
FT                   PNEKGLEFYENVFKECRKYGIEPLVTITHFDFPIHLIKEYGGWRNRKVIDFYKRLCTVI
FT                   FTRYKGLVKYWITFNEINMLLHAPFMGAGIVFEEGENKNQVLYTAAHNELVASAWVTKI
FT                   GHEIDPENKIGCMLAAGKFYALTSKPEDVWTALEKDRENYFFIDVQTRGYYPAYAKKFF
FT                   ERENINIGITDEDEKILRENPVDFVSFSYYTTRCISAEADRLGEGNLLKTMRNPYIEVT
FT                   DWGWGLDPLGFRTTINEIYDRYQKPLFVVENGLGAVDVPDADGYVEDDYRIDYLRDHIK
FT                   AMKEAVELDGVELLGYTTWGPIDLVSAGTGEMKKRYGFIYVDRDNDGNGTLKRSKKKSF
FT                   DWYKKVIATNGEDLD"
FT   gene            192074..192802
FT                   /locus_tag="Lebu_0183"
FT   CDS_pept        192074..192802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fma:FMG_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38111"
FT                   /db_xref="GOA:C7NDE9"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDE9"
FT                   /inference="similar to AA sequence:KEGG:FMG_1610"
FT                   /protein_id="ACV38111.1"
FT                   /translation="MSINGLDKIKVFSGAQLKYIAFLSMLIDHVNKALMYPLLTENGFL
FT                   RYVSDVFDILGRIAFPIFMFFLVEGFFKTRNRFKYLLYLIVFGIISEIPFDLFQSAVLF
FT                   QPNSNNIMFTLALALLMIWIIDELKVPKSRVVPKIFWFPVSIIIVITTCLLSMIWGLDY
FT                   EYHGILIAYFFYIFRNNPILSIVGGYLSIIKTPWALLGFGLTLTYNGERGKQNKILNYL
FT                   FYPVHLLILGLLRLCFKIGI"
FT   gene            192824..193507
FT                   /locus_tag="Lebu_0184"
FT   CDS_pept        192824..193507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0184"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: efa:EF1939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38112"
FT                   /db_xref="GOA:C7NDF0"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF0"
FT                   /inference="protein motif:COG:COG2364"
FT                   /protein_id="ACV38112.1"
FT                   /translation="MNRMIRAYGLLILLTILAGMELALLVKMNVGVDPWNAMALSFSFL
FT                   TGIKMGTIAIICNFLCVLGQIILLKKEFKKTNFLQIPISMLLGYAINFFVYTVFKDMEF
FT                   SNYIFRITTNIIVLVSVAFTMGAIVVLGLPTFALEGFCSAVHMKTGIPFAKFRQWIDFF
FT                   CVGIAIVLTLVFPIEWSLREGTIISMVLFGPLLGIFMPRIEKLYEKWYLVDGKSQIEKE
FT                   IEGLE"
FT   sig_peptide     192824..192895
FT                   /locus_tag="Lebu_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.663 at
FT                   residue 24"
FT   gene            193547..193933
FT                   /locus_tag="Lebu_0185"
FT   CDS_pept        193547..193933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0185"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: fnu:FN1050 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38113"
FT                   /db_xref="GOA:C7NDF1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV38113.1"
FT                   /translation="MKINHVAIYVKDLEKTREFYEKYFKAKANEKYHNKNTGLQTYFLS
FT                   FPDSEVRLEIMSRPELLERNDKIMNEGFIHIAFSVGNKENVDKLTERLVNDGFRCLSGP
FT                   RTTGDGYYESVVEDCEGNLIEITE"
FT   gene            194027..194620
FT                   /locus_tag="Lebu_0186"
FT   CDS_pept        194027..194620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38114"
FT                   /db_xref="GOA:C7NDF2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF2"
FT                   /inference="similar to AA sequence:KEGG:ECA1475"
FT                   /protein_id="ACV38114.1"
FT                   /translation="MFKKLEKNGFYYGFPVLLMTTKDKETGKSNVTPLSSSFVLGKSIV
FT                   VGIGFGNKGFKNIENGSDVTFNIPDENLYESVKKIEKFTGDTEISEVKQNLGYTYCEDK
FT                   FKIAGFTELAGEMVNSVRIKECPIHIEAKVTDIIKKDWFAIVTCEIQGIFVDEKIMKDD
FT                   SHIDTQKWKPLIYKFREYTSTGDRLGLNFNFQEV"
FT   gene            194863..195903
FT                   /locus_tag="Lebu_0187"
FT   CDS_pept        194863..195903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cts:Ctha_2029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38115"
FT                   /db_xref="GOA:C7NDF3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF3"
FT                   /inference="similar to AA sequence:KEGG:Ctha_2029"
FT                   /protein_id="ACV38115.1"
FT                   /translation="MIKKDIKKILSEILKLKEIKNTKDLPLLASLAMAVPILIGLLSNN
FT                   LKLGITASLAAIMVVYFPLEGSFSERILMLIGCSFGFISVYTIGLIFSFNRIISVIVFG
FT                   ITAGIIHWAVSHFKLKPPKDFFFIMLCSTAISIPHQAIPKIAENIGYLTFGTLSTCLIV
FT                   FLYCLIIGKKSSLNKTMNVPHIPLEIKKNVIESVIFGVFLSIALGAGYYLNLVNPYWVA
FT                   VACIAVMQGNSARHIFLRSIQRVTGTLIGVIFCWGILLLVNNPWEICILIIIFQFIVEY
FT                   LVPRNYGIAMIFITPMTIFLSEASTLFSKNHILFIQGRFFNTLVGSLIGIVGGYIVYHK
FT                   KIRKII"
FT   gene            196210..197913
FT                   /locus_tag="Lebu_0188"
FT   CDS_pept        196210..197913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38116"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF4"
FT                   /inference="similar to AA sequence:KEGG:CKL_2457"
FT                   /protein_id="ACV38116.1"
FT                   /translation="MKNYKELEKLLFSMDGKSYSAYKSLKGEYKFEKYILAIDHVQSDP
FT                   YAPPSKMRVIMDRKICGIPYELTDTKDKNIAVSDFLTRNFYREIQKIGNDSTGTGGSGR
FT                   IFIDRCGQEILERTSVLIKRDKVEVRFEMGMPARGRRIMGKAAQKIIFEQLPEIVEKSI
FT                   IYDNLNKKALNEQVILVLDQEYARKMLKEKGLVAFVANDSVLPRESGVSDRPMKNAVKF
FT                   KSPEKFEITLKLPSGKEISGMGIPKGITLIVGGGYHGKSTLLAALERGVYNHIAQDGRE
FT                   LIISESDAVKIRAEDGRNVEKVNISGFINNLPQNKDTRAFSTENASGSTSQAANVAEAL
FT                   EYGTSLLLIDEDTSATNFMIRDGRMQKLVAKEKEPITPFIDRVKELYDNFGVSTILIVG
FT                   GSGDYFDMANHVIMMDEYVPKDVTEKAKEIAKLDENKREFSSNDKFKGVTQRIPLKKSF
FT                   SQSGKLDKTKAKGKYSILYGKELIDISGLEQLVDDSQTNCIAVMIDYFKNKVLDEKLTL
FT                   SQAADRIYEKIEKEGLDSISSYTGHPGNLALPRKQEFCGAVNRYRKLRIK"
FT   gene            197989..199263
FT                   /locus_tag="Lebu_0189"
FT   CDS_pept        197989..199263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0189"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   cbe:Cbei_3272 putative glucan-binding protein D; BglB-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38117"
FT                   /db_xref="GOA:C7NDF5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF5"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ACV38117.1"
FT                   /translation="MAMRTKVLVFVGLFFVSMLGIASELVFKGGYDFNTYLSLKAKVFD
FT                   YGQNIVSIEIDTKGQGKNIQNKQIAKDTFKVFAKGTLPKDTGIVLDEKTKSLGTFEVER
FT                   EIENIFVNDKGNIVINLKYGKDVAGANTLSYVTGDVSRNVLMDLEYKVEQKKTIKGYKA
FT                   GFYRQGKIVDEEADKFVAAKSKSGVNYQYFKPVNKDDGKKHPLIIWFHGNGEGGYKDYR
FT                   NNVSQKLANRGAVAFAEDKTQKIFGGAYVVAPQADDTWYNNYTKGYIKSVKAMIDEFAS
FT                   ENNVDKNRIYVFGASAGGYMSFRMMIEYPNYFAAFSTSAAALDKAATSGGVATTTQDLM
FT                   KIRNKPLWMVHAQNDPTISYENTSKRVYDVLLKYGAILSSYPNVKIDGTEYNGHWSWIY
FT                   SLRNMPVNDKGEHLFEWMAKQRLKK"
FT   sig_peptide     197989..198057
FT                   /locus_tag="Lebu_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.909 at
FT                   residue 23"
FT   gene            complement(199683..200557)
FT                   /locus_tag="Lebu_0190"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(199683..200243,200243..200557))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Lebu_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spw:SPCG_1982 IS630-Spn1, transposase Orf1"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38118"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38118.1"
FT                   /translation="MAYEKDYRKRILNFYYENGKTKTLFQFNISSSTLYGWIKLKKETG
FT                   DLSSRTRKRKFKVLDPEKLDEYMKNPKNADKYIREIAKDFGCGKETVRVALKKLGYTRK
FT                   KKQTKYREQDEKKVNVYLKKLSEASSGREIIYIDETGFDEYYYREYGWSKRGISIEGKK
FT                   RGLRYSRINLVAGKIGNALIGSMIYKETMESEFFEEWFREILLRDIEKLGKRVLIVMDN
FT                   ARFHRKNILEKIIKGTEHCLLFLPPYSPDLNPIEKLWANMKKKLKDIAHNFNTLEEAVT
FT                   SVLFNKLVQF"
FT   gene            complement(200607..200840)
FT                   /pseudo
FT                   /locus_tag="Lebu_0191"
FT   gene            complement(200968..201282)
FT                   /locus_tag="Lebu_0192"
FT   CDS_pept        complement(200968..201282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38119"
FT                   /db_xref="GOA:C7NDF7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF7"
FT                   /inference="similar to AA sequence:KEGG:TDE0586"
FT                   /protein_id="ACV38119.1"
FT                   /translation="MKIVLNIFSRAFIALYAILTLIAVIAEMKEIGFQSIHLLYFIGAI
FT                   LLISATVTNLPWLVYLSLVLMIPLVIFTGYIVGNLQLSHIIIRILITVLLSLIYGCSVR
FT                   "
FT   gene            complement(201357..202031)
FT                   /locus_tag="Lebu_0193"
FT   CDS_pept        complement(201357..202031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0193"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: tde:TDE0275
FT                   CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38120"
FT                   /db_xref="GOA:C7NDF8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF8"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACV38120.1"
FT                   /translation="MSNRISIGKGVLWVLIWFGFMILYTILDISIWRKIAPEQSRVLNL
FT                   ITVVLCMAIFLNLLITKTNFKLQLFSNISFIGITLALGCSVLFYFLLDKGLDPIFEDLF
FT                   PSSKENYQQIIRLIKISPIVSFLDFCILAPILEEVLMRGFLLDGLSTNYGKIVALLISA
FT                   ALFSILHFNIAQIVPSFICGIILGLLYFYTDSIFSCILAHIGYNSISYMMIMLPIYINH
FT                   LK"
FT   gene            complement(202100..202707)
FT                   /pseudo
FT                   /locus_tag="Lebu_0194"
FT   gene            complement(202739..202962)
FT                   /pseudo
FT                   /locus_tag="Lebu_0195"
FT   gene            complement(203236..203861)
FT                   /pseudo
FT                   /locus_tag="Lebu_0196"
FT   gene            complement(203943..204761)
FT                   /pseudo
FT                   /locus_tag="Lebu_0197"
FT   gene            204757..205410
FT                   /pseudo
FT                   /locus_tag="Lebu_0198"
FT   gene            205513..205674
FT                   /pseudo
FT                   /locus_tag="Lebu_0199"
FT   gene            205806..206515
FT                   /pseudo
FT                   /locus_tag="Lebu_0200"
FT   gene            206673..208067
FT                   /locus_tag="Lebu_0201"
FT   CDS_pept        206673..208067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0201"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-di aminopimelate/D-alanyl-D-alanylligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: fnu:FN1461
FT                   histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38121"
FT                   /db_xref="GOA:C7NDF9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDF9"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACV38121.1"
FT                   /translation="MNKSEVFQNFFNREKISDFKINNVSINSKELNKNDIFVAIRGGNS
FT                   FVNEALEKGAFAVYDSEAVKIDEKYAERAFFVKDSIEFLQKFAREWRKNLDIKVIGITG
FT                   SNGKTTVKDMIYHLLSQKYKGKKTEGNYNNHIGLPFTLLRAEKDDDFIILEMGMSDFGE
FT                   IDLLGQIALPDINVITNIGESHLEFLKTKENVFLAKTEIIPHIKSTLVINGDDKYLKNV
FT                   KAENIEIVRALNLRNNEYEDKTSDFYYGDIHFDESGTNFFLKYFGKMCQSTVERNYKTN
FT                   VLGEHNVLNLVMAIAVAKQFGMEDKIISEAVKNIELTGMRFQIIENGNTTYINDAYNAS
FT                   PMSMKKSLETFSLIFNDKLKIMVLGDMLELGERELEIHRDLFDTIKNTNFDKLYLFGER
FT                   MKSLLEKIKENMDNGNLENESLKNKEFEYFDEKNKIKDRIREISESKAVLLKASRGMKL
FT                   EEIIEK"
FT   gene            208251..209339
FT                   /locus_tag="Lebu_0202"
FT   CDS_pept        208251..209339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0202"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferas
FT                   e"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: fnu:FN1459 phospho-N-acetylmuramoyl-
FT                   pentapeptide-transferase;
FT                   TIGRFAM:phospho-N-acetylmuramoyl-pentapeptide-transf erase;
FT                   PFAM: glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38122"
FT                   /db_xref="GOA:C7NDG0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG0"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACV38122.1"
FT                   /translation="MLYLLQELFINNWKVLRIFKSIMLRASVAFMIAFLFMLVFGKPFI
FT                   VWLKKKKYGDTAREEGPKSHFDKSGTPTMGGLLIIGAILFATAIAGNFTNKFVVFLFVI
FT                   TILFTTIGFYDDYLKLTKHKNGLSGKKKILGQMIITALTFWFVYKFGLVNKTIDFSIIN
FT                   PLIKNSYLYITPILFFVFIAFVIIGSSNAVNLTDGLDGLVSGPIIVVSITLLIITYLTG
FT                   HHNYARYLNLYHIPEVSEITVYLASIIGALIGFLWYNFYPAQMFMGDTGSLTLGGILGI
FT                   IVIFIKQELLLPIAGFVFIMEALSVMIQVWHFKTFGKRVFKMAPIHHHFELLGLPETKV
FT                   TIRFWIVSIMTCLLTFVILKLR"
FT   sig_peptide     208251..208376
FT                   /locus_tag="Lebu_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.893 at
FT                   residue 42"
FT   gene            209467..210846
FT                   /locus_tag="Lebu_0203"
FT   CDS_pept        209467..210846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0203"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: fnu:FN1458
FT                   UDP-N-acetylmuramoylalanine--D- glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38123"
FT                   /db_xref="GOA:C7NDG1"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG1"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACV38123.1"
FT                   /translation="MDKAIVFGAGLSGLGAKELLEKKGYETYLIDDKVAMPSTEGIKLL
FT                   NEEKIEFIVKSPGIPWKAELLKVAKEKNVKVISEIDLAYKYVDKNVKIISFTGTNGKTT
FT                   TSTKMAELLNFSGFRAKLAGNAGFSFAKLVADEEKLDYIVLELSSYQLENNPQIHSNIA
FT                   GIINLTPDHLTRYNSVEDYYITKFNIFDKQVESDFALINLDDKEFEKLYERNEIKEKIK
FT                   SKKIYLSTETKGTIFVYKNDICIMKDFKKRIDEIENFDENVDKVSEILMKTDELSLKGK
FT                   HNLENMLFLIGSAKILNISNEKISEFLKSTVALEHRLENFFIKGNTIFINDSKGTNVES
FT                   TLKAIDSFDNSIIMILGGDDKKIDNMPLIERIKEKADFVYLIGDNAQILIDDMEKIGYK
FT                   NYKNLETVENVLNYLKENIDFSKNQTVLFSPATSSFCQFKSFEHRGKVFKELTKKIIGN
FT                   F"
FT   gene            210874..212040
FT                   /locus_tag="Lebu_0204"
FT   CDS_pept        210874..212040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0204"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: ckl:CKL_1187
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38124"
FT                   /db_xref="GOA:C7NDG2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACV38124.1"
FT                   /translation="MKRKKWLGTFFIIVVLILSALSLITMASLSFPQAQKEFGKSHSYL
FT                   ARQALWLLIGGMGFVFTANLNYKKYKDIIKYFYILGAFTLVMVLLIGRTSKGATRWISI
FT                   GGFAFQPSEFVKIILIITLATFVYNLKYATKRDKVKTLPWLSSISILGLTGIYAGLIIA
FT                   EKSFSNTAQIVIIGLTYLLISEVKFSIIGIFVPIIGILGWLGIVGTGYRASRLASYVGD
FT                   DLGYHTTNSLIAIGSGGFSGRFYGNGLQKYGFLPEIHTDYIFSGYAEENGFIGALFLLG
FT                   LYISLLVIIAITLRKIKNVYAKYILVGIFIMFATQVIGNVAVVSNVIPSTGIPLPMMSY
FT                   GGSTTIVMMSTLGIVYNIIRALYKQEMGENLDEMNEIDYELINQRKRR"
FT   sig_peptide     210874..210966
FT                   /locus_tag="Lebu_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.446 at
FT                   residue 31"
FT   gene            212091..213140
FT                   /locus_tag="Lebu_0205"
FT   CDS_pept        212091..213140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0205"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptidebeta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain; KEGG: fnu:FN1457
FT                   UDP-N-acetylglucosamine-N- acetylmuramyl-pentapeptide
FT                   pyrophosphoryl-undecaprenol N- acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38125"
FT                   /db_xref="GOA:C7NDG3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG3"
FT                   /inference="protein motif:PRIAM:2.4.1.227"
FT                   /protein_id="ACV38125.1"
FT                   /translation="MEKVVFTTGGTGGHIYPALSIAKKIREKNIDTLFIGTKHRMEKDI
FT                   VPRENFRFIGLDVLPLRSLKSIFKMIAATISTIKLLKKEKPTKIIAFGNYITIPVLVAA
FT                   NVLKIPYYLQEQNHTMGQANKWFYKGAKKVFIAFGNTLDRIKDKYKNKFVVTGNPLREE
FT                   FYGKERKEERRKLNIKDDEKVLLVIGGSLGAKNINEAILKKWKTISEDKRIRLFWATGK
FT                   DNYEASTCKIRDFGTAVVEPYFENVPELMTAADIVICRAGASTISELIQLEKPSILIPY
FT                   DFVGQKENADVLEYVNGAKIFTNETVEKAIDEALSIVRQASMLEFMSENVKSLKKGNSA
FT                   EIIVSEMGL"
FT   gene            213176..214525
FT                   /locus_tag="Lebu_0206"
FT   CDS_pept        213176..214525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0206"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: fnu:FN1456
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38126"
FT                   /db_xref="GOA:C7NDG4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG4"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACV38126.1"
FT                   /translation="MLTKINNIYFSGINGIGMSGLAKILASDGFNVAGSDLERKPVTKD
FT                   MEDMGIKVYIGQVEENVKDKGIDLFVYSTAIKETNPEYKYIVDNNIKKIKRGELLAEIM
FT                   NRFDGIAVAGTHGKTTTSSMMSVALLEKEPFIVVGGIIPEIQSNSQIGNSEYFIAEADE
FT                   SDNSFLYIKPKYSVVTNIEADHLDHHGTFENIKKSFEQFIDSTERIAVLCKDTVEKVGL
FT                   DIKNKNVVWYSLKDETADIYAKNIRVENGITSYEVVKNGEELGTFSLSVPGNHNVSNSL
FT                   PVIYFAHEFNCNMKKVKERILKFKGANRRYQVIYDNNLRIIDDYAHHPTEVKVTINAAH
FT                   NTEKGKVTVIFQPHRYSRTKFFFDDFVKSLKEADDLILLPIYAASEDNTYGVSSESLAE
FT                   KIGGNVRVQTQEEIKNIIKNDKNSKNTYVFMGAGSVSKIAHEIANDLKEM"
FT   gene            214577..215446
FT                   /locus_tag="Lebu_0207"
FT   CDS_pept        214577..215446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0207"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: fnu:FN1455 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38127"
FT                   /db_xref="GOA:C7NDG5"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG5"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACV38127.1"
FT                   /translation="MEIIKNAKMKEYSNMKVGGTAKELIFIDDKNELKEILRTRNNIFL
FT                   LGNGTNTLINDGNLDISFLSLKRLKKITVEEKIENTKKEDSYDLVRVEAGLDLDDLIDF
FT                   MEKNDYSGLENITGIPGSVGGLVNMNGGAYGTEIFDCIEEVEVCKNDGEIVKIKTTDLN
FT                   FKYRTTEIKENKWIVISALFKFGFGFDKEASQDKKNQREVKHPLDLPNLGSTFKNPEGT
FT                   FAAKLISDADLKGYRVGDVVVSPKHPNFVTNVGNATFNDVISVIEHVKEVVFEKFGVKL
FT                   ETEIIILK"
FT   gene            215530..216195
FT                   /locus_tag="Lebu_0208"
FT   CDS_pept        215530..216195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0208"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein FtsQ-type; KEGG: fnu:FN1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38128"
FT                   /db_xref="GOA:C7NDG6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG6"
FT                   /inference="protein motif:PFAM:PF08478"
FT                   /protein_id="ACV38128.1"
FT                   /translation="MKRSIKALIALFLLAGAMFFGKRFIDTDYFKVQDVFIDGVPKLLK
FT                   QDIAAQLEQMKGKNIVYINTNKIENFIKNDIRVKKVSIKKLFPSKIEVVLEEREPYVYV
FT                   KKGEETLLADKDLNIYGDILEDPSRNIPVIDYTSDESLNGIKTILSKIKNKDFYAMISE
FT                   IRQSEKNYEILLTNNVKIITDTLVTEKKYNDAYKLYEKIKKEKAITYMDLRFTDIVVK"
FT   gene            216273..217406
FT                   /locus_tag="Lebu_0209"
FT   CDS_pept        216273..217406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0209"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   fnu:FN1451 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38129"
FT                   /db_xref="GOA:C7NDG7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG7"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACV38129.1"
FT                   /translation="MDNFSNTAKLKVVGVGGAGGNAINDMIESNITSVDFIAINTDQQD
FT                   LDRSQAPVKVLLGRGMGAGADPEKGRIAAKESEEKIKEVLEGTDMLFITAGMGGGTGTG
FT                   ASPIIAEVAKAMGILTVAIVTKPFSFEGPLKKNNAATGINNLRENVDTLIAIPNDRLFE
FT                   IPGMNISLMNAFKEANGVLKMGIKGISDLITKQGIVNLDFADIKSIMQNSGIAMLGFGE
FT                   ANGDEKAKSATAQALNSPLLEKSIEGARKILINVTAGPDIGLQEIQEVAETIAEKAGND
FT                   KANLIWGYIMEPELEGTISVSLVATDFQEELLARSENIDSRAIRFAPPKKEEVEVEKKT
FT                   EEKKEVKHQIEEEDHDTEERSDESSISDFVLPPFFEE"
FT   gene            217606..217890
FT                   /locus_tag="Lebu_0210"
FT   CDS_pept        217606..217890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0210"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: fnu:FN1657 SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38130"
FT                   /db_xref="GOA:C7NDG8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG8"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACV38130.1"
FT                   /translation="MRNYEIMFILSTQLTDEEKQAGVAFVEKILTAAGATEVKTEIWGD
FT                   RKLAYPIKKKENGYYVLTTFQADGTKFNEIETKLNINESILKYMIVKND"
FT   gene            217961..218392
FT                   /locus_tag="Lebu_0211"
FT   CDS_pept        217961..218392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0211"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: fnu:FN1304 single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38131"
FT                   /db_xref="GOA:C7NDG9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDG9"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACV38131.1"
FT                   /translation="MNVVILMGRMTRDPELKYTSGGKAFANFSLAVQKTKDEVEFIDCT
FT                   AWEKTAETIAEYFRKGNRILIQGRLSVSNYEQNGEKRKSTKVVVNSFEFVESSGTSGNN
FT                   GGYQQQQSFSNNTKKPVSVQNDTYEDDNDDMDDDEEFPF"
FT   gene            218488..218727
FT                   /locus_tag="Lebu_0212"
FT   CDS_pept        218488..218727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0212"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: fnu:FN1656 SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38132"
FT                   /db_xref="GOA:C7NDH0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH0"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACV38132.1"
FT                   /translation="MRAKPVTEFKRRKRRPKVKFKVEDINYKNVELLKNFMNDKGKISP
FT                   ARVTGLEAKIQRKIAKAIKRARQIALMPYTKIEK"
FT   gene            218877..219275
FT                   /locus_tag="Lebu_0213"
FT   CDS_pept        218877..219275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0213"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ctc:CTC00621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38133"
FT                   /db_xref="GOA:C7NDH1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH1"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV38133.1"
FT                   /translation="MSYNSNYHSVFDINYHMIFCIKYRREVINDEISNRLKEIFEKICP
FT                   KYNIVLKEWEHDVDHIHMLINAMPNTELSKFVNTYKSASSRLIKKEFPEIRRRLWKEYF
FT                   WSRSYLVVSVGGAPLEIIKKYIQNQKEV"
FT   gene            219280..220377
FT                   /locus_tag="Lebu_0214"
FT   CDS_pept        219280..220377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0214"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: afl:Aflv_2013 transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38134"
FT                   /db_xref="GOA:C7NDH2"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH2"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV38134.1"
FT                   /translation="MKYNLAFKYRIYPNKEQELLINKTFGCVRFVYNTILYTANKIYEE
FT                   TGKNKIITPTSLKSENQFLKEVDSLALSNAQLNVKRSFTNFFQKRAKFPRFKSKKTSVK
FT                   SYTTNCVNNSIRIEENKYLVLPKLKKVKLKYHREIPKDYKIKSVTLTNSNGNYYVSVLT
FT                   EFEKEIQKMPSNDKVIGLDFSMSELFVSSENQRADYPKYFRMLEEKLKKLQKSLSRKVK
FT                   FSKNWYKQKAKISKLHEYIKNCRRDFLHKLSKKLSKEHNAVIVEDLNMKGMSQALNFGK
FT                   SVGDNGWGMFLRMLEYKLMFLGKQFLKIDKWFPSSKTCSKCGNVKEELKLSERSYKCEC
FT                   CGIEIDRDYNAALNIKNIGKEMLKY"
FT   gene            220622..221284
FT                   /locus_tag="Lebu_0215"
FT   CDS_pept        220622..221284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38135"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38135.1"
FT                   /translation="MLNKKMIIFFLSFFLFVVSCNKKENESKKKNSENLQNKTTQENIF
FT                   SNNSIEKIIETFSKKSKENRVSIGNFEKLAYENKNYYYARINSKSDAIYALDYSGISAT
FT                   SIFLKVGKVDGANLGIIENMVVNLIQVSDENIKDSEARVIYAKILSNLGEKELSGLLTY
FT                   TNKITYGVRIDPLTSEFIFFAKESENESNVTSIQQFKVSKDKKENLEILANLKKNKK"
FT   sig_peptide     220622..220690
FT                   /locus_tag="Lebu_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.768 at
FT                   residue 23"
FT   gene            221306..221884
FT                   /locus_tag="Lebu_0216"
FT   CDS_pept        221306..221884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sml:Smlt1384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38136"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH4"
FT                   /inference="similar to AA sequence:KEGG:Smlt1384"
FT                   /protein_id="ACV38136.1"
FT                   /translation="MNLEALFGLLQGQDLGKLTEQIGGSSTQVKNGVSAALPAILAAVN
FT                   KNANNSEKAEGLNNALNQHDGSVLNNLGSYLQNPDLKDGAGILGHLFGNNTQNVANAVS
FT                   QSSGLDTQGSMKILETLAPLVLGALGQQKKENNLDAQGIGNLTSNLASNFTGAGGIIST
FT                   VTNMLDANKDGNVVDDVMGLVGKFLGGKK"
FT   gene            222114..222473
FT                   /locus_tag="Lebu_0217"
FT   CDS_pept        222114..222473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0217"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: oca:OCAR_4903 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38137"
FT                   /db_xref="GOA:C7NDH5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH5"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ACV38137.1"
FT                   /translation="MKFLIIGLGGGIGAILRYLISVVPLKVSFPVQTFVTNILGAILIG
FT                   VVVEMVAGKEISENWNLFLKVGICGGFTTFSTFSLETYNLIEKGNTGIALGYAILSVVL
FT                   SVIGVFVGRGIVKMI"
FT   gene            222489..223748
FT                   /locus_tag="Lebu_0218"
FT   CDS_pept        222489..223748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0218"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pmo:Pmob_1458 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38138"
FT                   /db_xref="GOA:C7NDH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV38138.1"
FT                   /translation="MNREHSIENTKKYAILEVMFFNGYSVGMQSFVLLSLAIYFNMSSF
FT                   FISIVSSLPTAGYLLQIFTKRVNILLGSRKKTMVIAATVSRLVICVMPFAVFFDIRRQE
FT                   VYFAVMFIYALVSPFSNNVWTAVMTKIVDKKERGKYFGKRNLFSSLSTVVYTLFYGYVL
FT                   SMPDRKNAMLILTIAMSLSAIGSAIFMCLHYVPDSESDMKKVSIKTAFKNKNFVIYLKF
FT                   ASVWLFTWEFLKPMTEYYRIKVLGVNTMFISQMGVLTAILSSILYLVYGKLSDKYGNKT
FT                   MLRMGIFFTTYYVLTYFSMTQDNKMSMLFAAAVIDAIGFTAITLSLLNLMMEVSGEPAD
FT                   AYVGAYAMVSGLSAILAGLFGGILGKFINNGVIYIFGEQFYTIRFAFVIGFILRLFSLL
FT                   ELTRVYSFEKHLCILAEAVE"
FT   gene            223754..223894
FT                   /locus_tag="Lebu_0219"
FT   CDS_pept        223754..223894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38139"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38139.1"
FT                   /translation="MFSKIMFSGSRYVIHSNKGKNEDSNEQNVDKEKNVDDKLDETKEY
FT                   N"
FT   gene            224073..225044
FT                   /locus_tag="Lebu_0220"
FT   CDS_pept        224073..225044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmz:MmarC7_0586 SMC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38140"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38140.1"
FT                   /translation="MKKILEKIGKDELLEYSRLGDRFSVGNYIGNSNNFHIFTSINPYG
FT                   KYEGYKFLKDEELKKLGRKKWYLELMKENIKERLFKEGKTVILRKDNFFEHLFEYFIKN
FT                   KIRLQISYDRDWNNNGYLIKNSDEFFWFHFCDEEDENEEEIIRKYGVKIIRAGKNVIKD
FT                   IIVENSEIKKNKLIKVYDLDDVLGDIIFQDDNHILINEKDLFFGDYKFTILKMSDIEEI
FT                   NDRMNLIETKDINLEEIFPNIVKMKIEEVLKKCFENKILVHFEHEKSYSEKFGIIERFD
FT                   NEKIILKEIDKMTGIFIAKSEIIIEDISFLFVRNCKVLGIER"
FT   gene            complement(225115..225273)
FT                   /locus_tag="Lebu_0221"
FT   CDS_pept        complement(225115..225273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38141"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38141.1"
FT                   /translation="MKKFIFLAMILMLASSCGVIQRANMRRAIKNSGGSCEYVSGVGEI
FT                   CAVPIRQ"
FT   sig_peptide     complement(225202..225273)
FT                   /locus_tag="Lebu_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.310 at
FT                   residue 24"
FT   gene            225490..227424
FT                   /locus_tag="Lebu_0222"
FT   CDS_pept        225490..227424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fnu:FN2102 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38142"
FT                   /db_xref="GOA:C7NDI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38142.1"
FT                   /translation="MSLVQFNKVYKQFAGEYILRDVNFTIEEKDKIGLVGVNGAGKSTI
FT                   IRMLLGEERIDGNENNLNEFGEIVKSGATKIGYLSQNTEFSDEKNTIYEEMMTIFEEER
FT                   KIWDEIQKVNMLLGTANEDEMEKLINKSAELSSIYEAKNGYEIEYKIKQVLTGLELTGE
FT                   YENLLLQDLSGGERTRVSLAKLLLSEPDLLILDEPTNHLDLISIEWLEDYLKKYNKAFL
FT                   LVSHDRIFLDNVCTKIFELENKKLHKYDGNFSSFILQKEMILKGEIKRYEKEQEKIKKM
FT                   EEYIDRFRAGIKARQAKGRQKILDRIERMEDPVFNPQRMRLKFEPAKMSGENVLKVRNL
FT                   SKSFDGKKVLNNINFELFRGERVGIIGKNGIGKSTLLKILLDKLPKDTGEIEFGTRLKI
FT                   GYYDQNHQEFSQENTILQEINNSLDLTEEYLRTLAGGFLFSGDDVQKKISMLSGGERVR
FT                   VAFLKLYMEKANFLILDEPTNHLDVYSIEVLEDALEDFDGTMLVVSHNRHFLDTVCNTI
FT                   YCLDENGLTKFKGNYEDYKESLKTAKSASQGTDIEMKEEKKLSYQEQKEQSRKIAKLKR
FT                   DIEKLEKEMEKITEMRENLNAEYEKAGKENNMEKLMEVQEKLDRLEEEELEKMEEWDVK
FT                   SGELDKMEL"
FT   gene            227683..227814
FT                   /locus_tag="Lebu_0223"
FT   CDS_pept        227683..227814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38143"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38143.1"
FT                   /translation="MGAVVVWQCMACGREIRSSIRPNGKAGGKCPDTSTGNHIWQQG"
FT   gene            227896..228516
FT                   /locus_tag="Lebu_0224"
FT   CDS_pept        227896..228516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0224"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; Sel1 domain
FT                   protein repeat-containing protein; SMART: Tetratricopeptide
FT                   domain protein; Sel1 domain protein repeat-containing
FT                   protein; KEGG: cts:Ctha_0439 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38144"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI2"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACV38144.1"
FT                   /translation="MYKEYKEKGYKELENLVLKNDYYAINELGERKFQEGNYKEALEYF
FT                   EKASKLGSDMAINNIGFYFLEIENNFEEAEKYFNKAIEKENIIAINNLGVLNINKNNYE
FT                   EAKKYFLLAIDKKCSFAYNNLGGLYENVYQKYEEAEKLYQRCFEETEDTDCLINLAYLY
FT                   LNYYENKNGAIKYLKLAINKGNKGAEHILFHVLNDEVCSCNND"
FT   gene            228763..229386
FT                   /locus_tag="Lebu_0225"
FT   CDS_pept        228763..229386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0225"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: fma:FMG_0194 putative cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38145"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI3"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACV38145.1"
FT                   /translation="MANNKYSWGNESDKILKRLVSQDEEEFLSKKRVKELFEDGILKNI
FT                   QVGTFEGLKEIHRYLFQECYGTAGKIRKHDIRKGDTVFCRAMYLEDNLKTVSKMPENTF
FT                   EEIIEKYVEMNIMHPFYEGNGRTTRIWLDQMLIKRLGMCVNWQNISRNDYLSAMKRSMV
FT                   NDLELKMLLKENLTEDVESRDMFMNGINQSYEYENMRKYDVINI"
FT   gene            229429..230556
FT                   /locus_tag="Lebu_0226"
FT   CDS_pept        229429..230556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38146"
FT                   /db_xref="InterPro:IPR027375"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38146.1"
FT                   /translation="MKKRLLKILMLLFLIGNLTFSEYVEKDGKVFYNGKEVWVEDMKSF
FT                   RILNDKIAADSQNVYFRGYRTISPYGRNSKDFIGVFSKERKEEQKEIKYDVKKIELIPS
FT                   REKDRYFYFFKYNKKIYAVYGLGGESFFGIQDVDYETFKEVSGSFVKDKNKVYFVRLSG
FT                   GFCSYSGDYCQSFFLGMPEIKGIVPKNFKVIIDNSDYDKIFVENDGKLYFMKSNPYSEE
FT                   DFKLEELKQVDVKTFKPLEYKLIKDKNNIYFFKDNKFIKFEKADANTFEVIGNGYARDK
FT                   SNIYFLYPNLEYMMPIKMEADRKSFNLIKVGEDYTSYAKDRKNIYCEGRILEGADYKTF
FT                   RIFKEKDENREEIVKIKDKNHEYDENCQIKDKNKF"
FT   sig_peptide     229429..229509
FT                   /locus_tag="Lebu_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.397 at
FT                   residue 27"
FT   gene            230676..231074
FT                   /locus_tag="Lebu_0227"
FT   CDS_pept        230676..231074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: KRT9; keratin 9 ; K07604 type I keratin,
FT                   acidic"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38147"
FT                   /db_xref="GOA:C7NDI5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38147.1"
FT                   /translation="MEKLVRRGGGGHSHGGGHSHSHGSGGSHHYSGGHYGGEHSSREHS
FT                   SGHSDGEGTGKSKKSSDDEQENSTSFWGSHGSHSRSSRRRNCESIVDTKERQACIDSNN
FT                   NANNLEVFFIFCAVIVFIFLKIKDFGRK"
FT   gene            231236..232672
FT                   /locus_tag="Lebu_0228"
FT   CDS_pept        231236..232672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0228"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Tetratricopeptide domain protein; Sel1 domain
FT                   protein repeat-containing protein; KEGG: aas:Aasi_0854
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38148"
FT                   /db_xref="GOA:C7NDI6"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI6"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACV38148.1"
FT                   /translation="MEIVISIIIGITIVFIMINFINRKKMDEFDDFSGKKENKENKEET
FT                   DNVDRFGHKITSIDDIVEVDYSQNYEGNDKERDRKYRHIIFFAYENIISGNYRMAREEL
FT                   EMAAGLKARGNYELGKFYYYCKSDNQNAVNMFRFAYNDGINEAVYYLGKIEEESGNIEL
FT                   AIDWYNEGAKKGDINSITRLGKIAEEKNDYKKAEEFYLKAADTKDAGGIYNLVNLYFKQ
FT                   NMREKVIEWHKKLMNEKQITGLTFEIIKNIEFMLGSEKDKKYVELINQGNEFLEKRDYE
FT                   NARKLFTEAINYNERGYLELAKSYYAEGKGEKTKEVFERAYEMGVKEAAYKLGQYMDVV
FT                   EGNEKESEKWYKIGKEMGDARAIYQLAMLYETSREFGKSEEEAYGIFEISANMKYAPAI
FT                   MDMAFYSDRAENKNKVKEWTSKLLNETGLIELGKNMIGDAQNLLEEMGEKIEDKISEKD
FT                   YEIEYDEDLIYFIKKFKSWN"
FT   gene            complement(232778..233317)
FT                   /locus_tag="Lebu_0229"
FT   CDS_pept        complement(232778..233317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0229"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: cbl:CLK_3538
FT                   PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38149"
FT                   /db_xref="GOA:C7NDI7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACV38149.1"
FT                   /translation="MLNFIQNIDIFIIKLFYNFQHSLNSKLLNSIMIFFTNLGNHGLIW
FT                   IAVTLFLLSIKKYRKIGYLAAISLIINAIIVNVILKNFTHRARPFEEISDIILLIKAPK
FT                   DFSFPSGHTSASFTMVYVFYKHLKKYFPVVLITSIIIAFSRLYLTVHFPTDVLAGLLIG
FT                   LFSGFWGEKILNRKNN"
FT   gene            233561..234013
FT                   /locus_tag="Lebu_0230"
FT   CDS_pept        233561..234013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0230"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   spl:Spea_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38150"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI8"
FT                   /inference="protein motif:PFAM:PF03891"
FT                   /protein_id="ACV38150.1"
FT                   /translation="MKNLKISVSIFMIATSIVGMAAAKKSVRKDTAKKGTTKSPVVGMA
FT                   NPASTYCVQKGGESIIVKGKDGEYGVCKLKDGTAVEEWEYYRQNNPDSTSKNEPVIGMP
FT                   NPASVFCEKHGGKSINVKDKDGNEVGKCQFKDGTKVDEWHYYRENN"
FT   sig_peptide     233561..233632
FT                   /locus_tag="Lebu_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.563 at
FT                   residue 24"
FT   gene            complement(234129..235598)
FT                   /locus_tag="Lebu_0231"
FT   CDS_pept        complement(234129..235598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0231"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   fnu:FN0221 carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38151"
FT                   /db_xref="GOA:C7NDI9"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDI9"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ACV38151.1"
FT                   /translation="MISFVLAIVALILGYAFYSKFVEKVFGIEPDRTPPSIEYYDGVDY
FT                   VQVSTPKAFLIQFLNIAGTGPIFGAIAGALWGPAAFLWIVFGCIFGGAVHDFLIGMLSL
FT                   RNKGSSIGELVGQNLGVVMQQIMRVFSIVLLLLVGVVFIKSPADILHNLIPGVSAMTFT
FT                   IIIIAYYILATILPLDKIIAKIYPIFGFALLFMAIGIGTMLIYGQFTGAFAIPEVTEIF
FT                   KGNPHPKGTSMFPYLFISIACGAVSGFHATQSPMVARCLKNETEGRKVFYGAMIAEGVV
FT                   ALVWAAAAMTVFGGIKELAAAGTPAVVVNKASVQLLGVFGAFLAVLGVVACPITSGDTA
FT                   FRGSRLIIADIFKIKQSPIKNRFLIAIPLFIVGIYLTTIDFNIIWRYFAWANQTLAAVS
FT                   LWTATVWLVKKGKPFVFALIPSMFMTMVVTTYIVIAPEGFVRFFKNVPVHTIEFYGILI
FT                   ASIVTIICTALLFNYKHHLHSHSTENLKVAK"
FT   gene            235867..236577
FT                   /locus_tag="Lebu_0232"
FT   CDS_pept        235867..236577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0232"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; SMART: cell
FT                   wall hydrolase/autolysin; KEGG: cdf:CD0784 putative
FT                   N-acetylmuramoyl-L- alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38152"
FT                   /db_xref="GOA:C7NDJ0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ0"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ACV38152.1"
FT                   /translation="MTKGIKKMLYLVTAGLVMAAPLNAAGNNELICIDPGHQVRGNSGL
FT                   EEVAPGSSTKKPKVSSGTRGVATKKYEYQLTLEVGLKLRDALQNKGYKVFMVRETNDVD
FT                   ISNKERAIKTNNAGCSLYIRLHADGVDNSSVNGATVLTSSAKNRYTQSVQKSSDKFSRT
FT                   LLSEYIKATGAKNRGVSYRDDLTGTNWSKVTNTLIELGFMSNPAEDRKMSTPEYQAKMV
FT                   NGMVNGIEKYLREK"
FT   sig_peptide     235867..235941
FT                   /locus_tag="Lebu_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 25"
FT   gene            236696..238159
FT                   /locus_tag="Lebu_0233"
FT   CDS_pept        236696..238159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0233"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: mmq:MmarC5_0620
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38153"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ1"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ACV38153.1"
FT                   /translation="MLIEEISNGENEKIEFKENAKTNTYIKTVVAFANGNGGKIVFGVK
FT                   DNGEIIGVENEFEVMDGIINAISDSCYPMIIPDISLHTLENRTIILVEIEGGKKKPYYL
FT                   KSKGMQKGTYIRSGATTRIIEEDYVLKELVLEGENKYFDQQVCHEESISDEEIEKFCEW
FT                   LEKLARKNSETDTKIKKVTRNTLLSWKVLEEKNGEIFPTNAYILLSGKENWEVSRKIQC
FT                   GVFKGETRSIFVDKREFEGSIITQLEKAYKYVLEKINLSSDIVGIYRVDKYEIPPKSIR
FT                   ELIANAIIHRSYLEPNDIQVALYDNRLEITSPGMLLSGVNVKRMKEGYSKLRNRAIASV
FT                   FAYINIIEKWGSGIPRIMNELAEYGLEEPEFITFENDFRINIYRKSYNTIQTTQGSTQD
FT                   KTNTTQTVSQKEKSNIKNLTETDKTIINTIINNPKMSQKQIADNLNWTVNKVKYYMKKF
FT                   KQKNILRYEGTSQNGKWEIQEERLKYFLK"
FT   gene            238516..238884
FT                   /locus_tag="Lebu_0234"
FT   CDS_pept        238516..238884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0234"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: fnu:FN1558 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38154"
FT                   /db_xref="GOA:C7NDJ2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ2"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACV38154.1"
FT                   /translation="MPTINQLVRFGRSTTEKKKKSPALKGNPQKRGVCVRVYTTTPKKP
FT                   NSALRKVARVKLVNGIEVTAYIPGIGHNLQEHSIVLLRGGRTKDLPGVRYKIIRGALDT
FT                   AGVVNRKQGRSRYGAKKG"
FT   gene            238917..239387
FT                   /locus_tag="Lebu_0235"
FT   CDS_pept        238917..239387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0235"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: fnu:FN1557 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38155"
FT                   /db_xref="GOA:C7NDJ3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ3"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACV38155.1"
FT                   /translation="MSRRRRAERRDVLPDSQFNDKVVTKFINGLMKDGKKSLAEHIFYS
FT                   ALQQITEETQEEGIEVFRRAMENVRPQLEVRSRRIGGATYQVPVEVRKERQQTLAIRWL
FT                   VRYTRERKEYGMVNKLKKELIAAANNEGGSIKKKEDTYKMAEANRAFAHYKW"
FT   gene            239544..241628
FT                   /locus_tag="Lebu_0236"
FT   CDS_pept        239544..241628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0236"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: fnu:FN1556 protein translation elongation factor G
FT                   (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38156"
FT                   /db_xref="GOA:C7NDJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ4"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACV38156.1"
FT                   /translation="MARKVALKDTRNIGIMAHIDAGKTTTTERILFYTGVNHKIGEVHE
FT                   GAATMDYMEQEQERGITITSAATTAFWNGHRINIIDTPGHVDFTVEVERSLRVLDGSVA
FT                   VFSAVDGVQPQSETVWRQADKYNVPRMAFLNKMDRVGADFNMCVNDIKEKLGGNGVPIQ
FT                   LPIGAEDNFEGIIDLVTMKEYLFKDETMGADYEVVDIRAELLDDAQAAREHMIESVVET
FT                   DEELMEKYFGGEEITEEEIKKALRAATIEGTVVPVLCGTAFKNKGIQPLLDAVVAYMPS
FT                   PLDINGGKINGTDPKTEEPIQREMGDDAPFSALAFKIITDPFVGRLSFFRVYSGVLEKG
FT                   SYVLNSTKGKKERMGRLLQMHANKREELDVVYSGDIAAAVGLKDTTTGDTLCAENAPII
FT                   LEKMEFPDTVIQIAVEPKTKADQEKMGTALAKLAEEDPTFKVSTNQETGQTLISGMGEL
FT                   HLEIIVDRMKREFKVEANVGKPQVAYRETINGATDVEEKYAKQSGGRGQYGHVKMKVEA
FT                   NHGKGYEFVNQITGGAIPREYIPAVDKGIQEALEAGVVAGYPVQDIKVTLYDGSYHEVD
FT                   SSEMAFKIAGSMAVKKGLRAANPVLLEPIFKVEVTTPEEYMGDVIGDLNSRRGQVSGMT
FT                   DRNNAKIINAEVPLSQMFGYATDLRSKTQGRASYSMEFEKYVEVPKNIAQQVIDERQGK
FT                   "
FT   gene            241703..242887
FT                   /locus_tag="Lebu_0237"
FT   CDS_pept        241703..242887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0237"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: fnu:FN1555 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38157"
FT                   /db_xref="GOA:C7NDJ5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ5"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACV38157.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAISKVLSDKGLAEKV
FT                   DFENIDQAPEERERGITINTAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVFLNKVDMVDDDELLELVEMEVRELLNEYDF
FT                   PGDDVPIIAGSALGALNGEAKWVEKIMELMDAVDEYIPTPERPVDQPFLMPIEDVFTIT
FT                   GRGTVVTGRVERGVIKVGEEVEIVGIKPTSRTTVTGVEMFRKLLDSGQAGDNIGALLRG
FT                   TKKEEVERGQVLAKPGTINPHTGFKSEVYVLTKDEGGRHTPFFTGYKPQFYFRTTDITG
FT                   EVNLPEGVEMVMPGDNIEMTVELIHPIAMEEGLRFAIREGGRTVASGVVATITK"
FT   gene            243066..243371
FT                   /locus_tag="Lebu_0238"
FT   CDS_pept        243066..243371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0238"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: fnu:FN1646 SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38158"
FT                   /db_xref="GOA:C7NDJ6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ6"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACV38158.1"
FT                   /translation="MDKIRIYLQSYDHKLLDQSAKKIAEVAKKNGSELAGPLPLPTKTK
FT                   KYTVLRSVHVNKDSREQFEMRIHRRFVEIKNSNQQIVNALASLNLPSGVGVEIKQS"
FT   gene            243438..244064
FT                   /locus_tag="Lebu_0239"
FT   CDS_pept        243438..244064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0239"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: fnu:FN1645 50S
FT                   ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38159"
FT                   /db_xref="GOA:C7NDJ7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ7"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ACV38159.1"
FT                   /translation="MILGKKIGMTQIFEDEKLIPVTVIEAGTNFITQIKTEEKEGYNAI
FT                   TLAYGDKREKNTTKPELGIFKKAGVTPKRFLKEFKVANPADFALGQEIKVDVLEGIEFV
FT                   DISGTSKGKGTAGVMKRHNFGGNRASHGVSRNHRLGGSNAGGAASNSNVPKGKKMAGRL
FT                   GAEKVTVQNLQVIKFDVENSLLLVKGAVPGPKNGYLVIKKSVKKY"
FT   gene            244086..244730
FT                   /locus_tag="Lebu_0240"
FT   CDS_pept        244086..244730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0240"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: fnu:FN1644 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38160"
FT                   /db_xref="GOA:C7NDJ8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ8"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACV38160.1"
FT                   /translation="MPVLNIYKLDGSQAGTIEVNNDVFGIEPNKHVMHEVLVAELAEAR
FT                   QGSASTKTRAEVRGGGRKPFRQKGTGRARQGSTRAPHMVGGGVVHGPKPRNYAKKVNKK
FT                   VRKLALKSALATKISEGNVIVLDDFALEIPKTKTFIDFAKALNFDGAKQLYVTNDDTDN
FT                   IDRDYFLYLSTRNIEKVAAINTRDLSIYWLIKQDKVILTKEALATIEEVLA"
FT   gene            244730..245014
FT                   /locus_tag="Lebu_0241"
FT   CDS_pept        244730..245014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0241"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pth:PTH_0322
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38161"
FT                   /db_xref="GOA:C7NDJ9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDJ9"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACV38161.1"
FT                   /translation="MHITDIIKKPVINTEKARNLLENNEYVFIVDRRANKLQIKDAVEK
FT                   LFNVKVQGVNTLNIKSKNKRFRMSMYKTAAIKKAIVKLKDGESIAAYEG"
FT   gene            245225..246052
FT                   /locus_tag="Lebu_0242"
FT   CDS_pept        245225..246052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0242"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: fnu:FN1642 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38162"
FT                   /db_xref="GOA:C7NDK0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK0"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACV38162.1"
FT                   /translation="MPIKKLKPITSGTRHMSILVNKDLDKVRPEKSLVEPLNSSYGIDN
FT                   YGHRTGRNRHKGHKRLYRVIDWKRNKIGVPAKVATLEYDPNRTANIALLHYVDGEKRYI
FT                   LAPNGLKKGDIVLAGEGADIKPGNALKLKDLPVGTVIHNVELMPGKGGQLARSAGTAAR
FT                   LVAKEGTYCHVELPSGELRLIHKECMATIGSVGNSEHSLVSLGKAGRNRHLGRKPHVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPVTPWGKPTLGKKTRGKKLSDKFIVRGRKK"
FT   gene            246281..246553
FT                   /locus_tag="Lebu_0243"
FT   CDS_pept        246281..246553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0243"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: sha:SH0806 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38163"
FT                   /db_xref="GOA:C7NDK1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK1"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACV38163.1"
FT                   /translation="MARSLKKGPFVDAYLLEKIEALGGKKQVIKTWSRRSTIFPQFIGH
FT                   TFAVYNGKKHIPVYVTEEMVGHKLGEFAPTRTFYGHGKDAKKGKK"
FT   gene            246600..246938
FT                   /locus_tag="Lebu_0244"
FT   CDS_pept        246600..246938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0244"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: fnu:FN1640 50S ribosomal protein
FT                   L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38164"
FT                   /db_xref="GOA:C7NDK2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK2"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACV38164.1"
FT                   /translation="MAVVAKLKYQRLSPQKARLVADIVRGKNALQALNILKFTNKKAAL
FT                   YIEKTLRSAIANAEHNNNMDPDKLFISKILIDKGPVLKRISPRAMGRADIIRKPTAHIT
FT                   VEVDERED"
FT   gene            246964..247620
FT                   /locus_tag="Lebu_0245"
FT   CDS_pept        246964..247620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0245"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: fnu:FN1639 SSU ribosomal protein S3P; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38165"
FT                   /db_xref="GOA:C7NDK3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK3"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACV38165.1"
FT                   /translation="MGQKVDPRGIRLGITRTWDSKWFAEGKEYVNNFHEDLKIKEYIKK
FT                   NYYHAGISSIQIERTSPTEVAVIIETGKAGILIGRKGQEIEALKVKLEKLTGKRVQIKV
FT                   QEIKNPNKDAQLVAESIATAIEKRVAYKRAVQQAIQRAEKAGIKGIKVMVSGRLNGAEI
FT                   ARSEWTLSGRVPLHTLRADVDYATATAHTTYGALGLKVWIFNGEVLSTTKEGENE"
FT   gene            247622..248047
FT                   /locus_tag="Lebu_0246"
FT   CDS_pept        247622..248047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0246"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: fnu:FN1638 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38166"
FT                   /db_xref="GOA:C7NDK4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK4"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACV38166.1"
FT                   /translation="MLIPKRTKYRKQFRGKMGGVATKGNKVDFGEFGLAAKEFGWITSR
FT                   QIEACRVTINRTFKREGKIWIRIFPDKPYTKRPEGTRMGKGKGNAEGWVAVVKKNKIMF
FT                   EVGGVSEEKAKEALRKAGHKLPIKVKFVRKEEVGGDK"
FT   gene            248047..248238
FT                   /locus_tag="Lebu_0247"
FT   CDS_pept        248047..248238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0247"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: lsp:Bsph_4606 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38167"
FT                   /db_xref="GOA:C7NDK5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK5"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACV38167.1"
FT                   /translation="MTINEIRELSLEELEVKVNELKQELFNLKFQKTLGQLQNTAKIRD
FT                   VKRTIARLKTVVTEKTGK"
FT   gene            248250..248510
FT                   /locus_tag="Lebu_0248"
FT   CDS_pept        248250..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0248"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: csc:Csac_2278 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38168"
FT                   /db_xref="GOA:C7NDK6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK6"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACV38168.1"
FT                   /translation="MENKRKERKVREGIVVSNKMDKTVVVVEETMKLHKLYKKRVKTSK
FT                   KYKAHDENNDCGIGDKVQIMETRPLSKDKRWRVVTILERAK"
FT   gene            248610..248978
FT                   /locus_tag="Lebu_0249"
FT   CDS_pept        248610..248978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0249"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: fnu:FN1635 50S ribosomal protein
FT                   L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38169"
FT                   /db_xref="GOA:C7NDK7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK7"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACV38169.1"
FT                   /translation="MVQQQSMLNVADNTGAKKIMVIRVLGGSRRRFGKIGDIVVATVKE
FT                   AIPNGNVKKGDVVKAVIVRTRKELKRADGSYIKFDDNAAVILNTALEVRGTRIFGPVAR
FT                   ELRAKNFMKIVSLAPEVL"
FT   gene            248995..249378
FT                   /locus_tag="Lebu_0250"
FT   CDS_pept        248995..249378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0250"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; KEGG: dge:Dgeo_1856
FT                   50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38170"
FT                   /db_xref="GOA:C7NDK8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK8"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACV38170.1"
FT                   /translation="MAKPNLKSVPKKLHVKTGDTVIVISGRSKDLLRNEKSTQTGDKGK
FT                   IGKVLKVFPKTGKIIVEGVNIKKRHIKPNAMNPQGEVVEREMPIFSSKVMLWDEGAGKP
FT                   TRVRKEIRDGKKVRISVVSGNEI"
FT   gene            249404..249958
FT                   /locus_tag="Lebu_0251"
FT   CDS_pept        249404..249958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0251"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: fnu:FN1632 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38171"
FT                   /db_xref="GOA:C7NDK9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDK9"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACV38171.1"
FT                   /translation="MAEKYIPRLQKLYKDEIVSSLLKELNLSNVMQVPKLDKIVVNMGI
FT                   GEAVSNPKLIDTAIAELAQITGQQPIARAARKSEAGFKLREGQKIGAKVTLRKEKMYEF
FT                   LDRLISITLPRVRDFEGVSPKGFDGRGNYTLGLREQIVFPEIEIDKVDKIFGLGITIVS
FT                   TAQNDEQGRALLKAFGMPFAK"
FT   gene            249989..250276
FT                   /locus_tag="Lebu_0252"
FT   CDS_pept        249989..250276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0252"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: fnu:FN1631 SSU
FT                   ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38172"
FT                   /db_xref="GOA:C7NDL0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL0"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACV38172.1"
FT                   /translation="MAKKAMVERNLKRQKTVDKYAAKRAELKERAKKGDREAVLELSKL
FT                   PRNASPTRVRNRCQINGRPRGYMREFGISRVMFRQLAGEGVIPGVKKSSW"
FT   gene            250298..250693
FT                   /locus_tag="Lebu_0253"
FT   CDS_pept        250298..250693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0253"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: fnu:FN1630 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38173"
FT                   /db_xref="GOA:C7NDL1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL1"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACV38173.1"
FT                   /translation="MYLTDPIADMLTRIRNGNMAKHAQVAIPFSKIKESIANILKNEGY
FT                   INGYEIKEEGAIKDIVVSLKTVDGEAVIKGLKRISKPGRRVYTSVESLPKVLGGLGIAI
FT                   VSTPQGVITDKECRKHNVGGEVLCYVW"
FT   gene            250726..251259
FT                   /locus_tag="Lebu_0254"
FT   CDS_pept        250726..251259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0254"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: efa:EF0221 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38174"
FT                   /db_xref="GOA:C7NDL2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL2"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ACV38174.1"
FT                   /translation="MSRIGKKPITIPAGVEIKQEGNTFTVKGPKGQLVRELSSEIKVNI
FT                   DGSEITIERPNDLPNIRALHGTTRANLNNMIVGVSEGFTRGLELVGVGYRVQASGKGLT
FT                   LSLGYSHPVEVEAVEGITFKVEGNTKISVEGIDKQLVGQVAANIRAKRPPEPYKGKGVK
FT                   YADEVIRRKEGKKG"
FT   gene            251273..251635
FT                   /locus_tag="Lebu_0255"
FT   CDS_pept        251273..251635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0255"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: gka:GK0122 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38175"
FT                   /db_xref="GOA:C7NDL3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL3"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACV38175.1"
FT                   /translation="MVKKLDRNKLRQKKHRSIRKKIVGTAERPRLAVYRSLQNIFVQVI
FT                   DDTTGNTLVSASTIEKGAKIENGSNIEAAKQIGERIAKKALDKGITTVVFDRGGYVYTG
FT                   RVKAVADAAREAGLKF"
FT   gene            251654..252163
FT                   /locus_tag="Lebu_0256"
FT   CDS_pept        251654..252163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0256"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   fnu:FN1627 SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38176"
FT                   /db_xref="GOA:C7NDL4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL4"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACV38176.1"
FT                   /translation="MARDRDNRERESEYKERLLRISRVSKTVKGGRRISFSVLAAVGDE
FT                   KGKVGIGLGKANGVPDAIKKAIANAKKNLVTVSLKGGTLPHEQIGKYNATSVLLKPASK
FT                   GTGVIAGSATRELLELAGVKDVLTKIRGSKTKDNVARATLEGLKQLRSIEDVARLRGKS
FT                   VEEILG"
FT   gene            252185..252364
FT                   /locus_tag="Lebu_0257"
FT   CDS_pept        252185..252364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0257"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: fnu:FN1626 50S ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38177"
FT                   /db_xref="GOA:C7NDL5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL5"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACV38177.1"
FT                   /translation="MSKVKVTLVKGINGRKPNHVATVKSLGLRKISQSAVHNKTADIEG
FT                   KIKLVSYLLKVEEV"
FT   gene            252370..252984
FT                   /locus_tag="Lebu_0258"
FT   CDS_pept        252370..252984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0258"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: fnu:FN1625 50S ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38178"
FT                   /db_xref="GOA:C7NDL6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL6"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACV38178.1"
FT                   /translation="MNLNELRPAAGSKRERRRVGRGHGTGWGKTAGKGHNGQKQRSGSY
FT                   VSPIFEGGQMPIIRRIPKRGFSNAPFKKDIIVITLADIVERFNDGDVVSLQTLVENGIV
FT                   KNPKFITKYSDETLRNTKGRRAVKEYLNANVEAYVKEKDFTSLLKIIGNTEVNKKLTVK
FT                   AHKVSKTAKELIEKAGGNVELLEVRSYSAKAGNNKKEDENK"
FT   gene            253031..254338
FT                   /locus_tag="Lebu_0259"
FT   CDS_pept        253031..254338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0259"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: fnu:FN1624 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38179"
FT                   /db_xref="GOA:C7NDL7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL7"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACV38179.1"
FT                   /translation="MTLAEAVTSRVKAIFNIPELEKRVTFTLLMIMVARVGIHIAVPGI
FT                   NTEAFKNFQQGNAIAQFLNLFSGGAVERASIFALGIVPYINASIVFQLLGVIFPKIDEM
FT                   QKEGGKERDKITQWSRYVTIVLAIIQSFGIAVLMQNQGLVLEPGPKFILSTVVLITGGT
FT                   SFLMWISERISIRGIGNGTSMLIFLNIVAGLPTVISAMYTGLPSGMGKVLLGLSIVAFV
FT                   VFIALMVIVQLAERRIPIQYAGKGSLGFGGGQSTVGKRTYLPLKINMSGVMPIIFASVL
FT                   MAAPPFLVSMLKAGTLKNFLAAQFEPKGAFYLLLFAILITVFSFFYTLTIAFDPDKVAD
FT                   DLKQSGGTIPTVRAGKETADYLEKVATRVTFGSAIFLSLLGIMPNIWFGYVLKLPVMLG
FT                   GTSLLILVGTAVELLLQIDSYLAVKQMKSFVNRRNR"
FT   gene            complement(254443..255135)
FT                   /locus_tag="Lebu_0260"
FT   CDS_pept        complement(254443..255135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0260"
FT                   /product="SH3 domain protein"
FT                   /note="SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38180"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL8"
FT                   /inference="protein motif:SMART:SM00287"
FT                   /protein_id="ACV38180.1"
FT                   /translation="MKIKKYRITFFTFFLVMLFCFVGKSDTDDDYKPSFKPVNIEGLLV
FT                   ATIDEDCYDDEGEDDPIVFDLIPNDKNSYNGKTIEIKLSRKDKEKFLKENFKDANKLLG
FT                   KKIEYAVQPVNVNVSTIGVRLTCGAGFPVYYAEISNVTKLNNSKATFSKNLNDLEDKKY
FT                   KTEMEKIRPVENADVKKLPETDAPIWGKAEKGQEFMVINRYGDWYYIIYDYPASTGYIH
FT                   KSQVEIIK"
FT   sig_peptide     complement(255052..255135)
FT                   /locus_tag="Lebu_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.558 at
FT                   residue 28"
FT   gene            complement(255253..256413)
FT                   /locus_tag="Lebu_0261"
FT   CDS_pept        complement(255253..256413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38181"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDL9"
FT                   /inference="similar to AA sequence:KEGG:FN1986"
FT                   /protein_id="ACV38181.1"
FT                   /translation="MKKLVSIMIFLITCIFSFGNDWEFISQGEHLIPLQISDMAIKKEK
FT                   IEFNLRDDRFMDVSVNFVFDSSSAGSRTIGFITPPDEYNDADNAPSGTGYDSESIKNFK
FT                   TIVNGKEVKIRIGKMDEFLNKGFFTAEEEKEYKNKYSKASVYYFKADLKKGENTINHSY
FT                   SYRGATSTYDKGEYQYVLTTISKWKNKKVDDFEIIVNMRKNELFSLPYTFWNDGKPIKW
FT                   EIVGNGDIVFLDKSKLEEGYSEIVYAKLKSGYVRYKTKNFAPDKEFYSHIPMNRYISSV
FT                   KSDIKINGYKFRDPLEDEIGTNLALKGWSEGDKAIKELDKLSTFQLEVLRNYPFAQYGH
FT                   EFTRKDLRNYFSQFFWYEPNKQVYVPEYIYEDRVKIIDEILKKRKK"
FT   sig_peptide     complement(256354..256413)
FT                   /locus_tag="Lebu_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.943 at
FT                   residue 20"
FT   gene            complement(256941..257747)
FT                   /locus_tag="Lebu_0262"
FT   CDS_pept        complement(256941..257747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0262"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lpl:lp_0712 phosphonates
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38182"
FT                   /db_xref="GOA:C7NDM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV38182.1"
FT                   /translation="MDKIKIRKLTKSRIYLYATLSVLSIITLYTLLTIDFGGVNIAIAT
FT                   KNFFKDLGTMFFSPKLSDRYTYIQIFTSLAVTIALAVLTTIIGSFIALFLSFFAAKNLS
FT                   SQRTSRIIKICMSFIRAIPTILWVMVFSVVANVGVEAAIIGMTFHSVAYLVKAYSESIE
FT                   EINSGIIEALRATGASSWKIIFQAVLPSTVTSLLSWTFIRFEINFTNAVLVGAAAGAGG
FT                   IGYDMFMSGTMYFDIREIGVFVYLIFGVAIILEFVSYLLRKKYLKN"
FT   gene            complement(257782..258576)
FT                   /locus_tag="Lebu_0263"
FT   CDS_pept        complement(257782..258576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lpl:lp_0713 phosphonates
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38183"
FT                   /db_xref="GOA:C7NDM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV38183.1"
FT                   /translation="MKLDKKDIFKQRFYSKLIFIFLIVLIYTISSIISGFENGMAFSSI
FT                   PSGILWLLQKFIPTSNALQYFPEIISSVLKTVLLAITSTMISAAFALFLAIIGSNSTGI
FT                   NGFTKIATKAIASFFRNMPIVAWSLILVFSFKQSQFTGFLALFLITFGYLTRAFSETID
FT                   DVAGDVIEALTSVGASYFQIIFCGVIPSVASQLLSWLLFFIETGVRESTLVGILTGTGI
FT                   GFTFSLYYKSFRYDAVGLVILIVTIIVIGIEMLSNKLRNEMM"
FT   sig_peptide     complement(258469..258576)
FT                   /locus_tag="Lebu_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.305 at
FT                   residue 36"
FT   gene            complement(258588..259337)
FT                   /locus_tag="Lebu_0264"
FT   CDS_pept        complement(258588..259337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0264"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="KEGG: oih:OB0977 phosphonate ABC transporter ATP-
FT                   binding protein; TIGRFAM: phosphonate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38184"
FT                   /db_xref="GOA:C7NDM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM2"
FT                   /inference="protein motif:TFAM:TIGR02315"
FT                   /protein_id="ACV38184.1"
FT                   /translation="MLLSIKNVSKKYNNGTEALKNVSFDVEKGEFISIIGPSGSGKSTL
FT                   LRSINKMTDISEGSILFENQNIEKLKKKEINLVRREIGMIFQNYNLVERLTVIENVLHG
FT                   RLGYKSVIAGILGIYSEEEKKEAFAFLEKVNMAKYAYQKCSELSGGQKQRVGIARAIMQ
FT                   KPKLLLCDEPIASLDPKTARNIMDYLRKIVSELKITCIVNLHQVDIAKKYSDRIIALNK
FT                   GEKVFDDKTENLTNDVIEFVYKNEENE"
FT   gene            complement(259540..261042)
FT                   /locus_tag="Lebu_0265"
FT   CDS_pept        complement(259540..261042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38185"
FT                   /db_xref="GOA:C7NDM3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38185.1"
FT                   /translation="MKYLKYLLSFALLILIIIFFGIMFSSNIVSIMAKTKHSEFKNVKF
FT                   SVKNHEMIFDNFVVNGKNLGKGRATVGIIRTGLFKIMPKLTLSNLKLEDVNLDKVYNDK
FT                   NSQIDTFTNKIDSLTAQEKTDKTTDDFIKETTGKVTDLTTNTDNFINSKVKNIEKINTL
FT                   KKDYGEITDLKNKAQKIIELNNEIKPLVQAINAEKENIEKNISEIELERDITLTNVSNN
FT                   LTKLEKEISLNDFNNINSSGNAQNMNLYIFLDKGKNLETSLNNALKATSLVREIKELNI
FT                   LISDININNGKIKVSGLNGDISKINGEILLDSNTKALVNGQNNDYIITYNKDTLNTKTL
FT                   FTANKISSIIEYSKNDLLEGKVMKLSSELILENNNFKNLNRTVLTDEEKTLLTKKIENL
FT                   RNNNYQQIMTKYEEDNKNIETLIDNVYAQKNKLDKLQRDLLSLGTIITTGQPATAINEN
FT                   DSQNNNSTINILNNSNSSNTNAENQNTSKNSSKNSNRINIGQ"
FT   sig_peptide     complement(260941..261042)
FT                   /locus_tag="Lebu_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.870 at
FT                   residue 34"
FT   gene            complement(261178..262074)
FT                   /locus_tag="Lebu_0266"
FT   CDS_pept        complement(261178..262074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_3758 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38186"
FT                   /db_xref="GOA:C7NDM4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38186.1"
FT                   /translation="MKNKIKIGVLTVLCVFALSCKNNAGQSGKVLFESPDKQIKVYENE
FT                   VNNELAKSLYSSGVDEKDLTSDQIAQMKQSIIKNIALNRALAIKGKEKKLDQDKKYTES
FT                   TDILQEQLLASLATLNEVNDKAKVTDADAKNIYDANAANFTRQEDSVRLQLIVFNTSDS
FT                   AKANQVLKEAIANPADFTSYARKYNANIQGVTENGETQEIPLTQLSSRFGPLNEAIKDV
FT                   KAGQIVNKVVTVGNDLYVVKVLERNGKGLIPFEKVKETIKTQLRNQKRQVEQQKYLKSI
FT                   SDEFKLSNMDEALKNIK"
FT   sig_peptide     complement(262000..262074)
FT                   /locus_tag="Lebu_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.760 at
FT                   residue 25"
FT   gene            262738..264242
FT                   /locus_tag="Lebu_R0012"
FT   rRNA            262738..264242
FT                   /locus_tag="Lebu_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            264281..264357
FT                   /locus_tag="Lebu_R0013"
FT                   /note="tRNA-Ile1"
FT   tRNA            264281..264357
FT                   /locus_tag="Lebu_R0013"
FT                   /product="tRNA-Ile"
FT   gene            264374..264449
FT                   /locus_tag="Lebu_R0014"
FT                   /note="tRNA-Ala1"
FT   tRNA            264374..264449
FT                   /locus_tag="Lebu_R0014"
FT                   /product="tRNA-Ala"
FT   gene            264753..267338
FT                   /locus_tag="Lebu_R0015"
FT   rRNA            264753..267338
FT                   /locus_tag="Lebu_R0015"
FT                   /product="23S ribosomal RNA"
FT   gene            267490..267602
FT                   /locus_tag="Lebu_R0016"
FT   rRNA            267490..267602
FT                   /locus_tag="Lebu_R0016"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 54.08"
FT   gene            267619..267695
FT                   /locus_tag="Lebu_R0017"
FT                   /note="tRNA-Asn3"
FT   tRNA            267619..267695
FT                   /locus_tag="Lebu_R0017"
FT                   /product="tRNA-Asn"
FT   gene            268893..269537
FT                   /locus_tag="Lebu_0267"
FT   CDS_pept        268893..269537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0267"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: aoe:Clos_1154
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38187"
FT                   /db_xref="GOA:C7NDM5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV38187.1"
FT                   /translation="MNKELKLYIVRHGQTEWNVLEKFQGQLNSPLTERGIEKVGKIGKE
FT                   LENVKFEAVYTSELGRTIGTAEIILEKNNFEKKKNIEKRLKLKKLPELNEIYFGEWQGM
FT                   DFKEIFLKYPEEAHNYFYDVKNYCAKNVKGEELKDGLERFLLGLKKIVNNNEEGNILIV
FT                   THGTVLELFFNYIENKEADDLDERKLIGNGEYRIFTYKNGKYLMETLGKKL"
FT   gene            269942..270742
FT                   /locus_tag="Lebu_0268"
FT   CDS_pept        269942..270742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0268"
FT                   /product="precorrin-6x reductase"
FT                   /note="TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK; KEGG: fnu:FN0950 precorrin-6X
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38188"
FT                   /db_xref="GOA:C7NDM6"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM6"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ACV38188.1"
FT                   /translation="MIWIIGGTKDSRDILDEILKVSKEKIVISTATEYGGKLLKDVGEN
FT                   ENVEVISERLNVMQIEKIISEKNIDLIIDASHPYAQNISKIVISMVSFLNERAKSEKKI
FT                   LKYIRFERKILDYGSENVFKFENVKELVEFLNQFENKNILSTLGSNALEEIKGIREKNN
FT                   LFIRILPTTSSIENAENLGYLPKNIIAMQGPFSKNMNVAMLENFKIDYLITKESGETGG
FT                   ELEKLEACQECKVGILAIKRPVLDYGIVFNTISELVNYVKNLSV"
FT   gene            271063..272289
FT                   /locus_tag="Lebu_0269"
FT   CDS_pept        271063..272289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0269"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   aoe:Clos_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38189"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM7"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ACV38189.1"
FT                   /translation="MFSLDDTLYEIINKYPEALDFFIANGFEQLKNKQMLEVMGKNIKL
FT                   RMALMSKKINQELFVEKLETFLQKDADIDVSLDESKADENSDLIIEGVLPCPIRIPLLE
FT                   GIKEWVNEQNEKNDYTISYTLKSANLGLDWVVEKVKTGNPDKVSDVLLSAGFELFFDKN
FT                   LMGQYMENGIFETHLENMNKDFCNETIDLRDPKKRYAIMGVVPAIFLINKTSLGDRKAP
FT                   ETWADLLNEEFEDSVALPMADLDLFNALLANLYKDFGMDGIHKLARSYKKSLHPAQMVK
FT                   ARTRTPEAPAVSIIPYFFSQMIDGSGDLEAVWPKDGALLSPIFMITKKCKADKIKPFMD
FT                   LFMSNEIGTIFSANGKFPSTNPNVDNHLEEHQNFKWIGWDYIYSHDIGKIIRECEDEFN
FT                   NDVQKSLAQ"
FT   gene            272320..273012
FT                   /locus_tag="Lebu_0270"
FT   CDS_pept        272320..273012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0270"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   aoe:Clos_0148 cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38190"
FT                   /db_xref="GOA:C7NDM8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM8"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACV38190.1"
FT                   /translation="MNLIIFSGPPSSGKTSVILKTVEALKSQGMSVGVVKFDCLYTDDD
FT                   KLYAKAGIPVKKGISGALCPDHFFVSNIEEVVQWGNSLGLSILITESAGLCNRCSPYIK
FT                   DIKGVCVIDNLSGINTPKKIGPLLKAADIVIITKGDIVSQAEREVFASRVNSVNPKAVT
FT                   MHVNGLTGQGAYELSTLLYEKELEIDSVQGMELRFPMPSALCSYCLGEKRIGEKYQMGN
FT                   VRKMNLQQ"
FT   gene            273047..274063
FT                   /locus_tag="Lebu_0271"
FT   CDS_pept        273047..274063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0271"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aoe:Clos_0149 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38191"
FT                   /db_xref="GOA:C7NDM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDM9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38191.1"
FT                   /translation="MKNNDLINKLTISELSEKYPFAENFFTENNLPVETFQDKTFHEFI
FT                   VTFAEDKIEDFALDVEKIEESLVDYIAQMKLFLGMEEENSIDMLTIVAGQDKSGNKEGF
FT                   ERLDIHKSEIISIVGPTGSGKSRLLADIEWTAQKDTPTQRQILINGELPDKKWRYSSNN
FT                   KLVAQLSQNMNFVMDLSVKEFLELHAQSRMIEDIDETVEKIITAANNLAGEQFDLTTAI
FT                   TALSGGQSRALMIADTAILSSSPIVLIDEIENAGIDRKKALELLVSSDKIVLMATHDPT
FT                   LALIADKRIIIKNGGISKIITTSPEEKKILKKLDEMDDIIQKMRSDLRKGKILKSDF"
FT   gene            complement(274231..274620)
FT                   /locus_tag="Lebu_0272"
FT   CDS_pept        complement(274231..274620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmn:NMCC_0596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38192"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38192.1"
FT                   /translation="MKMKFYYYISKNGELWGEFCSIINGEKYNIGYSVFLSRKLTEIKS
FT                   EGIDYFLKEIEKIKNGEKECVEGYGETLDFFIFKDRVDFIDWFGDYDDWSCTIEEFTRA
FT                   LLGKKKFLEMPRKINSYLEIEINDL"
FT   gene            complement(274693..274908)
FT                   /locus_tag="Lebu_0273"
FT   CDS_pept        complement(274693..274908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38193"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38193.1"
FT                   /translation="MKDWIEEYAILRKFIEKYCEEQDKNRLIEILNMKDRFLFKYFVNE
FT                   FSKLKIPNRMTEEELKEYKEKIMIYI"
FT   gene            complement(274913..275044)
FT                   /locus_tag="Lebu_0274"
FT   CDS_pept        complement(274913..275044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38194"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38194.1"
FT                   /translation="MSYPEHGKGGAFKLLPVDKMDIKYDKLDILPNPRTDLILREKR"
FT   gene            complement(275102..275512)
FT                   /locus_tag="Lebu_0275"
FT   CDS_pept        complement(275102..275512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38195"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38195.1"
FT                   /translation="MKQNYLGTYGVLKGSYMESRLKYYDFESKQKVYGDPTSTILKCAK
FT                   DDENEEYILVELLTTNEKMRIKREGYELTSKPKFDIGDKVKLIKYPDKKATVRKIYWHD
FT                   KDKRIYYLLNVENNKRKSASRYYEDDNKLEKV"
FT   gene            complement(275545..275859)
FT                   /locus_tag="Lebu_0276"
FT   CDS_pept        complement(275545..275859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38196"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38196.1"
FT                   /translation="MSILWGTILKCKTEELDYVGIKMLGRKNQEVIRISKEFYETIKCP
FT                   QFNIGDKVKLIKYPDKKATFRKIYRHDKDKRIYYLLNVENNKRKSASRYYEDNNKFEKV
FT                   "
FT   gene            complement(276344..277519)
FT                   /locus_tag="Lebu_0277"
FT   CDS_pept        complement(276344..277519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0277"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hac:Hac_0765 MccC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38197"
FT                   /db_xref="GOA:C7NDN5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV38197.1"
FT                   /translation="MNLIDKNTKVYYISTFLLFLASTMPHSILTVLFLKKGLLMSQIVL
FT                   MQSFFNLSMIIFEIPSGVMSDLYSRKKVYILSLFTLIITFFLIIFFKSLFWLSVAYTIY
FT                   GLANALETGTIDVVLINSLKNNETGLQKFLKYQKQISTFSSILGSGIGFFLYFKIGVNI
FT                   YFISIVLIFFNMFLIALFFSDENKKANENINFQIFKKHIAECISELKEKKVIKYYFIFF
FT                   GIIQIFIQSHFQLWQKLFLDKGIGEKNFFVMYVLFQIIVIIAYNTNILLINTKKLYLLL
FT                   ILIFLMAITVVILKNNLIFTGIYLTLCTIFFIINYYFEFHFNKILSKEKISAITSMKSF
FT                   FSRIFSFGTLFISSLLLRKISVVNLFVINITVVVFVVMYLIFRINKSVRQP"
FT   gene            complement(277560..277777)
FT                   /pseudo
FT                   /locus_tag="Lebu_0278"
FT   gene            278195..278761
FT                   /locus_tag="Lebu_0279"
FT   CDS_pept        278195..278761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0279"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: gka:GK2575 peroxiredoxin; TIGRFAM:
FT                   peroxiredoxin; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38198"
FT                   /db_xref="GOA:C7NDN6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN6"
FT                   /inference="protein motif:TFAM:TIGR03137"
FT                   /protein_id="ACV38198.1"
FT                   /translation="MSLIGKKIENFTAQAYQNEEFREVNFEKDFLGKWNVVVFYPADFT
FT                   FVCPTELEDLENHREELEKLGFNVYSVSTDTHFTHKAWHDHSEAIGKVKYTMIGDPTKA
FT                   ISREFEVLNEESGLAYRGTFVINPEGKIVAYEVNDEGIGRDASELVRRAKAAKFVADNP
FT                   GLVCPAKWKEGEATLKPGLDLVGKI"
FT   gene            278809..279441
FT                   /locus_tag="Lebu_0280"
FT   CDS_pept        278809..279441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0280"
FT                   /product="alkyl hydroperoxide reductase subunit,
FT                   FAD/NAD(P)-binding, detoxification of hydroperoxides"
FT                   /note="KEGG: abm:ABSDF1486 alkyl hydroperoxide reductase
FT                   subunit, FAD/NAD(P)-binding, detoxification of
FT                   hydroperoxides"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38199"
FT                   /db_xref="GOA:C7NDN7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN7"
FT                   /inference="similar to AA sequence:KEGG:ABSDF1486"
FT                   /protein_id="ACV38199.1"
FT                   /translation="MALLDSNIVEQLKMYFDKINGNIELVSFLDESEKSKELDSFLQEV
FT                   DAISGKVNYVKKSFENDKADLEKAKITRPISFTILKDGENTGINFSGIPGGHEFNSFIL
FT                   AILGLAGLGKKLEGEQLAKAESVNKPVNIETFISLSCTHCPDVVQALNLISASNKNITA
FT                   TMVDSAVFFEEAKEKDIQAVPVVFIDGEQKSVGAKTIEELLNLVVNA"
FT   gene            279734..280210
FT                   /locus_tag="Lebu_0281"
FT   CDS_pept        279734..280210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0281"
FT                   /product="thiol-disulfide isomerase and thioredoxins"
FT                   /note="KEGG: apj:APJL_2082 thiol-disulfide isomerase and
FT                   thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38200"
FT                   /db_xref="GOA:C7NDN8"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN8"
FT                   /inference="similar to AA sequence:KEGG:APJL_2082"
FT                   /protein_id="ACV38200.1"
FT                   /translation="MGTFEDYLKFEVTEAQEDEKQLRIIEKISLSEETEKAIKGIDKDI
FT                   TIIAVAQVYCPDCRATVPFLKKFSDLNNKIKIDYRSRETAKEFFPDTDERIKIPTLISY
FT                   VDGKYNTFWNEFPDVVRKEMDKNPENFEDIKYNFRIGKFNAQIEKELVDYLTSL"
FT   gene            complement(280339..281118)
FT                   /locus_tag="Lebu_0282"
FT   CDS_pept        complement(280339..281118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0282"
FT                   /product="TraX family protein"
FT                   /note="PFAM: TraX family protein; KEGG: cbk:CLL_A2054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38201"
FT                   /db_xref="GOA:C7NDN9"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDN9"
FT                   /inference="protein motif:PFAM:PF05857"
FT                   /protein_id="ACV38201.1"
FT                   /translation="MKKLNTNQLKYIALFFMFLDSVFFVFSGFLPSWIHLITRFVAPLF
FT                   AFFTVEGFYHTRNRKKYMARLWIAAILMQFGNVISFIILGERYQIVDNIFLSLAIGFTI
FT                   IYFLQKGRSSKKVIYNILGIFLFILGLAFSFVPIVIGNYIMGLEGGIQTLFTMISFWAF
FT                   YGNRKKQVITFLILNMLYIPLFTPSLNPAKYPNSRAWFDSFCYNSDGLTFLFLPFIFLY
FT                   NGKKGSKAPIHKWFFYIFYPLQFWILNILAFFLKIRS"
FT   gene            complement(281328..282272)
FT                   /locus_tag="Lebu_0283"
FT   CDS_pept        complement(281328..282272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38202"
FT                   /db_xref="GOA:C7NDP0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38202.1"
FT                   /translation="MKKIEFKIIQNSDYSDEIRNILDEEEMESLVQVKYEKVPNLFESL
FT                   HKDSEKTPIIVVGIDTENDNLVGVGACSIFKNNIGYLNSFRIKKEYRNKVNFGKAYKML
FT                   ITEAKKCGVKTVITTILEENKVAQRILTKRRKSMPIYEFYKNIVFFSLKNVKKGDLIVK
FT                   DEEILNYGNFEIYLKNKTNKKYIVTDYKKIYKFLYKFRKVIAFFGYPEMPEINKISNFL
FT                   YMDFVLKDKNADEEKNKNEFRKAVKFIQKKGYNCDFFMIGSYENSFLEKNLDKMKVFKY
FT                   KSKMYKVFYEKICNCENNEETKDEDWEFLLWNL"
FT   gene            complement(282253..282993)
FT                   /locus_tag="Lebu_0284"
FT   CDS_pept        complement(282253..282993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0284"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cac:CAC3686 metallo-beta-lactamase superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38203"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDP1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV38203.1"
FT                   /translation="MIEKIKIGLNNLYLFKNKNDEYLLLDTGINVKKEKILKKLIQKIG
FT                   DIKKIKVIVLSHSHSDHVGNLKMLIDEIGDVRVIAHRNSENILETGKSVIPNGFYPFTE
FT                   KISKKLKSKKNFSKNIFSKLEKTDMEKVIFIDFLQQEKILLSEYGFGNMEIIETKGHSN
FT                   DSVSVAVFDEKNNEKYLFCGDLVQNLCFKFPLIPLFGENKEELIESWKKIVLNGYDKIF
FT                   PATGKEVMARDLIRRLGKDEKNRI"
FT   gene            283415..284278
FT                   /locus_tag="Lebu_0285"
FT   CDS_pept        283415..284278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0285"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   fnu:FN1016 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38204"
FT                   /db_xref="GOA:C7NDP2"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C7NDP2"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACV38204.1"
FT                   /translation="MKTTIDFIIFSIFFIFIKIFNFLSPKIRLKISEFIGVLLFYLIPK
FT                   GRKLSYRNLNLILNEQNSFNYSKKKIKEIAIKSYKNTAKSFLLPFWIYEYFENFSPKIY
FT                   NSELLEKLKSENERIILVTSHFGFFHASLFPTRNDTMFIPIRIISNKFIESYMDTIRFK
FT                   NNMTYFPEQNYKSFLKNKNSKGVFVLLSDVRKPDGDKITFFGLPTTNSGFPAYFSKKEN
FT                   IPIVIIHNEVDENNICHIFIDKVIHPENYKNRHEIMKSILTEYEKIILKLPEQWFWFQD
FT                   RWRDGI"
FT   gene            complement(284451..285785)
FT                   /locus_tag="Lebu_0286"
FT   CDS_pept        complement(284451..285785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0286"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: glo:Glov_2205 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38205"
FT                   /db_xref="GOA:C7NE10"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE10"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38205.1"
FT                   /translation="MKITFILPAIGKKKGQKYIKTWKNMEPLMIAVLKSLTPEDVETNF
FT                   MDDRNEFINYEESTDLVVISVETYTAKRAYEIAKKFQKRGIKVLAGGYHPTVEPDECLE
FT                   HFDSIILGNAESVWTKMLNDLSKNKLEKRYYGVTTSFAMPDRSIYKDKKYSPLALIETG
FT                   RGCNFACDFCAIHSYYEKKYFRRPIEEIVQDIKNSGKKYVFFIDDNFVADHKHAIEICK
FT                   AITPLNIKWVTQGAITIAKNDELLYWMKKSGCKMILIGYESMNPNILKDMGKGWRSGVG
FT                   EINELTEKIHSYGIGIYATFVFGYGNDTKETFDETVKFAKKHGFYFAAFNHLVPFPKTG
FT                   VYRKLREEKRLLSEKWWLDENYPYGRISFLPTDQTPDELSKKCANARKSFFGWRSILKR
FT                   GFMQLKRSHDLGMFAIFFAQNFNLKKEVMGKYDLPYAQNLDEAPK"
FT   gene            complement(285811..287133)
FT                   /locus_tag="Lebu_0287"
FT   CDS_pept        complement(285811..287133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0287"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: amt:Amet_3280 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38206"
FT                   /db_xref="GOA:C7NE11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE11"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38206.1"
FT                   /translation="MRIMLVLAKDNIYKYNSIHKRKYYPQITLITLESLIDRKYNADVV
FT                   IVDEGVEKWDATSKKYENEKFDLICISSVISGSKRAKEIAKFWKSKGAYTLIGGHYATA
FT                   LKEEALQYFDTVITGAAEISFPMFIEDFTNGTPKREYFNLVGNDYEPKPLNRKLLKNKK
FT                   YFKNYGTIVANNGCPNKCSYCSITKMYSGKNQIKSIDYVINEIKTNKPKKWIFLDPNFL
FT                   GNRNYAIQLMEELKKLKIKWTASATINIGNDKKILQLMKESGCIGLVIGLESFVQENLD
FT                   GVNKKFNNVAEYKKLVKTIQSYGISVLSTLMIGMETDTVESIRRIPDIIEEIGVDVPRY
FT                   NIITPYPGTPFFNQLKEEGRLLTEDWYYYDTETVVFKPKNMSYDTLQKEFYKLWLDTFT
FT                   FKRIIRRVKTSRNKGLKFILEVFSRQHARKFRKYGKIKFDK"
FT   gene            complement(287130..288434)
FT                   /locus_tag="Lebu_0288"
FT   CDS_pept        complement(287130..288434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0288"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mta:Moth_0831 radical SAM family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38207"
FT                   /db_xref="GOA:C7NE12"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE12"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38207.1"
FT                   /translation="MKIAFLRPNMGGKRSNDAIEPLAFAVLSGLTDKTKHELMLFDDRI
FT                   EDIPMDLKVDLVVISTFTMTARRAYELAENYRKRGVYVMIGGYHASLMPDEVQEHADTV
FT                   CVGSGEVTWNEFLNDLENGVPKKRYECRKLPDINNVVYDRSIYKGKKYSFVVPVQFGRG
FT                   CMHQCEFCTIGAVHKGDFQHRDVENVINEVKEIFRTNKRAKIVYFVDDNIFANKKKALK
FT                   LFEELKKLKIKWACQGSIDIARDEKLIKLMSEAGCIEMLLGFENINIKNIKKMKKVANY
FT                   EFDYEKIINIYKKNKILVHASYVIGYDYDDKNCFDEILEFSKKHKFFLAGFNPALPIPG
FT                   TPFYERLKKEGRLLYERWWLDENFRYGKACFEPYNMTIEEFEAGILKCKVEYNRHSSIW
FT                   KRLFDGAANFKHALVFLAVNYINRKEVYNKKGIKL"
FT   gene            complement(288821..290143)
FT                   /locus_tag="Lebu_0289"
FT   CDS_pept        complement(288821..290143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0289"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mta:Moth_0831 radical SAM family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38208"
FT                   /db_xref="GOA:C7NE13"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE13"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38208.1"
FT                   /translation="MKVALLAPAGAMYRFNGTFKKAIHYAPLTLSTLAAYIPEDIEVVI
FT                   HDETIEKIPLELDADIVVMTSITGTSERVYKYARYFKSKGKKVILGGPHPTLCPEEAIQ
FT                   HCDSVVIGRSEWLFTEIMEDARNNSLKKFYVQKENSLENLKLPKRELLKKERYVSINSI
FT                   EATKGCSFDCSFCVGKALYPKLLKRPINEIIAEIETFKKKEVLFIDLNLIADRNYAKKL
FT                   FIELIPLKKWWFGLATSNLVHDDEMIRLMAKSGCKGLLIGFEAVSKESLRAMNKGVNVM
FT                   ADYHLLMKKLHHYDIAVNGTFTFGADGDDKDIFKRTVEEVIKMKVDLPRYSILTPFPKT
FT                   KLYNDLEKQGRIFEKNWTMYDVQHAVFHPKKMTAQELQEGGIYAWRETYKVSSIFKRIA
FT                   RFSVIAPIMLNTNLGYRHYADKLEEFTFEKMTDNSDIPNVD"
FT   gene            complement(290140..292056)
FT                   /locus_tag="Lebu_0290"
FT   CDS_pept        complement(290140..292056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0290"
FT                   /product="GH3 auxin-responsive promoter"
FT                   /note="PFAM: GH3 auxin-responsive promoter; KEGG:
FT                   acb:A1S_1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38209"
FT                   /db_xref="GOA:C7NE14"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE14"
FT                   /inference="protein motif:PFAM:PF03321"
FT                   /protein_id="ACV38209.1"
FT                   /translation="MKEFGEKSKFYEVKNLKYVILNRLFIFFCKKSYKDFVSNIKSKSK
FT                   IRKTQVKILLEILKTNKNTEYLKNFETESQILNAENEKELIEKFQNKIPIVNYEDIKEF
FT                   VEKEKSGENNVLLSDKIKLFELTSGSTSNVKYIPYTEKFLKSYMNGVFAWIYNLYQNNK
FT                   RLFLGSSYWSVSPILKREAVTSGGIRVGIEDDTSYFDKVSAFFLNKLFTVPKKIKSIQN
FT                   MEDFLLITAVFLLLSENLAMISVWSPSFLMILLDFIEKNHKVICQIVKSEDLGTEFFAD
FT                   KNLGNKKYFQIIQKKYRKLWKKNRSKFLINYFNEHEKNILSKNDKTQNLEITKKNNENE
FT                   IIAENKNLETKSGNKIVENFVDYSVIWKKLSLVSCWADSDSYEIFIKLKEKLNFDKKNI
FT                   NLKFQGKGLMSTECIVSFPLENVQNGSVAAYTSFFYEFIQVSDDKLENRSPKLLDELEL
FT                   GERYCVVVTTNAGLYRYNTNDIVEVAGFYHKIPIVKFVGRINNFSDIVGEKLKNSFVEK
FT                   QVLTTLEENNIKGEFLLFAPVKNETGGIFYTLFLEIKKDGRKFNWKQIEKEINSSLCKA
FT                   FHYEYAYKLGQLRKVRVFLIEKNGLKTYTAEKSKKQKIGDIKYRLLDKNFGWENKFAGG
FT                   FGE"
FT   gene            complement(292040..293368)
FT                   /locus_tag="Lebu_0291"
FT   CDS_pept        complement(292040..293368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0291"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: glo:Glov_2205 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38210"
FT                   /db_xref="GOA:C7NE15"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE15"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38210.1"
FT                   /translation="MKMLFVYPGFGKKKGQKYIFQLRTFEPLTFAYLRALTPYDIECEL
FT                   IDERIEAIDYDNDANVVVITLETYTARHGYEIAKRFREKGKKVIVGGTHASLVPDEAMK
FT                   HADSVVTGYADDIWEKIIEDYRNGTEKKLYIGGLSNKFLIPDRSIFKKKYLISVVETGR
FT                   GCPHHCEFCAISAVNKKRYAKRPVDSVIEELKHIKSKYIFFADDNFVADPKYALELCEK
FT                   IKPLKKKWISQGAITMAKNEKLLEAMRDSGCLFILIGYESINKEALDNMKKEWSYKLGD
FT                   IEESTRIIHKYNIGIYATFVFGFEEKIGTTFEDTVKFAQKNHLEFVQFNYLVPFPNTEL
FT                   YFKMEKEGRLLYKKWWLEPQKYSYLFFEPYDISTNEFRDRCIAVRYAYHSVKNILGRTF
FT                   DVLKRTKNIPFSIMYLFLSFGQKAVIKKFQDLPIGDNLDERIR"
FT   gene            complement(293484..294224)
FT                   /locus_tag="Lebu_0292"
FT   CDS_pept        complement(293484..294224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38211"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE16"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4696"
FT                   /protein_id="ACV38211.1"
FT                   /translation="MKMICKIFSMDSIKNDNNIVNEMFSLMKKHYENMKKEKFLADLYD
FT                   KDDVFLIFDGEILKGFSTIKKINVELKNENNENSEKISGFFSGDTIIEKGFSWGIEFQK
FT                   EWIKYCLLESEKNMKNGVKTYWFLISKGIKTYMYLPTYFKNFCPKVDYVESEIEKKIKD
FT                   IYAKKIYGSRYCKENGIVKNDGTNDFLRENVIVLSEKQLKNKNIQFFLEKNPDYKKGDE
FT                   LVCLAEISFENLTNLGKRVLKEIF"
FT   gene            complement(294508..295170)
FT                   /locus_tag="Lebu_0293"
FT   CDS_pept        complement(294508..295170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0293"
FT                   /product="O-methyltransferase-like protein"
FT                   /note="KEGG: csc:Csac_2422 O-methyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38212"
FT                   /db_xref="GOA:C7NE17"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE17"
FT                   /inference="similar to AA sequence:KEGG:Csac_2422"
FT                   /protein_id="ACV38212.1"
FT                   /translation="MRYIENLESVNKKMIIDENGLKITQDAILLSEFIKKYFNTKYKNK
FT                   EKKTILEIGAGQGIITLLLSKIEIFEKIFAVEIQKDIFEILKKNIKINNLEEKITSINE
FT                   DIKTIKGEYDFIFSNPPYKKINSGKLPENEAEQISKYEILLTLEELFYEIKRLLKNYGE
FT                   FFVIVPDDRLNDVFRYIYANNMNILSIEINKYKKLNLVIVHGKKGGKRNSEINIYEK"
FT   gene            complement(295283..297109)
FT                   /locus_tag="Lebu_0294"
FT   CDS_pept        complement(295283..297109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0294"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: fnu:FN1320 peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38213"
FT                   /db_xref="GOA:C7NE18"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE18"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACV38213.1"
FT                   /translation="MGFRSHKKGIQLASAIMMGIFGIGMLISGILFLKNNVFGALNHRE
FT                   VIATVNGIKIYRDDFERESYSLKNELNEITQQKIQQLAQVGTNSGNIKSVPDDLVNEYV
FT                   LQLIINKEILLSSAKNLGIKVSGSDVNKEFENYRKQSKLGKKEFGEYLRSVGYNVSSFK
FT                   QTIKDQKIIEKMREKIFSNDKITEEEIKKAYERNKYTQSFANQDFDDVKDQIKETMTQD
FT                   KNIMILNSYLAKAKEKTKIVFKDKNFENMYTKVKAVVAQNGEYKYTNEAVNEQIINSVS
FT                   QTQQGYSDKLVNELKTTLKKNLDKFVKISEKAKAAGIKADPDLIGVDQLRDYSQKYYNY
FT                   LIDSYKPDDATLQARFNAKRDSYNTQNSIGGYVIGEEYQAGESDFEGAKKQADEIMKTT
FT                   TKDNFAAKAKEFSKDPESAKNGGSLGETADLSQLVPEFANAVKNGKAGDIVGPIKTQFG
FT                   YHIIYIQSKDPKNDNVAKVSHILITPTISEASKQKVIKKVQNLKAEIESKKVTWDNAEK
FT                   QDKYNFSVKERFKKLVKTDAIPGIGKNDELMNQIFALKIDGILERNDATGYYLIAKTSE
FT                   IPFAQATFENSKERVRLELAHEYADKQLDSIN"
FT   gene            complement(297340..297888)
FT                   /locus_tag="Lebu_0295"
FT   CDS_pept        complement(297340..297888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38214"
FT                   /db_xref="GOA:C7NE19"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38214.1"
FT                   /translation="MPEKEKIKQENSKKQKGSFGKNLFVLLLFLITAGVVATYYYDIDH
FT                   SDKIQVVVNKNLVQERQKDDEVQNRISIFVYDPSTKIINEREIVVPRQMNLIEGDFING
FT                   IIRNSNYITEDMKFRSAYNLRIDNVNTTVVKLNAQFANLKKNPELFNGFSQAVTNTILK
FT                   NFPNIHSVLIQIDGEINTR"
FT   sig_peptide     complement(297775..297888)
FT                   /locus_tag="Lebu_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.591 at
FT                   residue 38"
FT   gene            complement(298035..299204)
FT                   /locus_tag="Lebu_0296"
FT   CDS_pept        complement(298035..299204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0296"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: fnu:FN1334 N-acetylmuramoyl-L-alanine amidase;
FT                   PFAM: cell wall hydrolase/autolysin; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38215"
FT                   /db_xref="GOA:C7NE20"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE20"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ACV38215.1"
FT                   /translation="MKKILLFLLLFISAITFSGTLENISYSNGKIIGTFKENSQIMPSA
FT                   SITKVGTEDVLMISFTDSEMGRNVPAFINRNDQYISKVYTVQNNNLVVVYIYLKPSVTY
FT                   QVISRNKEFQVTLNSESSKLVTPNRSSSTSRYGTTKKQPSNTNITKQPNNQQQTQVQNP
FT                   KIPANNTKKINKRYTIVVDPGHGGHDSGARGNGYNEKDIALQVATRLANNLRRDYNVIM
FT                   TRDSDFFVPLDTRAKIGNDANADFFISIHLNSGSSSSANGTEVYYFNKKDQNNYAAQVA
FT                   KFENKVDSSYGDTPFSDFILNDIFYKKNQKTSQAVAGAVLDGLINLTGLRRRGVLGANF
FT                   AVLRGSNSPSILVELGFMNNYSDLSKFLSPDDQERTAAVIGDAIRKYFK"
FT   sig_peptide     complement(299148..299204)
FT                   /locus_tag="Lebu_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.741 at
FT                   residue 19"
FT   gene            complement(299327..299593)
FT                   /locus_tag="Lebu_0297"
FT   CDS_pept        complement(299327..299593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0297"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: plt:Plut_0157 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38216"
FT                   /db_xref="GOA:C7NE21"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE21"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ACV38216.1"
FT                   /translation="MDKNSIVVILIYIVFMAVLILPTMLSNNKKKKQKAALLESLKVGD
FT                   KITTVGGIQGTLVNIFTETVEMKIDKNARMTVLKSAIDRIEKK"
FT   gene            complement(299881..301083)
FT                   /locus_tag="Lebu_0298"
FT   CDS_pept        complement(299881..301083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0298"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: lin:lin2552
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38217"
FT                   /db_xref="GOA:C7NE22"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE22"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACV38217.1"
FT                   /translation="MAKKTLKDLDVKGKKVLVRVDFNVPIKDGVITNDNRITAALPTLK
FT                   YILENGGKVIAFSHLGKVKEEADKASKTLAPVAKRLEELLGKPVKFIPETRGAELEAAV
FT                   AELKDGEILMFENTRFEDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVG
FT                   IASNIKDSAVGFLVEKEIEFIGGAVDNPERPLVAILGGAKVSDKIGVIENLLDKADKVI
FT                   IGGGMMFTFLKAEGKNTGSSLLEADKVELAASLIKKAKEKNVELLLPIDTVVAKEFKND
FT                   TEFKTVSVDDIEDGWMGLDIGEASIKLFSDALVGAKTVVWNGPMGVFEMENFAKGTIGV
FT                   CKAIAELSGAKTIIGGGDSAAAAIQLGFADKFSHISTGGGASLEYLEGKVLPGVDAISE
FT                   K"
FT   gene            complement(301168..301761)
FT                   /locus_tag="Lebu_0299"
FT   CDS_pept        complement(301168..301761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0299"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cpy:Cphy_0287 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38218"
FT                   /db_xref="GOA:C7NE23"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE23"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV38218.1"
FT                   /translation="MKLKNEDLIFRFATENDAKEILEIYRPYVENTTITFEYEVPSVKE
FT                   FKERIMKILEEYPYIVCEYDKKIIGYAYAHRVWSRAAYQWDAELSIYTNENYSGNGIGK
FT                   KLYKMLMEILKLQNVVNVYGCVTYPNENSDKLHEYLGFNKVGIFKNAGYKFGKWIGVTW
FT                   FEKAILEHCENPKPLKKILDVDKNKIKYIFKIVC"
FT   gene            complement(301801..302604)
FT                   /locus_tag="Lebu_0300"
FT   CDS_pept        complement(301801..302604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0300"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fma:FMG_1443 cobalt ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38219"
FT                   /db_xref="GOA:C7NE24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38219.1"
FT                   /translation="MSFITVKNLSFKYPNGTENVLNDVSLEVKKGEKVAIIGQNGAGKT
FT                   TMVKMLNGLLKPVSGDVVVDDWNTKKYTVAKMSRKVGYVFQNPMDQIFHNNVYDEIAFG
FT                   AKKLKYSPDEIKTMVENAIKLTELEKYQKENPYNLPYSLRKFVTIAAVIAMGSDVIVMD
FT                   EPTAGQDFRGMRVLHNLIDELQKQGKTIITITHDMEFVVKNFDRVIVMTNGKVIADGDK
FT                   RDIFWQFDTLEKSMVKQPYISDLAKEMEIGGKVLSVGEFVENYKK"
FT   gene            complement(302656..303183)
FT                   /locus_tag="Lebu_0301"
FT   CDS_pept        complement(302656..303183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38220"
FT                   /db_xref="GOA:C7NE25"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38220.1"
FT                   /translation="MKRYLSGLLGIILLFFVMTIVYCLYCLFKIFVNKYIPFFEALIFL
FT                   GICSGWTYGLNRYDKKNFENEKDKNKSRFAPKEKKEPSNKELLSALFLAYIPAIITIYL
FT                   GNVTELAYFISSTEKTKFTAEFFNSLNEVFNQRFFYKNLLVVSITFIIFGAFFSFRTVT
FT                   EYMKRKKEELEQ"
FT   gene            complement(303223..304035)
FT                   /locus_tag="Lebu_0302"
FT   CDS_pept        complement(303223..304035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38221"
FT                   /db_xref="GOA:C7NE26"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE26"
FT                   /inference="similar to AA sequence:KEGG:FN0994"
FT                   /protein_id="ACV38221.1"
FT                   /translation="MKEGKLKKIIKIDWTIFYSKPRIQILGILIFLDIILLFSVTKEME
FT                   KGFNVSSVSTSIVLFILFILLNGLFVFYYKNKFPNIEFYDDYFIFKKEKVYYENLKYFL
FT                   FKDNRLFQMKKFSKILYRPDGGNWKKIDGSGYDYDLFSVFQKCFLEKNFSKAVKNIESG
FT                   GVEIFPFQNQGFVKNKFLFSSEEGLQELTQIFESSPKIQVSNKSVTFDNEIYDWENYNI
FT                   EFEIGTITVSDLKKNTILEIEAKNTVIYQEILLKNLIENFDKKYPKFY"
FT   gene            complement(304032..304595)
FT                   /locus_tag="Lebu_0303"
FT   CDS_pept        complement(304032..304595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0303"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: lil:LA4133
FT                   Appr-1''-p processing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38222"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE27"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACV38222.1"
FT                   /translation="MKPKDLKNRIVLVKGDITEYPADVIVNAANSSLLGGSGVDGAIHR
FT                   KGGKEITEDCMKIRASQGKCNIGEAVITRAGNMSFKNVIHTVGPVWQSGKNNEAKLFAE
FT                   KLLKNAYISSLELAEKNKLKNISFPNISTGVYRFPKDLAAKTAINAVIEYLEKNDFIEK
FT                   VNFVCFENENFEIYRKLLEEKGIL"
FT   gene            complement(304657..305496)
FT                   /locus_tag="Lebu_0304"
FT   CDS_pept        complement(304657..305496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0304"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fma:FMG_1444 cobalt ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38223"
FT                   /db_xref="GOA:C7NE28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE28"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38223.1"
FT                   /translation="MGYFKIENVNYKYPLEDKQALKNINIEIKKGEFWAVIGKNGSGKT
FT                   TFCNMLRRFVPDFYKGELTGKITLEDKELKDYSQKELVQKIGFVFQNPFTQISGVKDTV
FT                   FEEIAYGLENLGLEKEEIISKVEKILKLLEIEKLRERNPYDLSGGQKQRVALASIIAMD
FT                   PDILVIDEPTSQLDPKGTEDIFKIINLMANEGKTIILVEHKLELIAEYAQNILVLDEGE
FT                   IILSGKAEEVLNNKILLEKEIGMTQYSILAYELEKARKVEFEEIPITKEKTVELLKK"
FT   gene            complement(305478..306233)
FT                   /locus_tag="Lebu_0305"
FT   CDS_pept        complement(305478..306233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0305"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: fno:Fnod_1257
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38224"
FT                   /db_xref="GOA:C7NE29"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE29"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV38224.1"
FT                   /translation="MKKDFFKQLYPLTKLFLSLTLILSAFIVPSYIYGYSMIIICGIIV
FT                   SLENKSKVYCKRIFFSLFWLFTAIFIIQSIFLPSGEVWMKFGFISIYKEGVMKAVNLTS
FT                   KLTAVVSALTMLTLITPVKTFTLALEKKGLNPKAAFILMLTLQMIPEMKKQANVIMDSQ
FT                   KARGVETEGNVFVRAKALIPVFIPLVLSSIANTEERAIMLEARGFSIGEKRTILYDIEE
FT                   TKNDKIMKIMLAIFIVLCIVWRVLWVISK"
FT   sig_peptide     complement(306129..306233)
FT                   /locus_tag="Lebu_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.925 at
FT                   residue 35"
FT   gene            complement(306237..306830)
FT                   /locus_tag="Lebu_0306"
FT   CDS_pept        complement(306237..306830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fma:FMG_1446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38225"
FT                   /db_xref="GOA:C7NE30"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE30"
FT                   /inference="similar to AA sequence:KEGG:FMG_1446"
FT                   /protein_id="ACV38225.1"
FT                   /translation="MKSLKEDFSLMSSLLIPVAVAINFTGFGIAKLLQVPIFLDSIGTV
FT                   FISLIAGPWVGMVTAVITSLITGSFSPEYFAFMPVAIIMALGMGFLARFKMKNIVTKTF
FT                   VCAFCLVFIAIVVSAPIIVLVYGGNTGNSTFGITTFFLATGQNIWTAVFSTNFITETTD
FT                   KIITAIVAMAIIKAMSPRYLVKFKYGENYIKEDK"
FT   sig_peptide     complement(306765..306830)
FT                   /locus_tag="Lebu_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.579 at
FT                   residue 22"
FT   gene            complement(307037..307759)
FT                   /locus_tag="Lebu_0307"
FT   CDS_pept        complement(307037..307759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0307"
FT                   /product="HAD superfamily (subfamily IIIB) phosphatase,
FT                   TIGR01672"
FT                   /EC_number="3.1.3.2"
FT                   /note="KEGG: sak:SAK_0768 acid
FT                   phosphatase/phosphotransferase; TIGRFAM: HAD superfamily
FT                   (subfamily IIIB) phosphatase, TIGR01672; PFAM: acid
FT                   phosphatase (Class B)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38226"
FT                   /db_xref="GOA:C7NE31"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR010025"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE31"
FT                   /inference="protein motif:TFAM:TIGR01672"
FT                   /protein_id="ACV38226.1"
FT                   /translation="MKKALLFLFAASVVFAAGPKVPYTHEGFYSTDKVQKAVHFVSVDD
FT                   IKKSLEGKGPINVSFDIDDTLLHSSGYFIYGQHYFQIPGDKRGAVSYLYNQKFWDYVAE
FT                   NGDEHSIPKQSAKDLIKMHLERGDNVFFITGRTKHSKDKNYTSTKLSKTLQRYFELPKE
FT                   VYVEYTADTPTGGYKYDKSFYIKKHNVSIHYGDSDDDILAARELGIRGIRVQRAYNSTN
FT                   PQKMNGGYGEEVLINSAW"
FT   sig_peptide     complement(307709..307759)
FT                   /locus_tag="Lebu_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 17"
FT   gene            complement(307781..308425)
FT                   /locus_tag="Lebu_0308"
FT   CDS_pept        complement(307781..308425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38227"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38227.1"
FT                   /translation="MKKIILTAAIIMSSTISFSNNLPNIQKETAGKTNSTEKNSEMDNI
FT                   IGEWRNYWTFIKITKQGNDYYIQKADMDKDYFYNQVVDKKFSKAPAFVQKIENHSVFEG
FT                   LTPVIISKPEKLTLDKNGFYTFEHDDKYGKNNKVYWGLSKYSQDDYNYDRLGEYGEYRP
FT                   GEKEFYKGLKVGDVVLKDYFDDENRTFTRWNYRPLNDKDREILKTLTIINQ"
FT   sig_peptide     complement(308366..308425)
FT                   /locus_tag="Lebu_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            complement(308716..309450)
FT                   /locus_tag="Lebu_0309"
FT   CDS_pept        complement(308716..309450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0309"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG: fnu:FN0557
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38228"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE33"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACV38228.1"
FT                   /translation="MKKIFNLVIFLLLSLSIIPAPKTKKTTIKKNQEKMELIFILDKSG
FT                   SMGGLESDTIGGFNSMLEKQKKAKNRNTYVTTVLFDNEYKLLYSHTSISEVKPLTEKEY
FT                   SPGGTTALLDAIGRTISQVKSEQARLSSKDKAKKVLFVIITDGMENASKEYNLTTVRRL
FT                   IEAQNKNEKWEFIFLGANIDAIGTAENLGIKKSRAVQYKSDSIGTQNNYRAVEKAIDGV
FT                   RAGYLDESWKLEIEKDVQNRGK"
FT   sig_peptide     complement(309379..309450)
FT                   /locus_tag="Lebu_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.377 at
FT                   residue 24"
FT   gene            309666..310292
FT                   /locus_tag="Lebu_0310"
FT   CDS_pept        309666..310292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0310"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbt:CLH_0731
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38229"
FT                   /db_xref="GOA:C7NE34"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE34"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV38229.1"
FT                   /translation="MERKKGKKNQKRKKILDKAWELFRKNGYEETKVEDITRELGVSKG
FT                   SFYTYFKTKDEVLYEILERIKKENEERISKINVNQEPSKILEDYVISKMNYIVKLLNNM
FT                   KISSINRNLSNSKLKNFFEELKKVSIEFIKKNIVEKFNKINGNKYNLEIISEFVYLAIE
FT                   EFLYNEFVLKNFKNLESSDFINIENTDEFENSLKEVIKFINNAFK"
FT   gene            310315..311601
FT                   /locus_tag="Lebu_0311"
FT   CDS_pept        310315..311601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0311"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   fnu:FN1273 outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38230"
FT                   /db_xref="GOA:C7NE35"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE35"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACV38230.1"
FT                   /translation="MNKNRIKLLTALLLLLSGISSFAQKITIQEAAEMAVKNNKDIKVG
FT                   MLEVEQGQIDVDRSWKKKFFTVSYNASANAHFKDILTKNVLTKTGESYQHYVSLSQPIY
FT                   TGGKLKLGNEISKDNLKLAELKLDKTKKDTILSTVQAYIDVYDAISTLGVLQKSKEALD
FT                   ENYKIQTEKYNLRMVTKPEYREAERGVKDMEAQIVQQQGNIEIAKESLGILIGIPDSKN
FT                   IEIVPFGVEDNFTKTVDLKQDLEKLQTLNTEYKIAQKQIDITKKNVKLEKASFMPTING
FT                   TINYGALNAKNKPKKLFETKEFTSVAGVTFSWDIFDWGRRKDNVKYAEKTQEISEVKSE
FT                   QTLDLVKANMRKTYYQLQALEKSLEALKVAVEKAEETYELEKERYKYNLITMNNLLDAE
FT                   AKLRLSRVNYANSKLKYYYLVSQYGAFLD"
FT   sig_peptide     310315..310386
FT                   /locus_tag="Lebu_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.860 at
FT                   residue 24"
FT   gene            311630..312751
FT                   /locus_tag="Lebu_0312"
FT   CDS_pept        311630..312751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0312"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   drm:Dred_2949 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38231"
FT                   /db_xref="GOA:C7NE36"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE36"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV38231.1"
FT                   /translation="MKMKLYNKKIIVGLAILAMLAISCGKKKTQAIDNSRPVKVQIIGQ
FT                   NSISLGYKASGTLKGIEEVPYTATSSGEIVVINAKNGDNVRAGQVIVSIDNQTARSNVK
FT                   RAASTVNTASSNINSSSAALEEARINYEKYAMLYEKRLVTETEYLNAKTQYNSAKANLN
FT                   ASKNNLSSARAELDSANDTNRKTVVKTNTTGTIAHMNLELHQQTSAGNQLFTVINEGEM
FT                   QLEVGVSPEIISKIHVGTQAKVKIDELKGEELTGTVYEVAAAANSSSRQFTVKIKIPNS
FT                   NRRLKSGMYGTASIDTGAEDGLIIPKKAIVVKGVEQVVYIVRNGKAVAIPIKITNQNEE
FT                   MAAVTGNGLTAGIELIVDGQNVVQNDEKIRRVQ"
FT   sig_peptide     311630..311707
FT                   /locus_tag="Lebu_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.457 at
FT                   residue 26"
FT   gene            312917..315973
FT                   /locus_tag="Lebu_0313"
FT   CDS_pept        312917..315973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0313"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   fnu:FN1275 acriflavin resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38232"
FT                   /db_xref="GOA:C7NE37"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE37"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACV38232.1"
FT                   /translation="MTVAEFATKRVVSTTMILLFMIFSGFMTMRSMKKELIPDFKFPMV
FT                   VISTSWTGAASEDVKTQISKKIEDAALNVDGIKNISTSSTYGNSNVIVEFNFGTDTDIK
FT                   QVQIQSEIDKIKRDLPSDANDPVVSKMNMAGGNSDMALMVAIRGGDEATITSFIEETLK
FT                   PRLKRNRGVGDISVFGNATRQIKVKLDPYRLQAYNLSPSEIYAKIQAANTIVPGGTVKD
FT                   GSKEFILKVDGELKTLEQIQNIIISNKDNQVVRLNDVATVEYGTKDKTSYSKYDGQDMI
FT                   SVMIQKSKDGNLVEIASIARKALEEMKPLFPSGTSYEIITDNSIRVKEAISNVTSTGLQ
FT                   ALVITIIVLLVFLKDLRAALVVGMSIPISAMFTFFLLGTQGITLNMISLMGLALAIGSL
FT                   VDNAVVTLDNIFDHIQLNKEPAMVAAIRGTNEVILPMIASTATSVCVFLPIVLFPGFAK
FT                   EVFSGISFSMMFALSTSIVVAMLFIPMASSIFLNIEKISGAAGKAHRFNAFRDKYKELV
FT                   KKALENRKVVIIGIAVLFVVVVFGLGKTVKSAFFPTIDNNEYSVVASLSTGLDVEVAHE
FT                   ISKQMEQIVKEDPVTKNYTTIVNAQAAIVNVDVKKDTMKAMERVRQKMSNIPNVTIAVS
FT                   PQKAGGRAVSKDYSFQVEGDNAEEINRIANAIMADMKQQSWFKDVKSSSEGGYPQAQLE
FT                   VDRVKAESYGLSVTDITRMLNQTVLGVDPIEVTQDTETLKVYMEFEDEYKNSLEKILNI
FT                   MIKTSTGQFVRLGDIATMKEVEGAASIETYNGAQIVTVGANMDKSKGLNDAASFVNASF
FT                   QKTNPAAGYKIAPAGNAQSQKEMGGEIMNALALSIVLIYIVLAVQLESFVLPLIMMLAL
FT                   PLSMIGVIFGLAVTRIQLSMFVMIGILMLFGMAVNNAIVLLDFVSGLRQKGMEIREALV
FT                   EAAGSRLRPILMTTLTTVLGWIPMVFSSKGSSGYYQGMAVAVMFGLSFCTLLTLFFIPV
FT                   AYSIVEERKEKRQKAKEEKRRAKKINERN"
FT   sig_peptide     312917..313018
FT                   /locus_tag="Lebu_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.633 at
FT                   residue 34"
FT   gene            316013..316309
FT                   /locus_tag="Lebu_0314"
FT   CDS_pept        316013..316309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38233"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38233.1"
FT                   /translation="MKRVEIYFDSYFIDKIKEEMKEYGIEQYIIIPQVYSRWSRTLKHF
FT                   NNHVWPGTDSVLITYLEDRQAKEIMRLIKIMKIDLGKSISMGAAMLPVDDIIL"
FT   gene            316497..317321
FT                   /locus_tag="Lebu_0315"
FT   CDS_pept        316497..317321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0315"
FT                   /product="Tubulin/FtsZ domain protein"
FT                   /note="PFAM: Tubulin/FtsZ domain protein; Tubulin/FtsZ
FT                   GTPase; KEGG: fnu:FN1451 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38234"
FT                   /db_xref="GOA:C7NE39"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE39"
FT                   /inference="protein motif:PFAM:PF03953"
FT                   /protein_id="ACV38234.1"
FT                   /translation="MNIENEKNVEIKVVGIGKTGNSALNEIIKAVEADFVAVSEKQENL
FT                   DLSEAGIKILVAEDFEKKIQKALENTDMLFILAETDEVENVKISTAVAKIAQSLDILTI
FT                   SIIAAPSEAEFAKTGKAELKQFADIVITVPTEKISEEINKIFIKNIKVIEDIIRERGIV
FT                   NLDFADVNSMLKNGGTAVLGYGIAAGENKEEVVVKQVLNEILEKSIKNARKILMNILAG
FT                   PEIGLDELSKITRALEKELEADEASIVWAYAMKPDMEGTVSITLIATDFSDE"
FT   gene            complement(317453..319120)
FT                   /locus_tag="Lebu_0316"
FT   CDS_pept        complement(317453..319120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0316"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; KEGG: fnu:FN0190 two-component sensor
FT                   kinase YesM"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38235"
FT                   /db_xref="GOA:C7NE40"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE40"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACV38235.1"
FT                   /translation="MKFKKTMKNSMLLQLFFYYLIGNLLFILFLSSIFYYTSKYLIMNK
FT                   EIEYTNKNVISTSRYITLYADKLKNMINLLSVDADVRNFLISGNEDSKKSIEKMIYSIL
FT                   DSNKGIKNITVIGKNGNIVSSDKNNDMKISENMMKEKWYVDAINNSDMPVFNPSRKNST
FT                   SSMNSALWFLSISRDIKNSKGENLGVIVFDIKYEILERYLNSISFGKQIDNIIVDKNNN
FT                   IIYYKDVKCFADKKCLAKFSEKNKNKDTYLYETQIENTNWNLRSLANTNDLVTLKKNFS
FT                   HIVIIIFLVSLAFSSIITFIVITKILRPLIKLENHMQNFENNLREFHLSEKTGYEIQNL
FT                   VEHFNIMVEKIKYLREYEIKALHSQINPHFLYNTLDTIIWMAEFKDNEKVINITKSLAN
FT                   FFRLSLSNGHEKIPLKDEIMHTKEYLFIQKQRYEDKLSYFFNIEDESLLSIEVPKIIIQ
FT                   PIVENSIYHGIKNLSENGIITIDVYRENSAINILIKDNGIGFEKAKQFKKSKTGGVGIK
FT                   NVDKRIKFYYGKNYGVFINKDNKTEGAEVIIKIPFKSI"
FT   gene            complement(319117..319899)
FT                   /locus_tag="Lebu_0317"
FT   CDS_pept        complement(319117..319899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0317"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART: response
FT                   regulator receiver; helix-turn- helix- domain containing
FT                   protein AraC type; KEGG: fnu:FN0189 two-component response
FT                   regulator YesN"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38236"
FT                   /db_xref="GOA:C7NE41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE41"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV38236.1"
FT                   /translation="MYSILIIDDEPIIRRGIKTFIDFEKYKISDVYEAEDGNSAFKTFS
FT                   EVLPDLVLLDINIPFKNGLTLAQEMKELKNDVKIAIISGYDYFEYAQKALKIGVEDYIL
FT                   KPVSKTDINEIISKLIYRLEETRKYNEARKIINKISHTEKTAKDVSYSKYKDILTKKIE
FT                   DKYSEISFNLNSLADEMNLSSGYLSSLFKNLFGIPFQDYLNNMRMEKAKLLLLTTDLKN
FT                   YEIGELVGIENFNYFNSKFKKTFGMTPKEFKKSVLEKL"
FT   gene            complement(319900..320370)
FT                   /locus_tag="Lebu_0318"
FT   CDS_pept        complement(319900..320370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0318"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   hip:CGSHiEE_04855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38237"
FT                   /db_xref="GOA:C7NE42"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE42"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACV38237.1"
FT                   /translation="MKKLIVTIVTLLSFGSISFGNTLQGVQLKDINNKPVSLNKYKGKK
FT                   IYIKMWASWCPICLSGLSEINSLSADKSKNFTVITIASPGQKGEKPTAKFIQWYKGLNY
FT                   KNTTVLLDEKGEVLKRAKVLGYPSNIILDGNLNIVKTLPGHLTAAQIKGAVK"
FT   sig_peptide     complement(320308..320370)
FT                   /locus_tag="Lebu_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            complement(320479..321117)
FT                   /locus_tag="Lebu_0319"
FT   CDS_pept        complement(320479..321117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0319"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: hiq:CGSHiGG_01145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38238"
FT                   /db_xref="GOA:C7NE43"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE43"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACV38238.1"
FT                   /translation="MFNQPLLVGSVFLGGVASFLSPCILPIVPVYLGILSKGKKTVLNT
FT                   FLFILGLSLTFVSIGFSFSFLTGIFFNDTIKVLAGILVIILGLHQTGILKFNFLEKNKS
FT                   VNLDLIEKNSSLQAFLLGLTFSLGWTPCVGPILASVLTLAGEKGSAVYGGLMMFIYVLG
FT                   LATPFVLFSFFSQELLKKVRTLNQYTNYFKIFGGFLIIFMGILLIMNKF"
FT   gene            complement(321142..322221)
FT                   /locus_tag="Lebu_0320"
FT   CDS_pept        complement(321142..322221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0320"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase A; Methionine sulfoxide reductase B; KEGG:
FT                   hin:HI1455 bifunctional methionine sulfoxide reductase A/B
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38239"
FT                   /db_xref="GOA:C7NE44"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE44"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ACV38239.1"
FT                   /translation="MKSRSLLLFLILSLALFSVVLSNKNKNRKNRNENKPKKENIIQTG
FT                   NENIREIYLAGGCFWGLEAYMERIDGVKDATVGYANGKTEKTSYNIVASTDHAETVHVK
FT                   YDANKISLSKLLKYYFQVVDPTSINQQGNDRGRQYRTGIYYTNPKDKEIILQEIEEEQK
FT                   KYTDKIQVEVQPLKNYILAEEYHQDYLRKNPNGYCHIDITKADEVIIDPKDYPKPSDEE
FT                   LKKRLTPLQYSVTQKKNTEHSFSNEYWDNHEAGIYVDITTGEPLFSSKDKYDSGCGWPS
FT                   FTKPISKDVVTYANDTSFNMVRTEVLSRSGKAHLGHVFDDGPKDKGGLRYCINSASIKF
FT                   IPLKDMEKEHYGYLIKLVQ"
FT   sig_peptide     complement(322153..322221)
FT                   /locus_tag="Lebu_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.520 at
FT                   residue 23"
FT   gene            322664..323222
FT                   /pseudo
FT                   /locus_tag="Lebu_0321"
FT   gene            323275..323898
FT                   /locus_tag="Lebu_0322"
FT   CDS_pept        323275..323898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38240"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38240.1"
FT                   /translation="MKDEIMSVIVNFAECTLDDFISDGFIKKLPIVGIAFSTIKIGKQI
FT                   HDRIFIEKLKSFIKYINENQKWKEKFSDEEECYKIAKQLLYIIDSCDDDDKLKLIGLAF
FT                   NSLVNGEVSKDEYFYIVSLISKSFYPFLKILLDIDESDKRFLNDGTKYDHTGITHLLNI
FT                   GVLDFDGQTMTLYNSQTGEIESPLSIVTLNKHSEFIKKLLSKLN"
FT   gene            324188..324682
FT                   /locus_tag="Lebu_0323"
FT   CDS_pept        324188..324682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0323"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; KEGG: fnu:FN0930 glycerol-3-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38241"
FT                   /db_xref="GOA:C7NE46"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE46"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ACV38241.1"
FT                   /translation="MGKSFKDNLLTADKMRDEIVRFQKAGKKVVFTNGVFDILHIGHLT
FT                   YLEEARNLGDILVVGVNSDASVKVNKGDKRPINSETNRAFVLLGTKFVDYTVIFNEKTP
FT                   EKLLDILKPDIHVKGGDYKKEDLPETKVVEKNGGEVKILSFVDNISTTEIINKIIEVYK
FT                   K"
FT   gene            325235..325687
FT                   /locus_tag="Lebu_0324"
FT   CDS_pept        325235..325687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0324"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   fnu:FN0929 ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38242"
FT                   /db_xref="GOA:C7NE47"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE47"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACV38242.1"
FT                   /translation="MKNKILTFDKIDKLAKKLAEKLRNGGCLGLIGDLGAGKTTFTKKI
FT                   CECYNVTENVKSPTFTYVIEYSSGDVPVYHFDVYRINDSEEIYEIGFEDYIGEEGSVVI
FT                   IEWADKILEEMPEDAVFVEINHYSDTAREVSVYTLKNGEKIDFEIE"
FT   gene            325729..326505
FT                   /locus_tag="Lebu_0325"
FT   CDS_pept        325729..326505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0325"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cbe:Cbei_0468 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38243"
FT                   /db_xref="GOA:C7NE48"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE48"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACV38243.1"
FT                   /translation="MLIFGITTTTKLAGLSLYENDKLLGEMHVEMAKTHSTTILEQIDS
FT                   LLKWTGKKLDEIENVIVSIGPGSFTGVRIAISVVKGLFFGRNVNFYEVNELDALGFQAY
FT                   YNLEKNSENNENVKIYSLIDSRKEKVYYAVYEILQKKGNFENENGKNKLKLEMVKSYEV
FT                   SKLDKIIEEIIENSKINNKVYMVGDAIFNYKEKILDKLGNYIKIFEDKNLKINTMTFVQ
FT                   MFLDENLKNADVMRKTDIFNLKPDYLEKSQAERDKK"
FT   gene            326505..327695
FT                   /locus_tag="Lebu_0326"
FT   CDS_pept        326505..327695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0326"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: fnu:FN1074 signal recognition particle
FT                   receptor FtsY; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; GTP-binding signal recognition particle
FT                   SRP54 helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38244"
FT                   /db_xref="GOA:C7NE49"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE49"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ACV38244.1"
FT                   /translation="MLKNFFKFGKKKKDEKQKETLENQIEKEIEDSQSEIDKIKAETEK
FT                   EIKETAEEILGKNHKKAEYKEKNLKTEKIENEMEKIEETSNEKTKSKPKLKPLKDRLAT
FT                   PKKGFFGKLKEMLLGKTINDDLYEELEELLIQSDIGMNMTMQLVEELESSVSRKKLKTS
FT                   EQIYDELKELLKAKLIYNDEENTKLKLKNGKLNILLVVGVNGVGKTTSIGKIAKKLKDS
FT                   GKKVIIGAGDTFRAAAIEQVEEWGKRTGVEVVKQAHGSDPAAVIFDTVKTAKNRGFDVA
FT                   ILDTAGRLHNKRDLMKELEKINKIIREQSGETDFETLLVIDSTTGQNGLEQARIFNEIV
FT                   DLTGIILTKFDGTAKGGIIFPITSELKKPIKFIGVGEGIEDLREFDKKEFVEAMFD"
FT   gene            327731..328735
FT                   /locus_tag="Lebu_0327"
FT   CDS_pept        327731..328735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0327"
FT                   /product="phosphate acetyltransferase"
FT                   /note="TIGRFAM: phosphate acetyltransferase; PFAM:
FT                   phosphate acetyl/butaryl transferase; KEGG: abu:Abu_0493
FT                   phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38245"
FT                   /db_xref="GOA:C7NE50"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE50"
FT                   /inference="protein motif:TFAM:TIGR00651"
FT                   /protein_id="ACV38245.1"
FT                   /translation="MNTLTEKLKEKAKKLNKTIILPESEDERILKATEKIIAEGIAKIA
FT                   LVGNEKTLKEKAEKIGVSLEGAIFYNPNSCATIDAMSELLKKRREKKGMTFETAKAILM
FT                   SDPRYFASMLVHQGRVDGMVAGSNSPTAHVLRAAIHVIGPRPGLKTVSSSFVMITNTPE
FT                   FGDNGTFIFSDGGVIPDPTAMQLADIAISAAEKAKFTAGIKEPKVAFLSFSTKGSADGV
FT                   SVSKVREAIEILKVRNVDFDFDGELQLDAAIIPEVAASKAPNSKVAGQANVLIFPDLDS
FT                   GNIGYKLTQRLAKAKALGPLIQGLARPVHDLSRGCSVEDIVEVVAITAVESEM"
FT   gene            328875..330071
FT                   /locus_tag="Lebu_0328"
FT   CDS_pept        328875..330071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0328"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: fnu:FN1171 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38246"
FT                   /db_xref="GOA:C7NE51"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE51"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACV38246.1"
FT                   /translation="MKVLVINCGSSSAKFELIDMTNEQSLAKGNCERIGIANPIFSYKN
FT                   LLTGEKIDKMEVPMENHTVAVELILKTLQDEKIGVISTVDEIDSIGHRIVHGGEYYEKS
FT                   VIVDDEVIKNLEEIAPLAPLHNPAHIMGIKVIQKLLPGKKNVVVFDTAFHQTMPAKAYM
FT                   YPYPYEDYTDLKVRKYGFHGTSHRYVSEVAREMLGKEDSKIIVCHLGNGASISAVQNGK
FT                   VVDTSMGMTPLAGVMMGTRTGDVDPASVIYIMRKRGLSLDEMNNRMNKKSGILGIIGTS
FT                   SDFRDLDTAKKAGDEKAILAYEMFCYRIQLYIGAYVAAMNGIDAIAFTGGIGENSVGAK
FT                   QYICDALSYFGIELDKEKNAQRLPGNVELSTKNSKVKIYKIETAEELVIARDTYKLTK"
FT   gene            330139..330561
FT                   /locus_tag="Lebu_0329"
FT   CDS_pept        330139..330561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0329"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   ckl:CKL_2165 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38247"
FT                   /db_xref="GOA:C7NE52"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE52"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ACV38247.1"
FT                   /translation="MATLNIIYYTGTGNTADMAKYIGEGAENAGAAVRLINVEEADESA
FT                   VNADFVAFGSPAGGAEEVAPEMVEFIEGIKDKILGKTVGLFGSYDWGQGGWMETWREEM
FT                   INEGFSIVNDGLIIHLAVDDDEKVEKCKEYGRVIVG"
FT   gene            330670..331431
FT                   /locus_tag="Lebu_0330"
FT   CDS_pept        330670..331431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38248"
FT                   /db_xref="GOA:C7NE53"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE53"
FT                   /inference="protein motif:COG:COG4399"
FT                   /protein_id="ACV38248.1"
FT                   /translation="MYLEFDKTNVLKQGVLTPCGKKLRLSNRSNDSLQDCSFNINMEEK
FT                   LGNLLIQLAIMVFVGILIGWFTNYLAIKLLFRPYKEINLLFFKIQGLIPKNRDRISVNI
FT                   AETIEKELISVEYITEKLKNGNAFNDDILDKLLDKIIGEKLKNSVLEKNPLLKMFLNDS
FT                   LIEKIKSYFKKSILENKEEIVEEIIKIAKDKINFKEIMLEKMKNFSLEEMEQIILSVSK
FT                   NELKHIEIIGGVLGGVIALFQFFIMLLLKQI"
FT   gene            331803..332816
FT                   /locus_tag="Lebu_0331"
FT   CDS_pept        331803..332816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0331"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: fnu:FN1217 Holliday junction DNA helicase B;
FT                   TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; magnesium chelatase ChlI subunit;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38249"
FT                   /db_xref="GOA:C7NE54"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE54"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACV38249.1"
FT                   /translation="MNEERILEPKELGEDNIQRSLRPRTFKEYIGQQDLKEKMNIFIKA
FT                   AKMRNESLDHILLYGPPGLGKTTLAGVIATEMGVNLKITTGPVLEKAGDLAAILTSLEE
FT                   NDILFIDEIHRLNTSVEEILYPAMEDGELDILIGKGPSARSIRVELPRFTLIGATTRAG
FT                   QLSTPLRDRFGVTHRMEYYQLEELKEIIRRGANILNISYDEDGITEIAKRSRGTPRIAN
FT                   RLLKRARDFALVEGSGVLEKESVDGILRLLGVDDNGLDELDRNILLSIINVYNGGPVGI
FT                   ETLSLLLGEDRRTIEEVYEPYLVKIGFIKRTPRGRVVTEFGYRHLGIEKIFGEKGK"
FT   gene            332854..333567
FT                   /locus_tag="Lebu_0332"
FT   CDS_pept        332854..333567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0332"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   fnu:FN1215 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38250"
FT                   /db_xref="GOA:C7NE55"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE55"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACV38250.1"
FT                   /translation="MLTVIAEKENIDENNGKILIKEKSDCNHIQNVYRLNIGDELRIID
FT                   GEYEYFTKIIEISKKEVAVKILEKNEDSYSLNINIDVAMGILKNDKMNLAIQKLTEIGV
FT                   KSIIPLKTERVVVRINEKKEKWDTVARETLKQCRGVKFTEILPVKKLAEIDYKKYDKII
FT                   FAYENSNESKSLSEIIKQKDKNILYIIGPEGGIAQEEVDFLKNNKAIEISLGKRILRAE
FT                   TAAIVVCGIIANFYM"
FT   gene            333730..334086
FT                   /locus_tag="Lebu_0333"
FT   CDS_pept        333730..334086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0333"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: bcy:Bcer98_3056 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38251"
FT                   /db_xref="GOA:C7NE56"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE56"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ACV38251.1"
FT                   /translation="MSEINNSYEKQVQEIIAIMEDKKAQDIKVYDMRGKSPFFDYSILC
FT                   TGSSSRNIEAIATDIKKSLDNVRNVEGLDEANWVLIDAGDMVISVFSKDARDYYRLDDF
FT                   YNGVNAEENKEEIE"
FT   gene            334148..336115
FT                   /locus_tag="Lebu_0334"
FT   CDS_pept        334148..336115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0334"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: fnu:FN1211 cell division protein FtsI;
FT                   TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38252"
FT                   /db_xref="GOA:C7NE57"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE57"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACV38252.1"
FT                   /translation="MRELDKEEKNVRLIAFIVFVGVVFFILIARLFVLQILNASEYAEQ
FT                   ALQNRIRTNVIKATRGEIYDREGKLLAKNTTGYQLMHSHTQSLEVKDVALLKEIKNMTA
FT                   EQIDARLSKERKMTAQRIKETIFDIRQISQLTNYPIDYLIDRFFKQQRIGTDKKILVIE
FT                   DLDKETAARAIEKIDNDRIDIVEYNKRFYPEDPIASHVIGYVKPISEKEFKELEKEGYR
FT                   NSDLIGKKGVERSYDKEMKGQDGKENVEVDAKGNVIRQMETTESVAGKNVYLSIDLELQ
FT                   KDMTDAFAGKSGAFIAMEAKTGKIITFVSNPEISLNLLSSRIPDNQWMELVNSKSKPLV
FT                   NKGIAGLYPPGSTFKAITGMGILESGISPSATVTSTGQYRFGHMIFRDSHKSGHGVTNF
FT                   LKSIEQSVNTYYYVFSQKVGIKNIVKYAKEFGIGSKTGIDIPGEMSGTLPSPEWKKRRF
FT                   KKKEDQKWLPGDLINMSIGQGYVLVTPIQIASAYQAIANNGLQLKPTVVDRFVSYTGKV
FT                   ENNGPKVVRKLKVSDKNLKLLQNALKLPVSGPGGTAKILKIANYPVSAKTGTAQNSGFG
FT                   DHHSWIAGYFPSDNPQIVFVSIVEGGGYGGVASGNMALRFILKYRDKYVLKKPQQEMKK
FT                   QEEEKKKAQEANNNKKLAKR"
FT   gene            336370..338043
FT                   /locus_tag="Lebu_0335"
FT   CDS_pept        336370..338043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0335"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: fnu:FN1210 metal
FT                   dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38253"
FT                   /db_xref="GOA:C7NE58"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE58"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV38253.1"
FT                   /translation="MDGKEEKMYVIPLGGIEEVGKNMTAFQYKDEIIVVDAGLTFPEDE
FT                   HLGIDVIIPDFSYLESNKHKIKGLLLTHGHEDHIGAIPYFYQKLGSENIPMYGGRLTLA
FT                   LARAKFEKKDAKLPKEKVISGRTILKVSKYFTVEFISVTHSIADCYAICIKTPAATILH
FT                   SGDFKVDLTPVDGEGFDFGRLAQLGEEGVDLLLSDSTNAQIPGFTPSERTVGESLKDEF
FT                   SKAEGRIILAAFASHVHRLQQIVNIATKHGRKIAIDGRSMVKIFEICSNLGYLKIPKDI
FT                   MIDIDKVETYPADRVLILCTGTQGEPLAALSRIANGTHKYISLREGDTVVISATPIPGN
FT                   EKAATKNINQLMKRDANVVFEKGIGIHVSGHGCQEEQKLMINLVKPKFFLPVHGEYAMI
FT                   KKHKELAIAVGVPEKNILLSENGAKLELTKSNFRSVGKVPSGAVFIDGFGIGDIGNAVL
FT                   KDRQNLADDGIVIISISQYRNGKFNKQVELVTRGFVYNKDAESLLSETKEIVKAELNSM
FT                   ENEGIKEIGKIKQKLRAKVGEFLNKETDREPIILPIIMEV"
FT   gene            338045..338383
FT                   /locus_tag="Lebu_0336"
FT   CDS_pept        338045..338383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0336"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   fnu:FN1209 putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38254"
FT                   /db_xref="GOA:C7NE59"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE59"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ACV38254.1"
FT                   /translation="MIQLSSKERAFLRKLAHNLEPIVRIGKDGIDENVLKSIAEVVKKR
FT                   ELIKVKILQNSSVEIDREMADEIARDTKSVFVDRIGKILIFFKPKTTKDAKITPEFNEF
FT                   RKSRKNKR"
FT   gene            338410..338871
FT                   /locus_tag="Lebu_0337"
FT   CDS_pept        338410..338871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0337"
FT                   /product="acid phosphatase/vanadium-dependent
FT                   haloperoxidase related"
FT                   /note="PFAM: acid phosphatase/vanadium-dependent
FT                   haloperoxidase related; KEGG: syn:slr1394 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38255"
FT                   /db_xref="GOA:C7NE60"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE60"
FT                   /inference="protein motif:PFAM:PF02681"
FT                   /protein_id="ACV38255.1"
FT                   /translation="MSGGILFGNRLLDVAAISCFSAQFYKVFFPVFKGQKPQWARLVQT
FT                   GGMPSSHASTVVSLVTGVFLLKGLSSIEFAISMVFAGIVLYDATGVRQQAGKHARALNT
FT                   LIDAIEHHEGIEIINEKFKELLGHTPVEVFWGSVLGIVIGLLFKGYILG"
FT   gene            complement(339024..339146)
FT                   /locus_tag="Lebu_0338"
FT   CDS_pept        complement(339024..339146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38256"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38256.1"
FT                   /translation="MECLPEIVNETGKSTNLPYLRGGECPIREVLKEISQSKIF"
FT   gene            complement(339260..340279)
FT                   /locus_tag="Lebu_0339"
FT   CDS_pept        complement(339260..340279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38257"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38257.1"
FT                   /translation="MSQKLFETLFRVYVKRVDDYFFHSNERKDKFKSKGFVKRTVTTAF
FT                   GDVTFERRKYVNKKTGIHYYIDEKIGLKRYRQLSEEMIFTILFEYQHTTASFLAKTYGI
FT                   SRATVYNLVNSFQMPKLNIERFERDDNSPVYMEIDEDHMKCRRSKNTYMRMVVIHRGIE
FT                   EISRDRNKLIDKHTIMFPTSVSLEEVSEYVLNYLEKRYNMDKKKLIVNSDGGIWIDSFV
FT                   RELGIYKPIHIYDKFHLVKAIAEISKRDKEISKNLYKWLKGDDFKELENFYENFKEKEN
FT                   VSQRRKDQTKMLFNQYEKIRRIYTEEDYIGSRTEALVSHECSRFLSSRPKEKHFQEER"
FT   gene            340793..341530
FT                   /locus_tag="Lebu_0340"
FT   CDS_pept        340793..341530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0340"
FT                   /product="hemolysin A"
FT                   /note="KEGG: aoe:Clos_1606 hemolysin A; TIGRFAM: hemolysin
FT                   A; PFAM: RNA-binding S4 domain protein; ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38258"
FT                   /db_xref="GOA:C7NE63"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE63"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ACV38258.1"
FT                   /translation="MKKRLDLILVEREFFETREKAKREIMAGNVIVNEQVVIKAGTMFK
FT                   DNDELNIRVKDKLKYVSRGGLKLEKAIKAWDLDFSDKLVLDIGASTGGFTDCALQNGAR
FT                   RVYSVDVGKNQLDWKLRNDEKVVSLEEMHIKDLKEEDIENKKVDFIVIDVSFISLTKVI
FT                   PYFKKFLAQSGKIVMLVKPQFEVGREKIGRNGVVENEEYHNEAIKKIISFSKEEGYELI
FT                   GVEDSPIKGAKGNKEFLMLIKSN"
FT   gene            341585..342886
FT                   /locus_tag="Lebu_0341"
FT   CDS_pept        341585..342886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0341"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: fnu:FN1205 protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38259"
FT                   /db_xref="GOA:C7NE64"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE64"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACV38259.1"
FT                   /translation="MKKNKILQAVLGLVLVSMPLFAATTIIKTSRNDKNTSAGYTKDST
FT                   ELNRIVDVINIIENNFVGKEATPSKKELYEGAVAGVVSRLKDPYSEYLSKADLADFSED
FT                   MEGEYVGVGMSINKKKGEALEVVSPFIGSPAEKVGIKIKDKVTKVDGKDILPLTANETV
FT                   KLLKGKEGTKVDVEVVREGKKEPMKFTLTRAKIKLEMVESKMLENNIGYVSLLRFGNHV
FT                   GAEVEKAIKDLQGKGMKGLILDLRSNPGGSLQEAQDIASLFVKEDLIVYLKYKNGQQRN
FT                   YNRTSKNLGNFPLIVLTNKASASASEIVTGAIKDYKRGTIIGEKTFGKGIVQQVIPLRT
FT                   EDAIKLTIAQYFTPKGNYIHEKGIEPDIEVKMEELLTLKGYANDSEQARKNREKEIEDI
FT                   IIKDKGKEEAAKIISAGDVQLKRAIQEMNKKIKK"
FT   sig_peptide     341585..341653
FT                   /locus_tag="Lebu_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            342915..343613
FT                   /locus_tag="Lebu_0342"
FT   CDS_pept        342915..343613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0342"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: fnu:FN1204
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38260"
FT                   /db_xref="GOA:C7NE65"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE65"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACV38260.1"
FT                   /translation="MFYVVGTPIGNLEDITFRAIKVLKEVDYIFAEDTRVTKKLLSHYE
FT                   IEKTVYQYHEHNKLHQITNIINLLKDEKKIALVTDAGTPCISDPGFELVNEILKAGIKV
FT                   VGIPGASSIVTGASISGLDMRRMAYEGFLPKKKGRQTLFNKLKEEERTIVILESPNRIL
FT                   KTLKDIKDYLGERYVVITRELTKIYEEIIRGTVSEIIEKLEEKPIKGEIVLFIRAINDD
FT                   GVYLKTIKTE"
FT   gene            344384..345259
FT                   /locus_tag="Lebu_0343"
FT   CDS_pept        344384..345259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0343"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   fnu:FN1203 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38261"
FT                   /db_xref="GOA:C7NE66"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE66"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACV38261.1"
FT                   /translation="MNINWYPGHMKKTKDLIVENLKIIDIVIEILDARIPLSSKNPDIS
FT                   KLANNKKKIIVLNKVDLVDSKELKVWEDYFLENKFSDYFVALSVEKGTNFNELRKITDK
FT                   IYAEKLEKMKKKGLRKTEVRAMIVGIPNVGKSKFINKFVNKNKARVGNTPGFTRGKQWI
FT                   KIDEKLELLDTPGVLWPKFEDDEVAYNLAITGSIKDNVLPLEQIAMKFLDKLKDLGKID
FT                   NLIKVYNLQENINTEEILKMENHKILEVLEKRLGISKNDEHNYEIISRRLIRDYRIGKI
FT                   GKFFLEYPKK"
FT   gene            345353..346609
FT                   /locus_tag="Lebu_0344"
FT   CDS_pept        345353..346609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0344"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tde:TDE2034 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38262"
FT                   /db_xref="GOA:C7NE67"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE67"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV38262.1"
FT                   /translation="MRIGIFTDTYRPQVNGVVSSIMTLEKELRKLGHKVYIITTTDPDA
FT                   PKVEPNVLRLPSMEFKPLPQYRLGMVYSSRIIKKIKKLELDIIHSQTEWGVGTFSRFAA
FT                   INLEIPLVHTYHTLYEYYTHYIFGSRFVSAGKKIAAAISKFYCEKCNALIVPTRKVEDI
FT                   LYSYGVDQTMNIIPTGLELDKFYRGNYSDEDLEFMRESFGIEKNDFLCVYIGRIAEEKS
FT                   IDMLIDMFSKIKDKNFKFMIVGRGRILDDLKAQAGKLGILDRVIFTGEVPHDKVAAYYQ
FT                   MGDVFLNASISETQGLTFVEAMAAKVPVVARYDLNLEDLLVKNEAGLVYKTEKEFIDSI
FT                   MLLKEDKEFREKIIKNAFAASQDYTAQKFGERVEAVYKKTIEEYDSRESFTIFRGEKFL
FT                   QQIRRWTSIKSSGRSPWSK"
FT   gene            346512..347543
FT                   /locus_tag="Lebu_0345"
FT   CDS_pept        346512..347543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0345"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tle:Tlet_0010 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38263"
FT                   /db_xref="GOA:C7NE68"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE68"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV38263.1"
FT                   /translation="MKVLLYSEGKSSFSKSGVGQALNHQVEALGANNIEVTQDPEDDYD
FT                   LAHINTVALKSYEVLKQAKKKGKPVIYHTHTTYEDFRGSIKGSYVLSPIIKFWTKKLYN
FT                   EADYLISPSEYTKNLIKSKYLEKEKEIRVISNGVNINKFNKNEILKEKFLNEYKSVYDI
FT                   SKPLIITAGLPFERKGIKDFVKVTEKCSDYQFLWFGSSSVKSMLPEKIQKIIENPPKNL
FT                   IFPGYVDKDILIGAFSAAKAFLFMTYEENEGIVVLEALSAKLPLVVRDIPVYEDWLEDG
FT                   KTCFKARTNEEFCEKIRNIVENNVENLDEITETAYNIAAERDLLNIGKKYKEYYEYILN
FT                   QKK"
FT   gene            348044..348325
FT                   /locus_tag="Lebu_0346"
FT   CDS_pept        348044..348325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0346"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   fnu:FN1972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38264"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE69"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACV38264.1"
FT                   /translation="MAGIVKNQGGLAFSGDNYKVVKEILDSGEKIPLHNHEGEDVVISV
FT                   LKGKLEIHLNDDEIHTLVPGDIIGFDGKNLVKGTALEYTEFNETLIKK"
FT   gene            348599..349381
FT                   /locus_tag="Lebu_0347"
FT   CDS_pept        348599..349381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0347"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: bpu:BPUM_0340
FT                   L-cystine ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38265"
FT                   /db_xref="GOA:C7NE70"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE70"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV38265.1"
FT                   /translation="MKKIKLLLGVLLLLILAVSCGNKANARKKRVIKVGTDGVYAPFSF
FT                   KDESSGKLTGYDVEVIQEVGKRINADIEFTTVPWDSIFLGLESKRYDIIANEIEKTKER
FT                   EEKYIFSDKYLVSAAQIIVKEGENNIKTLKDLEGKRVISAVGSNYSKTVEEYNKTASKK
FT                   IDLNYFDGGITLTLVEIAQGKADATLSDRLVVSYYKKQQGDKVQLVGEPLSTTPTFFLF
FT                   RKDSEELRNEVNKALAEMRADGTLAKISEKWFGGDYTK"
FT   sig_peptide     348599..348679
FT                   /locus_tag="Lebu_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.557 at
FT                   residue 27"
FT   gene            349442..350233
FT                   /locus_tag="Lebu_0348"
FT   CDS_pept        349442..350233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0348"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: bpu:BPUM_0340
FT                   L-cystine ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38266"
FT                   /db_xref="GOA:C7NE71"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE71"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV38266.1"
FT                   /translation="MKNILKITGILLIGLFLISCGGKQENSKSGSSEGKQKVKVGTEGV
FT                   YAPFTFTDGSGKLTGYDVEVVEEIGKRANLDIEFVPTPWDSMFLGLESKKFDFIANEIA
FT                   KNPEREKKYTFSDDYLVSAAQIIVKKGRTDIKTLEDLKGKRVMTGVGSNYNKTLTDFDK
FT                   NKEINYAYFDGNVSIALEEIAQGKADATLNDRLTVGYFTKQRGNLVEIVGEPVTKTPVY
FT                   FTFRKDSEELKNKINKALAEMKADGTLAKISEKWFGGDYTK"
FT   sig_peptide     349442..349510
FT                   /locus_tag="Lebu_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.265 at
FT                   residue 23"
FT   gene            350255..350968
FT                   /locus_tag="Lebu_0349"
FT   CDS_pept        350255..350968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0349"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: llm:llmg_1591
FT                   putative amino-acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38267"
FT                   /db_xref="GOA:C7NE72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE72"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV38267.1"
FT                   /translation="MNNNVPFLNWGFMVRAIPEILKALPMTLNIAIVTMIFSLILSFFI
FT                   ALVRINKIPVLTRLATIYVSFIRGTPLLVQIYLAYYGLPKILDYIHLKYGFNIDVNNIP
FT                   AIIFVYVAFILNVSGYLSETFRAAIQSVDKGQVEAALSIGMTKWQAMRRIVLPQAIIIT
FT                   FPNFGNTFISLIKDSSLAFTVSIVEMMGKAKIISASGLDIFEAYIVVAGIYWVVCIIVE
FT                   KVMGIVEKKLRVGGL"
FT   gene            350970..351728
FT                   /locus_tag="Lebu_0350"
FT   CDS_pept        350970..351728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0350"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cac:CAC0879 ABC-type polar amino acid transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38268"
FT                   /db_xref="GOA:C7NE73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE73"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38268.1"
FT                   /translation="MIKVENLKLSFGKNEVLKGINFKIERGQVISIIGPSGSGKSTFLR
FT                   SLNFLETASSGTITFGNETFDLSKINKKDINRLRKNTTMVFQNYNLFKNKTALENVIEG
FT                   LLIVKKMNRNEATEIGLKMLEKVGLKDKAEFYPNQLSGGQQQRVGIARAVAMSPDVILL
FT                   DEPTSALDPELIGEVLKVIKDMVKENMTMIIVTHEMQFAREVSDYIVFVDGGTIIAEGK
FT                   PEEIFVNSQNQRLQNFLKRYSESETDIYSI"
FT   gene            352553..353212
FT                   /locus_tag="Lebu_0351"
FT   CDS_pept        352553..353212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0351"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: cbe:Cbei_2510 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38269"
FT                   /db_xref="GOA:C7NE74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE74"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV38269.1"
FT                   /translation="MDFNFIIENIPKYLEAMKLTVSIGIMGIIFSILIGIICALILYYK
FT                   VPVIKQVVEIYIELSRNTPLVIQLFFLYFGLPKIGITFNSYICAVLGLSFLGGSYMCEA
FT                   FRSGLESVTKGQRESGLSIGLTESQLITNVILPQAFTVSFPAIAANIIFLLKETSVIGI
FT                   LALMELMYLTRDLIGLYYKTNESLFMLVAAYLIIILPVSFILTVIERRIRYATVGN"
FT   gene            353193..353870
FT                   /locus_tag="Lebu_0352"
FT   CDS_pept        353193..353870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0352"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: cco:CCC13826_0662
FT                   SugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38270"
FT                   /db_xref="GOA:C7NE75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE75"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV38270.1"
FT                   /translation="MQLSGIDVIFKGVNLQRLMGGLVVTGQIALVSIVFSILLGLILGI
FT                   VMTSKNKIIYGVLKFYLESMRIIPLLVWLFIIYFGVAKGFDLHIDSETTTIIVFVIWGT
FT                   AEMMDIVRGAIISLPKIQGESAKALGLDTIQVYRYVLLPQAVRRIAPAAVNLITRMIKT
FT                   TSLAIFIEVAEVLKIGRQIIEFSSRKNPMAPFWVYLFIFFLYFIICYPITLLSKKMEKK
FT                   WAV"
FT   gene            353898..354680
FT                   /locus_tag="Lebu_0353"
FT   CDS_pept        353898..354680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: asu:Asuc_1949 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38271"
FT                   /db_xref="GOA:C7NE76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE76"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38271.1"
FT                   /translation="MADSEVLLELSDIKKEYKKGVLALKGVSLSVNKSEVVVILGPSGC
FT                   GKSTLLRCVNGLEEIQSGEIKLQGNVINKDKTKWHLIRQRIGMVFQSYELFDHMTVMQN
FT                   LLLGPLKVQKRDKKEVTEQAEKLLERVGLLDKKNSYPRELSGGQKQRIAIIRSLCMNPE
FT                   IMLFDEVTAALDPEMVREVLDVMLELAKEGMTMIIVTHEMEFAKAVADRIVFMDSGEIV
FT                   ETNYPLEFFRNPKTERAKKFLNIFNFEKKDKMESALLI"
FT   gene            354739..356004
FT                   /locus_tag="Lebu_0354"
FT   CDS_pept        354739..356004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0354"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   sen:SACE_5070 Na(+)/glutamate:H(+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38272"
FT                   /db_xref="GOA:C7NE77"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE77"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACV38272.1"
FT                   /translation="MKKLLGFRKLNLLAQILIGALLGILVGQLFPSFAKELKILGVLFT
FT                   SLVQMVIVPLVFPLVVLSIVTMKNTKKFGNLAFKTFLHFFSITTLVITLSLILGKVTGI
FT                   DANIKAGSISTEAIKDVASNINLSDFLTSIVPKNVFTAFADGNLLPVIFFAVFLGIALI
FT                   AVGDDNKPVIAFFESWIKAMYKIVDYAIAFAPVGVFGLIASNVAKTGLGDLYLLGQFVL
FT                   LLYVGYLAALLVVFPIIAYIFKVPYLKLLSNIKDLVLIAFTTGGSAVVLPTLLERSEEN
FT                   GISESVSAFATPLGYSFNLIGACIYISLSVTFITNLYSTPLTWGQLIPLILFLTIITKG
FT                   IAAVPSGALVVLLATAAQLNLPAEGIALIVSVDFLANAGRTAVNVVGNTLVPAIIEKTA
FT                   EYEVVETEEVYAGLRENAAVVE"
FT   sig_peptide     354739..354843
FT                   /locus_tag="Lebu_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 35"
FT   gene            356037..356984
FT                   /locus_tag="Lebu_0355"
FT   CDS_pept        356037..356984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0355"
FT                   /product="RimK domain protein ATP-grasp"
FT                   /note="PFAM: RimK domain protein ATP-grasp; KEGG:
FT                   bwe:BcerKBAB4_0879 RimK domain-containing protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38273"
FT                   /db_xref="GOA:C7NE78"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE78"
FT                   /inference="protein motif:PFAM:PF08443"
FT                   /protein_id="ACV38273.1"
FT                   /translation="MSKVYIIHENMDWTRHLTARLEELSVPYEELDLSEGILNIGKEPE
FT                   KGVYYNRMSASSHTRGHRYAPELTEQVLTWLENKGTEAVRVINGTSAINLEVSKLKQYI
FT                   LLQKAGINTPKTLGAVGKDQILNAAKELDTYPFIIKHNRAGKGLGVRLIRSYEELDNYV
FT                   NGNDFEDSVDGISLIQEYVKPVDGHIIRAEFIGGKYLYAVKVDSSDGFELCPADSCQIN
FT                   DKFCPVGEEAAEKSKFRIIERLPENQIEEYEKFLKENHIDVAAIEFIINENNEVFVYDI
FT                   NTNTNYNADAEKIAGKYAMLELAKYLKDELKKLG"
FT   gene            357022..357870
FT                   /locus_tag="Lebu_0356"
FT   CDS_pept        357022..357870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0356"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ccv:CCV52592_0290 acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38274"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE79"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV38274.1"
FT                   /translation="MKKNFERLVKIIAILVLGVFAISCGKGGKGSAEPGSIEAIKKAGK
FT                   IRIGVFGDKPPFGFVDENGKNQGYDIYLAKRLAKDLLGDENKIEFVTLEAANRVEYLLS
FT                   NKVDIILANFTVTDERKQKVDFAKPYMKVSLGIVSPEGAPIKDVKELKGKKLIVNKGTT
FT                   AEIYFTKNYPDIELLKYDQNTETFNALLDKRGAALAHDNTLVFAWATENPGFVVDIKQL
FT                   GEQDYIAPAVRKGNKELLDWLNTEIDALTKEGFFEKAYKATLEPVYGNKVDPKTVIIEN
FT                   K"
FT   sig_peptide     357022..357099
FT                   /locus_tag="Lebu_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.295 at
FT                   residue 26"
FT   gene            complement(357957..358421)
FT                   /locus_tag="Lebu_0357"
FT   CDS_pept        complement(357957..358421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38275"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38275.1"
FT                   /translation="MKKKLCMLMTVLAISAVSYAKGSTAAETNTQNVQQDQEFPGGLAK
FT                   GIDQKFTTDGKLHAEKFLNKTFSYPDTSDSFKIQKDSKGYFITQYIDASPEHDGSGPIK
FT                   EEKIRLKLEKNVFLKEIADDADYAYAYDTKLKKVVIINPYNNYKIMFVVD"
FT   sig_peptide     complement(358359..358421)
FT                   /locus_tag="Lebu_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 21"
FT   gene            358761..360926
FT                   /locus_tag="Lebu_0358"
FT   CDS_pept        358761..360926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0358"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: fnu:FN0065 transcription accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38276"
FT                   /db_xref="GOA:C7NE81"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE81"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACV38276.1"
FT                   /translation="MDIVGSVAKELNFKVPQVENTIKLFDEGATVPFIARYRKEVTGNL
FT                   DEEQIRDVIEKITYYRNLEKRKEEVIRLIEEQGKLTEELQKSIVNAMKLQEVEDLYLPY
FT                   KKKKKTKADIAKEQGLEPLSEFALAKGTTMEQLEKEAEKYVTEEVADVKAAIEGVHLII
FT                   AQDISENIKIREFLRDKIAKFGILTSKVIEKNKENDEKGVYQDYYEYSEQIGRSASNRI
FT                   LALNRGEKEKILKVDIDIDEKNEETIINFILNTFENKNLTEFFRGVIKDSLDRLAYPSI
FT                   KNEVRNIYTEKAEEEAINIFSENLEKLLLQPPLAKKTLMGLDPGYRTGCKMVIINKDGF
FT                   YETNDVLFLVDGVHNERQLATAKKKILDYVAKYDVDIIAIGNGTASRETEAFVADLIKE
FT                   MKKKVSYLIVNEAGASIYSASKLAIEEFPDLDVTARGAISIARRIQDPMAELVKIDPKS
FT                   IGVGMYQHDVNQKKLNETLEQTIEHVVNNVGVNINTASWALLSFVSGIKKNVAKNLVDY
FT                   RHENGDFKDRKQLKKVKGLGDKAFEQMAGFVVVPDSENPLDNTIIHPESYHVAEIILKE
FT                   AGCKVEDLKADLDAVRQKLQKIDLEKIIKENDFGRETAKDVYEALLKDRRDPRDEFEKP
FT                   LLRSDILNMDDLTEGMVLEGTVRNVAKFGAFVDIGLKNDALIHISEIAEKFVSDATKEL
FT                   SVGQIIKVKILSLDKERGRVGLTRKGI"
FT   gene            361061..362638
FT                   /locus_tag="Lebu_0359"
FT   CDS_pept        361061..362638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0359"
FT                   /product="L-lactate transport"
FT                   /note="TIGRFAM: L-lactate transport; PFAM: L-lactate
FT                   permease; KEGG: cbh:CLC_1058 L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38277"
FT                   /db_xref="GOA:C7NE82"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE82"
FT                   /inference="protein motif:TFAM:TIGR00795"
FT                   /protein_id="ACV38277.1"
FT                   /translation="MEFLVGLIPIILFLILLAVLKKSALFSTYASLIVAIILNFVMSSW
FT                   RIPVQGIIASLFEGFAVAWMPIGFVIIAAIFAYDLSVKNGKIEIIKTMLGNITSDRRAQ
FT                   ALILAWGFGGFIEGIAGYGTAVAIPAAIMISLGFSPMTAAMICLLANSTPTAFGTVGLP
FT                   VTTMISNFGLNAQQTALFTSLLLLLLTCVIPFILVVFANKEIDGGKNPAFGKGILPVII
FT                   ASIIGYMVQPLIAMATGAELPTIISSLIAMILMIVATKMFVKAEEGFETVAVSTKDAIL
FT                   AWLPYILMVVLIVGTSPVVKVINEPLHEHTISTIDFSFGHWATWFRDAKSAKDAGVAFK
FT                   WILAPAAPLFVATVIAGFIQKVKVKDMVEVLGHTIYHKLDKMLVIMGIVALSVVMKHSG
FT                   MTASIASGLKTLTGSGFPFIAPFLGTIGTFVTGSDLSSNLLFGGIQVGVAKGLSQNPAL
FT                   QSLLIAANTAGATGGKMISPQNIAIVTSVSAALNGKDGELLGKTIKYSVLYGLVLGVLT
FT                   FVGAGMIH"
FT   gene            362856..365648
FT                   /locus_tag="Lebu_0360"
FT   CDS_pept        362856..365648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0360"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG: fnu:FN0067
FT                   isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38278"
FT                   /db_xref="GOA:C7NE83"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE83"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACV38278.1"
FT                   /translation="MSENNNVEDKVDYAKTLNLPKTSFKMKANLAQKEPLTLRDWKKAE
FT                   IYEKSLNEGAPFFVLHDGPPYANGDIHIGHALNKILKDIILKYKRLRGYNAPYIPGWDT
FT                   HGLPIEWKIMEELGEKAKNMTPLQIRQECKKYALKWVEKQKEGFKRLGILGNWDNPYIT
FT                   LRPEYEAEQLKVFKEIYENGYVYKGLKPVYWSPTTETALAEAEIEYKDVESHSIYVKFE
FT                   GTQDLLDKLGVEEASILIWTTTPWTLPANLGVFLHPEFDYGLYKTEKGNIVVAKELAET
FT                   VFKTLGISYELLKEFKGTELEKTHYRHPFLDREGLVMLGDYVTVDAGTGAVHSAPGHGA
FT                   DDYNYSRKYELGVLSPVDDRGHMTKEAGKYEGMFYAKASNVIVQDLTESGHLLHHSKFV
FT                   HSYPHDWRSKKPVIFRATEQWFISVDESDIRENAIKALDDVEFVPSWGKNRIGSMLETR
FT                   PDWTISRQRVWGVPIPLFYNRATDEVIYEPEIMDRVIEMVKKEGTDIWWKYEAKEIIGD
FT                   ELLEKYNLKDVDIRKERSIMDVWFDSGVSHRSVLVPRNLPRPADLYLEGSDQHRGWFQS
FT                   SLLTSIASTKDAPYKRILTHGFTMDGQGRKMSKSLGNTILPKDITEKYGADILRLWVSS
FT                   VDYREDVRISENILQQMSDAYRRIRNTARFLMGNLNDFDYANDKVDYNDMFEIDKWAMH
FT                   KLEELKAKTTEFYDKYEFYSLFQEITYFCSMEMSSFYLDIVKDRLYCEGTTSIERRSTQ
FT                   TVLTEVLKVLVRIIAPVLSFTADEIWERIPETLKEEESVHLSKWIEARPEYLNEELAQK
FT                   WDKIARLRREVNKKLEAERQNGLIGHSLDARVILNIANDEYSFIKDYTENEVSDLFIVS
FT                   QVKFVNDNLAESEIEGINIAVEKASGEKCERCWKYDEEVGHNHNHPDVCPRCAGVLEEM
FT                   "
FT   gene            365756..366223
FT                   /locus_tag="Lebu_0361"
FT   CDS_pept        365756..366223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0361"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: fnu:FN0068
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38279"
FT                   /db_xref="GOA:C7NE84"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE84"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACV38279.1"
FT                   /translation="MPYIIIILVLAALDQITKQLMYNVSGGVQGFSIPIIDKFFHLTYV
FT                   ENHGGVFGLLQGKINLFTIASAVLIIYVIAVEYKNFKNYSKWTKIGVVVIAAGATGNMI
FT                   DRILRGYVIDMIDFRGIWAFVFNVADMYVHIGIYIIVIDYLTRKYFKNSKK"
FT   gene            366627..367502
FT                   /locus_tag="Lebu_0362"
FT   CDS_pept        366627..367502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0362"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: fnu:FN0069 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38280"
FT                   /db_xref="GOA:C7NE85"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE85"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACV38280.1"
FT                   /translation="MTFQEIILTLQKFWGDKGCIISNPYDIETGAGTFNPDTFLMSLGP
FT                   EPWNVAYVEPSRRPKDGRYGENPNRVYQHHQFQVIMKPSPENIQELYLESLVALGINPK
FT                   EHDIRFVEDNWESPTLGAWGLGWEVWLDGMEITQFTYFQQVGGLEVDIVPSEITYGLER
FT                   IALYLQNKDDVKDLEWTKGVKYGERRFQFEYELSKYSFEVADVPMHFQLFDMYEKEAQN
FT                   CLNNDLVFPAYEYVLKCSHTFNNLDARGAISTTERMSYILRIRDLAKKCAEKFVEARER
FT                   LGFPLLNKNN"
FT   gene            367546..368829
FT                   /locus_tag="Lebu_0363"
FT   CDS_pept        367546..368829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0363"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: fnu:FN1701 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38281"
FT                   /db_xref="GOA:C7NE86"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE86"
FT                   /inference="similar to AA sequence:KEGG:FN1701"
FT                   /protein_id="ACV38281.1"
FT                   /translation="MKLSIKNVGRLKEADVEINGITVIAGENNTGKSTVGKVLWSIFSS
FT                   FYKINEQIAIEKQESIEKVIFNSFLDSMYQDNMGYLDPFYNEEKEKENIKKVSKKIVNT
FT                   FENIKDDTELKYYLINTLNKIIYSDVNASNYKIDEIVKILRITNDRIGEIAILKRLLKE
FT                   FNNQINNIYSEAEAEMELIIKDKSLKIVIEDNKIKDLREDIYVNTEVFYIDDPHIVDEL
FT                   EEISMEKIKFSHRGQLIENLLNVEKESVINELLAEDRWEKINDKLNDIIQGKFTRKKNG
FT                   RSFFYEEKNGYEKINVKNLSMGLKVFTIIKLLIQNNSLKENGTIILDEPEIHLHPEWQI
FT                   KFAELIVLLQKEFGMHILLTTHSPYFLKAIQVYSKKYEISDKCKYYMSELDGEQAILVD
FT                   KTSKTDDLFYKLAISFENLMNEEELYED"
FT   gene            368819..369349
FT                   /locus_tag="Lebu_0364"
FT   CDS_pept        368819..369349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38282"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE87"
FT                   /inference="similar to AA sequence:KEGG:FN1700"
FT                   /protein_id="ACV38282.1"
FT                   /translation="MKISDLRIECKSTLKKTSKDDSNNYMTNSDLQVIDFDCLKDKYIG
FT                   KIEFNGLGVKSNDALFIKGKNYVFIEFKNGEMKNIKEFELHKKIYDSVLIFCDIFDKTL
FT                   KDTRKELDYILVANFSNSERNDKKLLDNLLKTVKIEERLRAGLRNFKDYCFKNVHTYSK
FT                   EEFEEKFVKKMEN"
FT   gene            369406..371442
FT                   /locus_tag="Lebu_0365"
FT   CDS_pept        369406..371442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0365"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: fnu:FN0070 glycyl-tRNA synthetase beta chain;
FT                   TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38283"
FT                   /db_xref="GOA:C7NE88"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE88"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACV38283.1"
FT                   /translation="MNFLFEIGLEELPAQYVDKAEKDLKKIIENELKAERIKFSGIESF
FT                   STPRRVTAIIKDLAEKQDDLDKKSVGPSVEIAYKDGQLTKAGEGFVKSQGATADDIKII
FT                   ENEKGKYISIEKFIAGKNTREILPEILKNAIKKIEFEKSMKWADRTFRFVRPIKWFVTL
FT                   FDNGEILPFEFEGLKGGNKTRGMRYFASQDIEINNPLDYEKILLENFVIVDGEKRREEI
FT                   LKSIRENGENDGDTAIINKYLLDEVVNVVEYPYAIKGEFSKDYLELPEDIITITLETHQ
FT                   RYFPVKDKDGKLSNKFIVIRNAPEYSETVKKGNEKVVEPRLADAKFFFDEDLKNKFADN
FT                   VEKLKEVTFQKDMGTIFEKVKRSEKIAEYLISELNLTDKKENIIRTVDLAKADLVSNVI
FT                   GEKEFTKLQGFMGSVYAEKQGEDKDVALGIFEHYLPRYQGDELPTTVEGAIAGIADKMD
FT                   TIIGCFSVGLKPTSSKDPYALRRATQGIIQVVLNSKLSFNYKKLIEKAYEIFSADKKVL
FT                   EKDVVKDVTEFFKQRIINVLSEKYKKDLINYEINLESNVVELDKKLSELLKLSQTENFE
FT                   ILINLLKRVKNIVKDEKNITTDVIFELFESKEEKALLDFANKLESMENNEFSNYIEELL
FT                   NNADTINQFFDNVIINVDNGKLRTNRIALLKKLELSIDKMINI"
FT   gene            371813..372913
FT                   /locus_tag="Lebu_0366"
FT   CDS_pept        371813..372913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0366"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: lch:Lcho_0958
FT                   OmpA/MotB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38284"
FT                   /db_xref="GOA:C7NE89"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE89"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACV38284.1"
FT                   /translation="MKKLVILGTALLALNAVASEVQIKSGYDFYRKFKSGSAEDFSVKR
FT                   GPVVGVEYIIDNQGEFEWGLGAEYKFSNTSGKLKEKVNDNKIARSAPVYALGKFNLITT
FT                   NSGNDALYVLGRAGYNFAHESKEWDKNISGGLYVAAGLGTEFGPVSVEAIYERSSLKEK
FT                   SAGQGTRTRDHVDSAGLRLGYRFGQLKNDRAPKVITQIVNVPVPTPVPTPVPEPTPVPE
FT                   PTPTPIPNTAVLPFSCSANERKCVIRGFKVDGRIPNEREAGDLRAIAGVINQFADGGSI
FT                   DFVGHTDSTGSDAYNQKLSVARAQNVARLLREYGLKNTISYGTITGQGESNPADTNDTT
FT                   DGRYNNRRVELFFQNVDFSNVRFINQ"
FT   sig_peptide     371813..371869
FT                   /locus_tag="Lebu_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            373065..373502
FT                   /pseudo
FT                   /locus_tag="Lebu_0367"
FT   gene            373523..373816
FT                   /locus_tag="Lebu_0368"
FT   CDS_pept        373523..373816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0368"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: fnu:FN1782
FT                   phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38285"
FT                   /db_xref="GOA:C7NE90"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE90"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACV38285.1"
FT                   /translation="MKEIIVEIKNEQGLHARPAALIANIAKKYNVKLEIEKIGENEVID
FT                   GKNVMGIMILGAAKGEKLKLKAVSENENSIEEENRLLEELRQLIEIDKFFEK"
FT   gene            374175..375977
FT                   /locus_tag="Lebu_0369"
FT   CDS_pept        374175..375977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0369"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: fnu:FN1781
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38286"
FT                   /db_xref="GOA:C7NE91"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE91"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACV38286.1"
FT                   /translation="MDEREFEVLLEDYLPEEKKSGDVVEGVITRKELDYGFLDLNAKKE
FT                   GRIYAHEVQDFEIGDKIEVKVLREDDDNIIVSKFMLDKAKELASFNVDDIVTGEISRKI
FT                   KGGYTVKIGKNEAFLPFSLARFEKDKDYTGQKFKFLIREKNKSNITISRSDLIKLEEEK
FT                   YFESVNIGDIVTGKVKEVFDFGIILDLGAASGFIHISEVSWEQVDNLTEKYKKGDEISA
FT                   KIIEKDAEKNRLKLSIKQLSEDPWINFAENHNVGDVVEAVVKDVLDFGIVATVDGNSGF
FT                   VHISELAWHNGAKELKNYKEGDKFSAKIIQIENEKKNVKLSVKQLSENPWNTVKEKYHI
FT                   GDIIEKPITEVFDFGLLISLEKDIDGLLHVSDLSYKRESNLTSKYKAGDLIKFKIVDFN
FT                   DEKNRITLSAKALLDDRWEVLEETYDFDNTFTGKVMNVQDYGIFVELEKGIEVFIHRNE
FT                   FSWDKREHKKYKVGDEVEFKVIIVDKLDKKLSGSIKQLEKSPWKEATEQCKKGNVINTE
FT                   IVEIQENFVLVKLTDRFNGIVPKRELSEEFLKDISEKFSIGDKVQAVITDINEKRKSIA
FT                   LSVKKVKEQEEKKELDELMKVYGV"
FT   gene            376107..377045
FT                   /locus_tag="Lebu_0370"
FT   CDS_pept        376107..377045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0370"
FT                   /product="Branched-chain-amino-acid transaminase"
FT                   /EC_number="2.6.1.42"
FT                   /note="PFAM: aminotransferase class IV; KEGG: lbl:LBL_0002
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38287"
FT                   /db_xref="GOA:C7NE92"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE92"
FT                   /inference="protein motif:PRIAM:2.6.1.42"
FT                   /protein_id="ACV38287.1"
FT                   /translation="MAKTEFMKFAYFDKEIVEFEKATVSIATHSLQYGTTCFGGIRGYY
FT                   RNGKVAIFRLKDHYTRLMSASKMLGFEYFITWDEFKDIVTELVKKNDIKEDFYMRPFVF
FT                   CKEPRLSPKKAGLDFDLAIYMLPLADYVSSEGGLNLMSSTYRKYNDSAIPTKAKAGGSY
FT                   INSFLATSDAQRNGYDDALMFDDAGNVVEVSVANIILVYRGQIIIPDTGNAALEGITVR
FT                   SALELLEYNGYKINRGKIDRSMVFTADELLVTGTAMKITYAESLDRRPIGQLDFNAKPE
FT                   AGKFHKLLKSEYEKVINGEHELSSEWLFVVE"
FT   gene            complement(377238..377885)
FT                   /locus_tag="Lebu_0371"
FT   CDS_pept        complement(377238..377885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_1495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38288"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38288.1"
FT                   /translation="MRKFTLFLMTLILFNLSFAAGEAFTFQGFVPSAATSIVKSSHRIK
FT                   ALGSSRISYPMFISSKNANIVKNMNKNMEKFILDYKSTKDRFYVITSEIKADNSLFLSV
FT                   LFTIEEKNTKTGQKTKLYDGITFNLKDGSTLRLKDLFTDDFNTPLSTAVNDRFRQFGLL
FT                   PVDKFTAISKNQSFYMENDAVVLIYNKGEGTDFANGEVFIPFMLRDLVEILK"
FT   sig_peptide     complement(377826..377885)
FT                   /locus_tag="Lebu_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 20"
FT   gene            378387..380096
FT                   /locus_tag="Lebu_0372"
FT   CDS_pept        378387..380096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0372"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: ckl:CKL_1807 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38289"
FT                   /db_xref="GOA:C7NE94"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE94"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ACV38289.1"
FT                   /translation="MKLDNFKRIEDYEAEREKKELEFIINLTREALTDPEKEKEWNAVR
FT                   TSFALYTEGRKKGTYMIRPRFFESKIDIEDFEYLLDVVQKYCDKRLHLTTRQDFQLHGI
FT                   EKENLPELLEAISKRGFFTKATCGDSTRAVITPETTGFEEEVFDVSPHAKIVTDYILNG
FT                   REFMHLPRKYKIAFSNKEENSLYAKINDIGFQAVIQDGKKGFRVYVGGGIGPISTNAII
FT                   LREFIEEDEFLYYIHAIRNVFNDHGNRKIRARARLRYVLLNLGEEKFLELCNEYISNFY
FT                   VEKGDSLRVYTRKLLDEREILDKEKELEKIEVFSNGENTDESIKDDEFIKSERNIVAGK
FT                   HKGEYGYYLRPARGNIYKEDGEKLIKFVKSLDYKVELKLTSFQSILVRGLKKEDLLKLR
FT                   EIMEEYYGENEFFNSYSCIGSTTCNVGILDTPPILDYIFKYFENDEKRELTNYLPQIKI
FT                   AGCPNSCATPQIAKLGFSGRRKKDGEYFAIFARGEFTGKTVKLNEIVGEIKASKIPYFL
FT                   EDIANIIKEENIEFEEFVHEERFIELIEKYKEFELEVVDFNDFRKADMERAW"
FT   gene            380101..381165
FT                   /locus_tag="Lebu_0373"
FT   CDS_pept        380101..381165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0373"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: cbe:Cbei_4190 sulfate ABC transporter, ATPase
FT                   subunit; TIGRFAM: sulfate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38290"
FT                   /db_xref="GOA:C7NE95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE95"
FT                   /inference="protein motif:TFAM:TIGR00968"
FT                   /protein_id="ACV38290.1"
FT                   /translation="MYVELKNINKMYNSYKASDNINLGIRKGKLVALLGPSGSGKSTIL
FT                   RMIAGLETPDSGEIIIDGKVVNDVSPSKRGIGFVFQNYALFRYMTVFDNIAFGLKIAKV
FT                   KKSIIKERVEKLMELVNIKGLGKRYPNQLSGGQRQRVAFARALAPHPELLLLDEPFAAI
FT                   DAKVRQELRNWLRETIDKVGITSIFVTHDQEEAIEVADEIIVTNKGRIEQIGSPKEIYS
FT                   NPKTAFVAKFMGNPIELENINRFKGFENLKNGQKAIIRPENVSIIKANEKFRYSASTEN
FT                   GIVKYTLFRGKEVEIGVQINGTLIKGNRKIEEDAVSVGEEVNIYIYRAYAFGKNEEVEI
FT                   VENENTRNQNDVVI"
FT   gene            381537..383291
FT                   /locus_tag="Lebu_0374"
FT   CDS_pept        381537..383291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0374"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; FAD dependent
FT                   oxidoreductase; KEGG: cpy:Cphy_1830 adenylylsulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38291"
FT                   /db_xref="GOA:C7NE96"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE96"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACV38291.1"
FT                   /translation="MAENKADKNKNNKERKKLEIKELETDVLIIGGGTAGCYAAITLGK
FT                   NSDLSVIVAEKANIKRSGCLAAGINAINAYNVKGRVPQDYVDYAAKDANGIVRHDLLIT
FT                   AANRFNEITAEVEKLGLVILKDENGEYVARGNRNIKINGENFKPILADAVKKTKNVRVL
FT                   NTLNITDLLVKDGKVYGAVGFSIKKEEVFVIRAKKVIISTGGAAGLYKPNNPGFSRHKM
FT                   WYPPFNTGAGYAMGILAGAEMTTFEMRFIALRCKDTIAPVGTIAQGVGAKQVNSRGVVY
FT                   EDKYGLTTSERVYGTVRENQLGNGPCYLKTSGISEEESESLLKAYLNMAPSQTLKWIES
FT                   GKNPNEQDVEIEGTEPYIVGGHTASGFWVNTNRETTINGLYAAGDVAGGCPQKYVTGAL
FT                   AEGEIAALDIISKLVDEKKINCGKIDENVENFMDEQKNQIINQYEKIRNTEPKRFSTED
FT                   MEEGMQKIMDEYAGGISTNYQFNEKQLNLAKQKIDQLIELSDELSAENMHDLMFVYELK
FT                   ERLIVCKSLIEHLFFRKETRWHSFNENLDYPETDENYFKYVNSRLVNGELEVFMREIVK
FT                   EERYEHSN"
FT   gene            383275..383604
FT                   /locus_tag="Lebu_0375"
FT   CDS_pept        383275..383604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0375"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cpy:Cphy_1831 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38292"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE97"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV38292.1"
FT                   /translation="MSIVIDPYVCIGCTKCTLVCPGTLIEMQKVDDMKIEKAVMQYPKD
FT                   CWGCVSCVKECPVQAISFFLGADIGGNGSTMTTKEEGDVLKWIIEKRDGTVEEIDINRK
FT                   DANKY"
FT   gene            383647..384549
FT                   /locus_tag="Lebu_0376"
FT   CDS_pept        383647..384549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0376"
FT                   /product="sulfate adenylyltransferase, small subunit"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, small subunit;
FT                   PFAM: phosphoadenosine phosphosulfate reductase; KEGG:
FT                   cpy:Cphy_1832 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38293"
FT                   /db_xref="GOA:C7NE98"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE98"
FT                   /inference="protein motif:TFAM:TIGR02039"
FT                   /protein_id="ACV38293.1"
FT                   /translation="MNELSHLDELEAEAIYIIREVAAECENPVMLYSIGKDSSVMLHLA
FT                   MKAFYPEKPPFPFLHVNTGWKFKEMINFRDRRAKELGIEMIEYINPEGVEKNINPFDHG
FT                   ASFTDIMKTQALKQALNKYGFTAAFGGGRRDEEKSRAKERIFSFRNAAQAWDPKNQRPE
FT                   MWKLYNTEISKGESIRVFPISNWTEKDIWEYIQRENIPIVSLYSAAERPVVERDGNLIM
FT                   VDDERMRLEEGEDPEIRMVRFRTLGDYPLSGAVESNAVTLEEIIDETLSSVESERTSRV
FT                   IDKDSGAASMEKRKREGYF"
FT   gene            384549..386234
FT                   /locus_tag="Lebu_0377"
FT   CDS_pept        384549..386234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0377"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: cpy:Cphy_1833 sulfate adenylyltransferase,
FT                   large subunit; TIGRFAM: sulfate adenylyltransferase, large
FT                   subunit; small GTP-binding protein; PFAM: protein synthesis
FT                   factor GTP-binding; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38294"
FT                   /db_xref="GOA:C7NE99"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:C7NE99"
FT                   /inference="protein motif:TFAM:TIGR02034"
FT                   /protein_id="ACV38294.1"
FT                   /translation="MVRLLKFITCGSVDDGKSTLIGNILYNSKLLYADQEEALILDSKV
FT                   GSRGGAIDYSLLLDGLMAEREQGITIDVAYRYFTTNKRSFIVADTPGHEEYTRNMAVGA
FT                   SFAEVAILLLDVTKGVLVQTRRHARICSMVGIRHFVFAVNKMDLAKYSEEKFNKIVNEV
FT                   KELAKELELENIKIIPVSATEGDNVTKKSENMDWYKGESIIEYLEIVDVTENNENSDFY
FT                   IPIQRVCRPNHEFRGFQGQIESGIIRTGEEITVLPSNETATVKTILNGDKNVEEAFSGQ
FT                   AVTIQLDKEVDVSRGSVITKNKNLPVAKSVEAVLLWMDDDKLTVGKEYLAKLGTKKLSA
FT                   ILKEIVYKIDVNTGEKIEIQSITKNEIALCKIEFSDKVIVDLFKKNKALGELILIDRLS
FT                   HQTAAAGVVKNIDTTGEKPYFEKDDIKIDGYIFEELYFDFENARMSKEGTKERTYHVGD
FT                   EVPQKGDSFEYPQYFDVISLESEAAVLVRDCKIFDIVKLEDYHFTGLPILDTAGFGLQI
FT                   KTREDMKNYLLDYNQNVNKVEIHKKWAKFETYRRVVSGDNFYMI"
FT   gene            386286..387317
FT                   /locus_tag="Lebu_0378"
FT   CDS_pept        386286..387317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0378"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: cpy:Cphy_1826 sulfate ABC
FT                   transporter, periplasmic sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38295"
FT                   /db_xref="GOA:C7NEA0"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA0"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ACV38295.1"
FT                   /translation="MLKKLKIPVIFAIIVIFLYFIGIMRQNSKSGKSRKKLEIVNVSYD
FT                   PTRELYEKYNKLFIEYYRQKYGQDVKISQSHGGSGSQARSVIEGLDADVVTLALENDVA
FT                   LLEKVDLLEKGWVNKFPGSSSPYTSTIVFLVRKGNPKNIKDWNSLTEKGIKVITPDPKS
FT                   SGGACWNFLAAWSYGREKFGNDENKIQNFVKNIYDNVTVMDSGARAATTTFVENNQGDV
FT                   LIAWENEAIATIREYPEKYEIVYPSVSILAQPTVAVVDKVAKSNGTYQISTEYLKYLYS
FT                   EKAQEIIAESGYRPYNQKILKKYENKFDLKMKLTKIDDFGGWKKAYEKFFNEGALFDKI
FT                   YEN"
FT   gene            387457..388305
FT                   /locus_tag="Lebu_0379"
FT   CDS_pept        387457..388305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0379"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit CysT; sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1827 sulfate ABC
FT                   transporter, inner membrane subunit CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38296"
FT                   /db_xref="GOA:C7NEA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA1"
FT                   /inference="protein motif:TFAM:TIGR02139"
FT                   /protein_id="ACV38296.1"
FT                   /translation="MKILALKRKEQSVIPGFGLAFGISLTMLSILILIPLASILVYSFR
FT                   LSPLEFWKLVTEKPVLNAFFTSVLCSFIAAAVNCVFGVILAWVLVRYDFFGKRFLDGML
FT                   ELPFALPTAVAGITLSKMYSDTGMVGKYFAKIGIKISYTHVGIIIALIFVGIPFVVRAV
FT                   QPILEKLDNQYEEAAYILGADGKTTFWKVIFPEIRPALLTGFGLAFSRGLGEYGSVIYI
FT                   SGNSLKEHTQVVSYVIMQKLNYVDYPSATVIALVMLIFSFTLLFLINFVQMNQFKRTNN
FT                   V"
FT   gene            388298..389164
FT                   /locus_tag="Lebu_0380"
FT   CDS_pept        388298..389164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0380"
FT                   /product="sulfate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1828 sulfate ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38297"
FT                   /db_xref="GOA:C7NEA2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA2"
FT                   /inference="protein motif:TFAM:TIGR00969"
FT                   /protein_id="ACV38297.1"
FT                   /translation="MFRKGKRVMDKKNNIIKYVLIGISILFVGIMLVLPLIAIIVNSLQ
FT                   KGWAFYIRSLTDKYVLSALKITVIATISALIINTFFGIAAAWLLTKFSFRGKHILATLI
FT                   DIPFSISPVIAGLAFIMTFGRMGWAAPYIEHLNKFFVLDIKIVFAIPGVILATVFVTFP
FT                   FISREIIPILNAQGKDEEEAAALMGADGFTIFRKITLPQIKWGLLYGIILCTARALGEF
FT                   GAVNALSKARGKTFTLPLEIDALYLSGSSESIVSAFAVSSLLVIISIFILIIKNIIEHK
FT                   SKNKFIK"
FT   sig_peptide     388298..388414
FT                   /locus_tag="Lebu_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.621 at
FT                   residue 39"
FT   gene            390078..393647
FT                   /locus_tag="Lebu_0381"
FT   CDS_pept        390078..393647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0381"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: fnu:FN1170
FT                   pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38298"
FT                   /db_xref="GOA:C7NEA3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA3"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV38298.1"
FT                   /translation="MTKNMKTMDGNQAAAHIAYAFTEVAGIYPITPSSTMSELVDQWAS
FT                   YGKENLFGMPVKVVEMQSEAGAAGIVHGSLQTGALTTTFTASQGLLLKIPNMYKISGEL
FT                   LPGVMHVAARAISTQALSIFGDHQDIYAARMTGWAMLSTSSVQEVMDLAGIAHLTAIKS
FT                   RVPVMHFFDGFRTSHEINKIEVMDYEFLESLLDKKAVQEFRERALNPENPVTRGTAQND
FT                   DIYFQAREAQNKFYEAVPDIVNDYMKKISEKTGRNYAPFVYYGSETAERVIIAMGSVNE
FT                   TIKEVVDYLNKNGENVGALNVHLYRPFSSKYFFDAMPKSVKKIAVLDRTKEPGALGEPL
FT                   YMDVKALYYGRENAPEIVGGRYGLSSKDTTPEQIVAVFKNLAQKEPKNNFTIGIIDDVT
FT                   FTSLALEDEVFTGNEDVKGCLFFGLGSDGTVGANKNSIKIIGDKTDLYAQGYFAYDSKK
FT                   SGGVTRSHLRFSKKPIRSTYLVKKPNFVACSVPAYLGKYDMISGLREGGIFLLNTIWDK
FT                   EKLLKYVPNEIKRELARKKAKFYLINATEIAKEIGLGNRTNTIMQSAFFYLSEVIPHDE
FT                   AKEYMKEYAEKSYGRKGQDIVQKNWDAIDRGIDGLEEVEVLPEWADLEVNEQIIEAAKP
FT                   EFIKKIADPINLMKGNELPVSSIIENGMVDGSFQHGTAHYEKRGIADEVPEWQPDMCIQ
FT                   CNQCAYVCPHAVIRPFLIDEEEMAKAPEGMPTIKALGRGMNDLNYKIQVSPLDCTGCSA
FT                   CVDVCPAPRGKAIVMKPIQSQIERNEVEYTDYLFNNVSYKDKILGKNTVKGSQFAKPLF
FT                   EFSGACAGCGETPYIKLVTQLFGERMIVANATGCSSIYGASAPSTPYTTAESGCGPAWA
FT                   SSLFEDNAEYGYGMFQAVNTIRLRILKRMEEIKADVSNELADLFTIFAENFHDGDKTTE
FT                   IRDELVILLEKENNENPNEKVKSNTQEILELKQYLIKKSMWMFGGDGWAYDIGFGGLDH
FT                   VLASGDDVNVLVLDTEVYSNTGGQSSKSSRAGAVAKFAASGKPVKKKDLAAILMTYGNI
FT                   YVAKVSMGANQNQTLKAVREAEAYPGPSIIIAYSPCIEHGIKAGMGKFQTEEKLATEVG
FT                   YWPIFRYDPRLAEKGKNPLQLDTRNPAWDKYEDFLLGERRYATLAAEFPEKAKELLEAN
FT                   LKNAKDNWNYYKRMAAMDYSTEE"
FT   gene            393823..396816
FT                   /locus_tag="Lebu_0382"
FT   CDS_pept        393823..396816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0382"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: fnu:FN0374
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38299"
FT                   /db_xref="GOA:C7NEA4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA4"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACV38299.1"
FT                   /translation="MRNTKWAAKTIPNPRQEREYIERDNKQKDDEKTKKMKKSKTEKQN
FT                   FENTNLSSVIDNDILKILYSRGITTEKEIREFLNPKLGNIQNPYGLQDMEKTVLEIEKA
FT                   IKEQKNIWIYGDYDVDGITSTSILYMALKELGAENVNYYIPIRDEGYGLNNEALKKIKK
FT                   SGADLVITVDCGITAFPEVEFANSINLPIIITDHHNLHGDKVPDAITVVNPKRPENDFS
FT                   FEFLAGVGTIFMVILCLYERIGKKAKAYKYLDLVAIGTVADIVPLMEENRILTKFGLEQ
FT                   LSRSKNKGLRFLLYKLFSIQNSDFNEKTEYNSYDVGFIIAPVFNAAGRLKDAKMVVKLL
FT                   ISDNDREIEIIVKELINKNFERKELQNEIVEKVEKHIEESDLKEDYVIVDYSPEYHHGV
FT                   IGIAASKIVDKYYKPAIIIEVKEDEGIAVGSCRSIGNFNILEALQSMPELFVKFGGHSG
FT                   AAGFTIGIKNLELFKKKINKFAKTKLKEEDFVKIIEIDKQIPIQKISYEFFQIIELLKP
FT                   FGFGNPMPTFRTNNVLFENIKFIGENKNHIMFDIKQKGFFNRNAVWFNSGEYFKELNEN
FT                   LFYDIVYKLKTEMFQDRYYTKVYIEDVKVSKLKDDTLLYYHSLFNTSFPIKSVFYTNIE
FT                   LESEKKITMKIEFDQISLFQGRKFIGRLDYGISNLLILLNQYYNWNFTVKIENVKQTSS
FT                   HNIVNILIKKDYNFKCYDHLQAGIFKKIKEFLIGKMEYNSQTKNLLAQFFKQNKNLIIK
FT                   NIFGENEKYKYKISNFENFLLTVGIYYKKITGKKSQIVINSEKEPTFNNFIKTYFDINE
FT                   KYSENDYPFTLFYNYENLEEMEKIVKDDFSVKNEIIYDAENKNIAEIEVNEEIKQIEYR
FT                   KVEKIEYKNRENTEKNVKKQEKNIQNSNESEKKQNLEFEKRFCIIVNSEDLMIKTENLA
FT                   ESNIAEINTQIEVPKNVVFLENSTKKERKKAKNIFLEYLPIEEKIKLKKLLEDGEKIYS
FT                   DYSINEIL"
FT   gene            396832..397731
FT                   /locus_tag="Lebu_0383"
FT   CDS_pept        396832..397731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0383"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region; KEGG: cth:Cthe_3168
FT                   putative lipid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38300"
FT                   /db_xref="GOA:C7NEA5"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA5"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ACV38300.1"
FT                   /translation="MEKLKKAILVYNPKSGNANTILSNFDLITRKLLQKGITLTLYSIS
FT                   WDYDLFTEILQNEKYDILILSGGDGTLSRCLSELYSKNIEFPEVAIFPTGTSNDFAKAL
FT                   NIGENIENWIEKITEKTAKYVDFGLINNKTVFLSSYAGGLFTQISYNTDKTLKKTFGKV
FT                   AYYINGVGELTNIKAFDLNIVLDGNEKVKEKAILFVILNGKGVAGFDNVIDDASMNDGL
FT                   MDILIIKNIDNLLDVPKILMDLMNNNLTDNDYTRTLRAKKCKIEKVKEDINLSIDGEEG
FT                   ENMDVEIEFIEKKLKVFH"
FT   gene            complement(397862..398506)
FT                   /locus_tag="Lebu_0384"
FT   CDS_pept        complement(397862..398506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lga:LGAS_0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38301"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA6"
FT                   /inference="similar to AA sequence:KEGG:LGAS_0819"
FT                   /protein_id="ACV38301.1"
FT                   /translation="MAFDFKKEFKKFYRPSQNPEIIEIPKINFIAVRGKGNPNEKGGEY
FT                   QKAVEMLYGVAYTLKMSYKTEYQIKDFFEYVIPPLEGLWWQENEKSENYLLNKELFNWI
FT                   SLIRVPDFVKRNDVQWAINRATEKKKKDFSKVEFFSYAEGFCVQCMHIGSYDNEPKTIQ
FT                   KMNDFLQKNGYNLDLAGKRYHHEIYLSDPRKTDTNKLKTIIRQPIKKQKSF"
FT   gene            398846..400435
FT                   /locus_tag="Lebu_0385"
FT   CDS_pept        398846..400435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0385"
FT                   /product="Domain of unknown function DUF1957"
FT                   /note="PFAM: Domain of unknown function DUF1957; glycoside
FT                   hydrolase family 57; KEGG: ank:AnaeK_1135 domain of unknown
FT                   function DUF1957"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38302"
FT                   /db_xref="GOA:C7NEA7"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA7"
FT                   /inference="protein motif:PFAM:PF09210"
FT                   /protein_id="ACV38302.1"
FT                   /translation="MNGYLSLVLHAHLPYVRHPEYKEFLEEDWLYEAITETYIPLLEMF
FT                   ENLTRDNIPWNMTITMSGTLVNMMNDGLLRERYVRHINKLIEFCENEVERLSPYPDMLN
FT                   VARHNLWFNTRAKRVFEEKYGRDLVGAFRKFQDQGNLEIIPVTATHGFLPVMKDYPEAV
FT                   NAQVFMAKKDYIKNFGREPKGIWLAECAYYPGQDKFLEKHGIRYFLVDAHGIMHSDPRP
FT                   VYGIYSPVYTKNYVAAFARDLESSEQVWSSESGYPGDGLYREFHKDAGYELDYELVKPY
FT                   LHSDGVRRNIGVKYHAITDKKGTYKAVYNPEAAAARAKEHAYNFVFNRSKQIEYLASKM
FT                   KYRKPIVVSPYDAELYGHWWYEGPIFLEWVFRATAESDFSTITPYKYLEQYPTNQIVDV
FT                   SMSSWGANGYYDVWIDGSNDYAYRHLHKAAQKMIELANGREPYNELEYRALNQAARELL
FT                   MAQTSCWEFIMFTGTMVGYAHKKISDHVHRLFKIYEDFKNGRIDEGWLNEIESRDNIFP
FT                   EIEYRMYRTDWL"
FT   gene            400651..402789
FT                   /locus_tag="Lebu_0386"
FT   CDS_pept        400651..402789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2683 outer membrane autotransporter
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38303"
FT                   /db_xref="GOA:C7NEA8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38303.1"
FT                   /translation="MKKKIILLALITSSILNAAKLIYTNSNTPIYEGTVKYAKRTQESY
FT                   RVRNYFYDSIIGTAENEIWKKLMGTSRDTFNILLVKDSNYKDKFSADGYHMLGMLRAFE
FT                   FGAGKGYAVKNSHNVFITSKIAPQQIQSGLVTISTMAPSGSRSNWTKDSIYFGDVINEL
FT                   AGSYHITPRFLGITSDNSNLYVEALPNDNTVNKEKRLKGDDVEAVTPSQETFSFPMFGT
FT                   EVQKMFRSDRIRVKDFSCGLIKNPKQSFGNIRGIDGGYEKNTKEPCTVNDNRGAGKYPS
FT                   YALYARAETIIADGQVNDGERFSSGASYAAPRVSGVISVILDKFKGLSYSQAKNILLTT
FT                   AKRDYDMLDTYIGWGIVDKNKALNGPAALNAGLIEEQKFFTGMYDKIFDGSDNIYFWAD
FT                   VQNEWKWTNDIQGNLKYTPSGETILNTVINTTDEDGDASNVLVAFATVRNVNFKNIIPS
FT                   EYNYYESTSKYKPGLRKAGKGTLITTGNLNYPGRTEILEGKMIMKGSVPKSEIYVYEGA
FT                   TLEISGENYYQINLVGGNLTINGNPNIQTLFIENDNWSINGKGDLTIGKVIANEKVQKD
FT                   FKNSSVKVEEYSNKNSKYVEKDIIVNPKKYQDIPREYFFSDFKSEIKNFSTRNSQKVYN
FT                   EMVKRYTKMENAPEKVKEIIPGYKNGKFLMDTSPYSDPTRPEEFTTYPNPVFSNDTSLS
FT                   IKKKDFEITNFKNIIKNK"
FT   sig_peptide     400651..400707
FT                   /locus_tag="Lebu_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.972 at
FT                   residue 19"
FT   gene            402814..403512
FT                   /locus_tag="Lebu_0387"
FT   CDS_pept        402814..403512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0387"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: fnu:FN1519 23S
FT                   rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38304"
FT                   /db_xref="GOA:C7NEA9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEA9"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACV38304.1"
FT                   /translation="MEKIIGINPVIEVLKSDKNIEKLEVYKKIKKETIKEILNLASKRN
FT                   IKIFYTDRRTENSQGVVALVSEFDYYVDFTAFLEKLLRKEKSIVVVLDQVQDPRNFGAI
FT                   IRSAECFGVDGIIIQDRNSVKVTETVVKSSTGAIEHVDIVKVTNISDTIDKLKKYGYTV
FT                   YGAEADGQNYYYQENYPEKACLVLGSEGNGMRKKVKEHCDKIVKIHLKGEINSLNVSVA
FT                   GGIILSEMSK"
FT   gene            403724..404290
FT                   /locus_tag="Lebu_0388"
FT   CDS_pept        403724..404290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38305"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38305.1"
FT                   /translation="MEKQKYILNNTYGINGIEKISLKEIMKIFSVPEEVEMKLSDDKIT
FT                   ISIDLIYKGLKIYYSLYFFVENLKKPENQSLTFCMEKLYLNNRESIKVGDEIKTVLPKI
FT                   RKYLKRNNKNLNFKYEEDKFFGEYLFDDGNIHIFFEKFGSKKVMDDIMISLPYEDILPE
FT                   NKEVLAEISKIMEIKNKIDGLFWDE"
FT   gene            404500..404739
FT                   /locus_tag="Lebu_0389"
FT   CDS_pept        404500..404739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0389"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: fnu:FN0482 50S ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38306"
FT                   /db_xref="GOA:C7NEB1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB1"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACV38306.1"
FT                   /translation="MKKDLHPSYGFVVFEDTSNGEKFLGKSTKTSKETTTFEGQEYPVI
FT                   KVATSSTSHPFYTGKSKFVDETGRVDKFKKKYNL"
FT   gene            405399..406409
FT                   /locus_tag="Lebu_0390"
FT   CDS_pept        405399..406409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lwe:lwe0908 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38307"
FT                   /db_xref="InterPro:IPR024291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38307.1"
FT                   /translation="MKKIGVIVVIMLIIALLSLKTGKDEKNAGNKVTKEQIVLEKNKEK
FT                   YNKHIRFYNRILNIDKGLLYYFEDAGMEKKFKVIQDEDIKADIAIDRNFIDKLKELEQN
FT                   EDKKSELDKKAITMIPILEKMLPIADEMRTYYKNKEYLKDKYAKAQTLHTELLAILDKY
FT                   NQVTKAYKDLFEKKSDEIKKLMIKDYDKRREFITYNQFMFIEEGNNIIKEIHKQGLDAS
FT                   DFTTKGNPKKFKKIEEKMIKALVKFEKSLKNEKQLKKEGYTVGEHNDFIQKANKFKQSV
FT                   NVFIQKIEKKEKASHSSASDSFFAQTEEGTPENILSNFNEVIKEHNKLLMKKTKK"
FT   sig_peptide     405399..405470
FT                   /locus_tag="Lebu_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.397 at
FT                   residue 24"
FT   gene            406733..406951
FT                   /locus_tag="Lebu_0391"
FT   CDS_pept        406733..406951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0391"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38308"
FT                   /db_xref="GOA:C7NEB3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB3"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACV38308.1"
FT                   /translation="MTLVEGKVGEKFLLKDIDERKLDTRLLSLGVCRGDACTIENIANG
FT                   NILIKTVETKIVISTNLANHIQIEVVK"
FT   gene            406948..409139
FT                   /pseudo
FT                   /locus_tag="Lebu_0392"
FT   gene            409167..409331
FT                   /locus_tag="Lebu_0393"
FT   CDS_pept        409167..409331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD1480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38309"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB4"
FT                   /inference="similar to AA sequence:KEGG:CD1480"
FT                   /protein_id="ACV38309.1"
FT                   /translation="MIKTIIVGIIAVLIAFAVFRKVYKDYKKNKNLCGTDCCSCSSGST
FT                   CGSHKKEIK"
FT   gene            complement(409661..410725)
FT                   /locus_tag="Lebu_0394"
FT   CDS_pept        complement(409661..410725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0394"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: aoe:Clos_1046
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38310"
FT                   /db_xref="GOA:C7NEB5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB5"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV38310.1"
FT                   /translation="MKKYKNANGTGSITKVKINRTNPFRVRVTNPVTKKRHSLGYFSTK
FT                   KEATEILNKYFNNPYNLENHRIKFKDLFELFKNSKKDIVAKNTLNSYINSFKRCKELHN
FT                   LVFKDISTPVLQNLINDLNCSISTKSITKGFLKIFWDYAREIDILEKNRAEFINLPKET
FT                   ETKEKKPFNYDEIEKLWENTDIIWVKYILIMIYTGMRIEETVELKKENVDLQQEFIHGG
FT                   NKTRKGKNRSIPIHKDIVEIIKELYENSPTDYLIYNDKWIFSKKKNENKPLRKNYFREK
FT                   FYKTLETLKINKHKPHDCRKTLATLMSNQKINNIVITDIMGHENIATTKQYYIQTDKQK
FT                   LKLSMNSLNFRKTS"
FT   gene            complement(410812..411030)
FT                   /locus_tag="Lebu_0395"
FT   CDS_pept        complement(410812..411030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sah:SaurJH1_2090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38311"
FT                   /db_xref="GOA:C7NEB6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB6"
FT                   /inference="similar to AA sequence:KEGG:SaurJH1_2090"
FT                   /protein_id="ACV38311.1"
FT                   /translation="MNLEDKRLVYYTLKSRIRKKKLNYKEISKKMNISESGLNKKMNGK
FT                   NFFTQSEIYELKELLELSNDELVQIFF"
FT   gene            complement(411255..412019)
FT                   /locus_tag="Lebu_0396"
FT   CDS_pept        complement(411255..412019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EFA0012 replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38312"
FT                   /db_xref="GOA:C7NEB7"
FT                   /db_xref="InterPro:IPR000989"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38312.1"
FT                   /translation="MIKIDTEKVKEEKENYYLKALEWYSEYEIISKSEYSSINTCFNNY
FT                   IECHENSMKFTKNLRCKRRSCPICDEIDRSAKYFEIMKKIENFKNRYLIFILTINGKNV
FT                   EIDDKSRLQNELNVVRTNFNKLVKSPFLKKTVKGYLRVMEIAYNPERNSFLPHLHILLF
FT                   TIKGIYKHFKMKKLKEMIQTKWNILNGFKTNVHLEKLGTEEKIQKTVSYLTHSKKKRLK
FT                   NFFDNDENKTILSAYLNIIKRKRIYHWSKFKE"
FT   gene            complement(412142..412345)
FT                   /locus_tag="Lebu_0397"
FT   CDS_pept        complement(412142..412345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0397"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   cdf:CD2949 putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38313"
FT                   /db_xref="GOA:C7NEB8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR008003"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB8"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACV38313.1"
FT                   /translation="MNIKKLKAKCVEKGYTAEQLAKKIKIGRTAMSYKINQHKPFKQNE
FT                   MKEIMEVLGLDPVEMTEIFFAD"
FT   gene            complement(412472..412624)
FT                   /locus_tag="Lebu_0398"
FT   CDS_pept        complement(412472..412624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38314"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38314.1"
FT                   /translation="MSENNTEKQAIERYCLECCDDDKDKVKKCFYTRCPLWKYRLKKDK
FT                   KIQEN"
FT   gene            complement(412697..413410)
FT                   /pseudo
FT                   /locus_tag="Lebu_0399"
FT   gene            413883..414650
FT                   /locus_tag="Lebu_0400"
FT   CDS_pept        413883..414650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0400"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: cdf:CD1573 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38315"
FT                   /db_xref="GOA:C7NEC0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV38315.1"
FT                   /translation="MKINEKLKDLRLKNNMTQRELAEKLGISIPTLQKYEYGTLKIKNE
FT                   VILSLCDIFDISPDDFFNEKRNDIFKETDNLLKELDKFKNTDIIKELDEFEKKEYRKNR
FT                   ALLVIEKIRKDMQKKEEIEKQRQIKLSDYRKRVINEKMETFEDFYYYEEDLEINQLEFK
FT                   NLFPLIQFLMSYFDLDIEINREMEHSPYVKIYSEKLKIKYELSTEGFEEFLTFLNDDLI
FT                   HNFFSLLNYRFSNEFEEEQDDEYEIIEDEEDDE"
FT   gene            complement(415127..415675)
FT                   /locus_tag="Lebu_0401"
FT   CDS_pept        complement(415127..415675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38316"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38316.1"
FT                   /translation="MFYEKNIIFLFFLLGILTFAFNSVDEIKIYSKQVPKNSDFKYKKQ
FT                   TGSYFEYTVSDARARVFYKGNAVTKVELRVPYYFGKNRGNVINYLLTNVGGIIGLRREI
FT                   VDGVNWELDSLYYITDDTMKLNLDYYTVYLEAGLSGGSVFSKAVGAFGRETYRQGLNAN
FT                   YTDYSGYTEYRMKITIYEK"
FT   gene            complement(415905..417953)
FT                   /locus_tag="Lebu_0402"
FT   CDS_pept        complement(415905..417953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0402"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: ctc:CTC00689
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38317"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC2"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACV38317.1"
FT                   /translation="MEAKKIRILDFIGKGKKTFNIPVYQRNYDWQEENCKKLFTDIENI
FT                   IKHNEEIEHFLGTVVYVLTKIERDYEEYVLIDGQQRITSISLLLKALHEKIISEDTKES
FT                   IWEQYLINKKSPDNIRIRLKPIESDSVSYKQLIDNNDDSLNSNVCRNYKIFKELLENSH
FT                   YSAEQIYSALYKIELVTIKLEKDKKSENPQLIFESLNSTGLSLTQADLIRNYLLMNSEY
FT                   EKQTVLYKNFWLKIEIELTNKKISDFIRDFLTMKTGKIANKNKVYDDFKEYMRIQKELN
FT                   EEAVLEELVTYSKYYNWFLNANSNNEKINEKLKHFKYLKNTTVYPLLLSIFEDTYYYKK
FT                   LDEDKLLKIIDLLISYIFRRTICGYKTSSINKVFASIPKKILENQDEKDIYFKIEKNLM
FT                   ERRLETIFPRNEEFKINFIKYNFEKNKELLKYTLKELEEQISNNVINDVSNLNIEYIMP
FT                   ENLNSEWKLELGEKKFENTHLEYLGTIGNSSLIENELLRYNKNFKTKKEFYKKSNIEIT
FT                   KNIDDYQIWTDNEIKNRAEQLYEKSKEIWSIPAGYKIQKLNNIEYGKEYLLNSSINVTG
FT                   EKPDKLIIDGIPYPVKSWKGLLEKLCIVLYDFDSDTFKELIYNPNFQTKERVILSNSTF
FT                   KLRQPIEISNDLYIESNLNANAILSYADIIASNFELSDEIYFVLKRK"
FT   gene            complement(418076..418279)
FT                   /locus_tag="Lebu_0403"
FT   CDS_pept        complement(418076..418279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38318"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC3"
FT                   /inference="similar to AA sequence:KEGG:CLH_2507"
FT                   /protein_id="ACV38318.1"
FT                   /translation="MKRNLLKSKMSLHEDNNKTLAHKLKITPSAFSRKINGSSNFTIKE
FT                   MKFIRKEYELSDVEFLDIFFNN"
FT   gene            418413..418739
FT                   /locus_tag="Lebu_0404"
FT   CDS_pept        418413..418739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0404"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bsu:BSU04820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38319"
FT                   /db_xref="GOA:C7NEC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV38319.1"
FT                   /translation="MENVGKRLKSLREKYKFSLEEVAKKIKSSAGAISRYENNERKINS
FT                   ESLIGLSNLYNVSPEYILYGIKKDSSNLESSVISFFNNENIDFKEKEELFNKIQNAFFK
FT                   EKFR"
FT   gene            complement(419003..419686)
FT                   /locus_tag="Lebu_0405"
FT   CDS_pept        complement(419003..419686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38320"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38320.1"
FT                   /translation="MDIYVYSDESGVFDINHNEYYVYGGVIFLNKNDRDVMNRKYKNIE
FT                   RTLKNNNENFKNVEIKANILNGKQKYKIMNATSNIIKFGIIINQKEIHKKIFADKKDKQ
FT                   RYLDYAYKIGIKDCFKKLIAERRIKKDEVENIYVFVDEHTTATNGKYDFKEGLLQEFKR
FT                   GTFNSNYEIYFEPIFKNLKNLEVKHCKSEKIPMIRLADITANYLYGGILNDKPIQKTIY
FT                   IKMLP"
FT   gene            420572..420847
FT                   /locus_tag="Lebu_0406"
FT   CDS_pept        420572..420847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0406"
FT                   /product="ACT domain-containing protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   mba:Mbar_A3182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38321"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC6"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ACV38321.1"
FT                   /translation="MNDRIVITVIGTDKTGIVANVSTKLSELNLNIIDITQKVFENDIF
FT                   AMIMLVEAPKNTDIKGLQEEFKAVEEKIGVRVYLQHENIFKAMHRI"
FT   gene            420899..422263
FT                   /locus_tag="Lebu_0407"
FT   CDS_pept        420899..422263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0407"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   mma:MM_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38322"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC7"
FT                   /inference="protein motif:PFAM:PF05167"
FT                   /protein_id="ACV38322.1"
FT                   /translation="MNLLPDEILETIDMVEMQHLDVRTVTMGISLLDCIDTDAEKTAEN
FT                   IYNKITENGKDLVKIADEVASKYNMPIINKRVSVTPISIIGNATNTEDYTIFAKALDKA
FT                   AKTIGIDFIGGFSALVDKGFTKSDVKLINSIPKALSETDRVCSSVNVGSTKSGINLDAV
FT                   KMMGKTVKELAELSKDKDGLAAAKFVVFTNAVPDNPFMAGAFHGVENPDVVLNVGISGP
FT                   GVVRHTLANISKTAKIDEITEAIKKVSFKITRMGELIGKEVAERLGVEFGIIDLSLAPT
FT                   PAVGDSVGNVLEEFGLEAVGAYGTTLALAILNDAVKKGGAMAATRVGGLTGAFIPVSED
FT                   QGMIEATSKGYLTLEKLEAMTCVCSVGLDMIAIPGDTSEAVISGIIADEMAIGMVNSKT
FT                   TAVRIIPVPGKKAGDRVVFGGLLGEADIININNLDCSVLINRGGKVAPPIQALKN"
FT   gene            422456..423025
FT                   /locus_tag="Lebu_0408"
FT   CDS_pept        422456..423025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0408"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: methyltransferase
FT                   small; KEGG: cbb:CLD_3622 precorrin-6Y C5,15-
FT                   methyltransferase (decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38323"
FT                   /db_xref="GOA:C7NEC8"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC8"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ACV38323.1"
FT                   /translation="MYHIKDEEFLRGKVPMTKEEIRFVSLGKMEMKDDDICLDIGGGTG
FT                   SVSMEMARFARNGKVFVIERNDEAVELIHKNKEKLGLENITVIKGMAPDGLKDLNTKFN
FT                   KIFIGGSAGNLVEIIKYSYDNLVDDGILVLNFIVLENIFTAVEELKKYDFKDVDICQLI
FT                   VSKSRKIKDFNMMMAENPIYVITAKK"
FT   gene            423166..423267
FT                   /pseudo
FT                   /locus_tag="Lebu_0409"
FT   gene            423300..424129
FT                   /pseudo
FT                   /locus_tag="Lebu_0410"
FT   gene            424819..425181
FT                   /locus_tag="Lebu_0411"
FT   CDS_pept        424819..425181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0411"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   tde:TDE0248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38324"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEC9"
FT                   /inference="protein motif:PFAM:PF04343"
FT                   /protein_id="ACV38324.1"
FT                   /translation="MNRLNWKRIYEEPEKNDGFRVFVDRLWARGIKKEDAKIDYWAKEI
FT                   TPTKELREDYHKGRINFETFSAGYLNELEKNPDFDKFLQKIKTELISKNVTMVFASKIP
FT                   EISHIPILKKYLENKL"
FT   gene            425197..425964
FT                   /locus_tag="Lebu_0412"
FT   CDS_pept        425197..425964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0412"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fnu:FN1791 mutator MutT
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38325"
FT                   /db_xref="GOA:C7NED0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NED0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV38325.1"
FT                   /translation="MIATLCYLEKDNKYLMLYRNKKEIDINKGKWIGVGGKLENGETPE
FT                   QCLVREVWEETGYKLNTYKYRGIVIFNYNEDEPLFIYVYTSSDFSGVEKECDEGDLKWI
FT                   PKDEVLNLELWEGDKIFLKLLFENSPFFYLTLDYENDNVINSKLEFKQKYSCFEVFVPE
FT                   NYVEKIVENLQRYSLLTEGFYADVYSTTDTVGHWKTLEGGNPFDGEVGKASIANEKIMR
FT                   FRVKTDFEELAYHLVKEAHPYETPVINVFRMEV"
FT   gene            426009..426983
FT                   /locus_tag="Lebu_0413"
FT   CDS_pept        426009..426983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38326"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7NED1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38326.1"
FT                   /translation="MKKIIYAITVFLTINFGLNAYTLRENVQETLSKRGVKQSVIDETA
FT                   DFLLDSRGKISIIPQQDEIDSLIDRAETLLKKDKNNIVIKQYLSSMYLKKGGNKNTLKA
FT                   QKINEENLKDKGITDFEKWSVTGLYYYQIGEKKKAQEYFNKIKEKYKEKPAVYNLIEIV
FT                   MMDIDVLRDSKNFSQLIVDTATNEKKMKEIQEISKKQVEKMKIVKDFFQSEESKREFGV
FT                   VDELVYSFDLLLNLSKINEIMQKDLKQDGEFKIKTIREATDYYLKNIANNEKMTEDSIK
FT                   YNIILENMYLRIMVILVSDDEKESAEFSKKLEKSKLYRIFEKL"
FT   sig_peptide     426009..426071
FT                   /locus_tag="Lebu_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.836 at
FT                   residue 21"
FT   gene            427034..428056
FT                   /locus_tag="Lebu_0414"
FT   CDS_pept        427034..428056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0414"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: fnu:FN0952 cobalamin biosynthesis protein
FT                   CbiG"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38327"
FT                   /db_xref="GOA:C7NEG6"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEG6"
FT                   /inference="protein motif:PFAM:PF01890"
FT                   /protein_id="ACV38327.1"
FT                   /translation="MRTAIYCVSKNGYKTCLKVKENVYNNLHIYVSGRVANLLNLENEN
FT                   NENLIVINERVPILLEKTFNKYDLHIFVAATGAVVRIIEGKFKSKDTDPAVITIDDHAN
FT                   FVISLLSGHLGGANEECKKIANGIGAIPVITTASDVGGKIAVDTLSQKIKAKLNDLDGA
FT                   KRVTSLIVNGENVSLHLPKNIVNHDENSAGAIIVSNRKNIEISKIIPQNIFIGIGCKRG
FT                   VSKEHIIEKLKYAMDKQNLELSAIKMAGSAWVKSDEIGLLEAMEELDIPIKFFKKEEIL
FT                   KLEDLIEEKSEYVKKTIGVYGVSEPCAFLASSGKGAFLAKKIKLDGMTLSIFEEDSRSV
FT                   "
FT   gene            428268..429017
FT                   /locus_tag="Lebu_0415"
FT   CDS_pept        428268..429017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0415"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: fnu:FN0951 precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38328"
FT                   /db_xref="GOA:C7NEG7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEG7"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ACV38328.1"
FT                   /translation="MNKNGKIYVVGIGPGKKADMTFKAYEAMEKSDIIVGYKTYTDLIK
FT                   EYFPNTEIKSSSMMKEVDRCIEVLELAKSGKNVALISSGDAGVYGMAGIMYEVVDEKDD
FT                   VEIEVIPGITAANAAAAIVGAPIMHDYVTISLSNLLTDWELIKKRIELAAQGDFIISLY
FT                   NPKSKGRTTQIVEAQEIMLKYKSKDTPVAIVRNAGRETEEHEITTLEKMLDSEINMLTI
FT                   VLIGNSNTFVKKGKIVTPRGYEKKYEY"
FT   gene            complement(429171..430214)
FT                   /locus_tag="Lebu_0416"
FT   CDS_pept        complement(429171..430214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_1393 putative high-molecular-
FT                   weight surface-exposed protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38329"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38329.1"
FT                   /translation="MKIRNQLKKVLIILAGITILSTNLIAKETVTYPKESKSIQILGFE
FT                   KLENSFGISSSSEGNTIYINSGGKPLERVFGAAEDSNNKFSEIKNNHVIINGGILATNG
FT                   YWEKNGVKTVRGGSVYGGAGQSSVVSNNTITIKGKSKIGGNVYGGYSHRGSAINNKIVI
FT                   EGNLVTFGEESVLFGGRGSRNINIKDNKPTPVDVITGNTLDLKAKNVKVKDIKNFEKIV
FT                   FEISNTAKQNDKILILTNSEGAAPEKPEIVKISPKVTDLSETEKEKILVEKNKQINLDI
FT                   NVVFKNKPVKNIKNLKVILINTENGLELSKLPENIEKTGKGYKYSVKFEKDAKNLYAII
FT                   NASLVRN"
FT   sig_peptide     complement(430134..430214)
FT                   /locus_tag="Lebu_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            430564..430788
FT                   /locus_tag="Lebu_0417"
FT   CDS_pept        430564..430788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spb:M28_Spy1896 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38330"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38330.1"
FT                   /translation="MVIVNHPKKNKKVLGNSIEKRPEHINSRSEKGYYKIDAVKGKNGK
FT                   EKEIPKIQEALNGRYRKIFFILFLLFCCT"
FT   gene            complement(430932..432134)
FT                   /locus_tag="Lebu_0418"
FT   CDS_pept        complement(430932..432134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0418"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: ctc:CTC00561 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38331"
FT                   /db_xref="GOA:C7NEH0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH0"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACV38331.1"
FT                   /translation="MAKEKVVLAYSGGLDTSIIIPWLKENYDLEVIACCVNVGQEEDME
FT                   AVKVKAIESGASKVYVEDKKAEFVKDYAFRALRAGAVYENKYLLGTSFARPLISKVLVE
FT                   VAHKEGATYICHGCTGKGNDQVRFETGVFSLDPTLKILAPWRMWDISSREDAIDYAQKN
FT                   DIKITVTKEKIYSRDQNLWHISHEGGDIEGLENEHKEDIVYMMTTPPEKAPDKPTYVDI
FT                   TFEQGWPVKVNGEELEPVELLTKLNKIAGENGVGVIDIVENRLVGMKSRGVYETPGGTL
FT                   LMEALKDLETLILDKDTFDFKKMISQKYASIAYSGQWFTPLREGLDAFIDKTSKNVTGT
FT                   IKLKLYKGSVKIAGRFTDFALYDEEISSFGASELYSHKDAEGFIKLFSLPNRIRAYKKH
FT                   K"
FT   gene            complement(432157..432756)
FT                   /locus_tag="Lebu_0419"
FT   CDS_pept        complement(432157..432756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0419"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: fnu:FN0342 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38332"
FT                   /db_xref="GOA:C7NEH1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACV38332.1"
FT                   /translation="MIRKLSLLMLSLLLMTTVGVVSYSKEYKMKVKITTAKGDVNINLL
FT                   PEKSPVTVANFVNLAKHGYYDGLKFHRVIENFMAQGGDPTGTGMGGPGYKFEDEVNNGL
FT                   NFSKAGKLAMANAGPGTNGSQFFITTVPTEWLNGNHTIFGEVVSNADLDVVKKLSNGDI
FT                   MTKVTVEGDVDSFLKTQKSKVDSWNKVLKQNFPNKF"
FT   sig_peptide     complement(432682..432756)
FT                   /locus_tag="Lebu_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.653 at
FT                   residue 25"
FT   gene            complement(432836..433240)
FT                   /locus_tag="Lebu_0420"
FT   CDS_pept        complement(432836..433240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38333"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38333.1"
FT                   /translation="MKKSILALFAVSMVMFAGDNETKKVHEQTAKLQKNSYCNIPKSHS
FT                   EFKKINNKDYRVDIDFEKCVFDGETYNDVKVGILIQNTEKTEKYLKKYKYMHLKAGRNL
FT                   VYDSKNNIYYHDGSWAFNNDKAYPTVFDGK"
FT   sig_peptide     complement(433178..433240)
FT                   /locus_tag="Lebu_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.659 at
FT                   residue 21"
FT   gene            433546..434205
FT                   /locus_tag="Lebu_0421"
FT   CDS_pept        433546..434205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0421"
FT                   /product="TraX family protein"
FT                   /note="PFAM: TraX family protein; KEGG: cpy:Cphy_3371
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38334"
FT                   /db_xref="GOA:C7NEH3"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH3"
FT                   /inference="protein motif:PFAM:PF05857"
FT                   /protein_id="ACV38334.1"
FT                   /translation="MNLFILKIIGIIIMFLDHWHYIVGGDKILNVIGRVSFPIFAFTLS
FT                   EGYIHTRDLKKYLFRLFIFAISIQMPSILFNYNYPMNVFFTLFLGLLAIYIFNFKNFWL
FT                   KSPFDWIIKFILISIILLLSQKFNLDYKAYGILLIMNFNIFRNNKLYILMNFLILNLIN
FT                   LIFPNIFNLSDIQFFSLISLIFIFMYNGGKGRSMKYFFYLFYPLHFFILEIIKTIQ"
FT   gene            434221..434880
FT                   /locus_tag="Lebu_0422"
FT   CDS_pept        434221..434880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0422"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: fnu:FN0057 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38335"
FT                   /db_xref="GOA:C7NEH4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH4"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACV38335.1"
FT                   /translation="MTKKERLKKIFPILKEKFGEPKAALEFETPYQLMVAVILSAQCTD
FT                   ARVNIVTKELFKVVKEPADIRKMNQETLEKYIKSTGFYKNKAKNIKLNAEMMLDKYKDI
FT                   IPKKLEELIELPGVGRKTANVVLGELWNIREGIVVDTHVKRLSNRIGFVKNDNPEIIER
FT                   ELMKFIPKKYWFVYSHYLILHGRDKCIARKPKCEICEIRDYCKYNEENLKKSKINN"
FT   gene            434935..436392
FT                   /locus_tag="Lebu_0423"
FT   CDS_pept        434935..436392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0423"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: fnu:FN0060 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38336"
FT                   /db_xref="GOA:C7NEH5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH5"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACV38336.1"
FT                   /translation="MFKKGRRILILGVLFTVLLYAEGEQENSGGSTPKESEVTIKEERR
FT                   KTPAVKENESRNEVEQVSGRSSSKYSDHNSKRNKHQKHEGNTVSKGELTSTNSKEKNIS
FT                   TKNNNNKPIQKKKFVKAIEREKEGESEYQGEVIKFIATTDGKILKDKMSRQQHPIASLT
FT                   KVMNILVALDQIDRGNAKIDDKVCFTPDTVNMGGSWLNAKAGDCYTLKDLLRAEIIYSA
FT                   NNAAYMVAKHIGKGNLDNFVKLMNQKAKELGMNDTHYYTPAGLPTSMTNKGMDTSTAYD
FT                   MYLLGRRAIRDERLKAWMKESELVLQNSEGEDVIYNNRNHLLNKFGIYGLKTGFHVQAG
FT                   YNMIVSSKIGNLEIISVTLGNKSDDARTKDQTQEFTQLEKRMIPVYKAGQEIGNKFRIK
FT                   GTKEKKIAGVLSTNVYQIDNTNYKFEVKDLKITTENGISKGDVIGKLEVLSNDNELVNT
FT                   VDIIASNDYKQLSVFGRILRFVTFGLA"
FT   sig_peptide     434935..435000
FT                   /locus_tag="Lebu_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.761 at
FT                   residue 22"
FT   gene            complement(436552..437073)
FT                   /locus_tag="Lebu_0424"
FT   CDS_pept        complement(436552..437073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0424"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: fnu:FN0253
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38337"
FT                   /db_xref="GOA:C7NEH6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH6"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACV38337.1"
FT                   /translation="MEKKSKITAMLSVLLVSAPSTAKKITTSNLRNNAMKTTAVEIEGV
FT                   NIDDLNTKEDKIKENDIIVLDANALKFDFNSATIKEEYTPVLEKLKNYIESKNHKISIT
FT                   GYTDSKGTKEYNRELSLRRAESVEEKLIELGLAPEKIIETKGNGDANPIASNDTEEGRS
FT                   VNRRIEIKFM"
FT   sig_peptide     complement(437005..437073)
FT                   /locus_tag="Lebu_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            complement(437395..441075)
FT                   /locus_tag="Lebu_0425"
FT   CDS_pept        complement(437395..441075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0425"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: glo:Glov_1235
FT                   organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH7"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ACV38338.1"
FT                   /translation="MKRIKYKGLFILLFYIILFSELKAAGEIIDLETEKSTINLETEEI
FT                   ETEGNVTVRYGDYTINADKLKKIANRNIISGSGNVEFTQGSQIIKADNLIFDMDTKLAK
FT                   IFNSESYDTNLKLRYGGEETLAEGNKRIFIKNGWFTTSPYENPSYKINAEELEIYPNRK
FT                   AIARNIGIVAGGKTWLKLPYYVTSLKPYTQRATLFPYIGMDSDRGFFGIMGFDYDLGPL
FT                   AQGFVDFELSTKKKLALKFSNDYSFWGNNSGNIFINRVVVPIGNHKKEWDFKWNHKVKN
FT                   TPKKEKENMKFYDAGYGIWNLNYQNITTNLMYAVNGTELKDDYTAFVDKYKHIGFWDFN
FT                   INQELGQNGELNAKYYWTQDKHALKALTEINDKIMKDEDLDPRRTDVDLYKSIKYTNGN
FT                   KDMGITIDNEDFRDINPGYVGDLNSYRKKRSYEINLRGPKIKFNYLDSDKDEYGELKGM
FT                   RDRGDDKTIHWVQNVAYDRRNEWGLTFGNYYPFKESDFFGYKPRTQYQNLTNTLYFGAQ
FT                   VKQIDIRKKEYEYDYTRDNENYNALFLNPLTTDESRIYEIYEDNEKIRRPKKIIYEKYR
FT                   SQKFNVGNDRIDIPFKDSFIGYNMAFENRDYSNLAVPDFVNGRKVEDLDSKSGYKVARD
FT                   ASGDTIKQSPSMTIFTLDTRLYTTFFDNTAKRNNKYDVKVTNDAILTLQRTNAGSATYN
FT                   GYDIVEVPTNALGFKNNFNYHIGNVTFNYNLTMRDDRHFKYDWLKNRYVRNYLKADIAN
FT                   KRFVSFDFENNEEYEFENFRSERNFNREIQYGYLSNAGDNFLYKFTDKNKQLFPYNTSL
FT                   GWNQRIYKESLKERSLGVNFNEWGVEYTKSRNKTNDIFGNNATFGYPALKLKTDYNRFG
FT                   FVYDTSKMKNKKFESDHYFKINFGFGKKEYRDINNTPMNAADDRYIRGKDYTTIGFLYK
FT                   YENNAKPRFAADLEKKETTKKTEISEIENQINNINMVKNSNTQEFSINNSNKSAIDKIV
FT                   VNSDDRLFLSNEEEEAYKSFVEEENYRQNKFSLNDFNTKLQNLRSQKKYFQIGMDMQID
FT                   GSDATNPTGMKGVKRINDLSFKVEGGYLEKMFLRYAFIMERPDRIYRKASTRNSTFDFR
FT                   KHEFEGKYMFSRDPDKPWWIGGTFQYVQNGASKASDPEIYESSWYAKKVNKLTLGMATL
FT                   SHRFENIEWEIGAGMKWDKPNNKKLGYYPVVSLKFGVTPFPEKNAQFKYSGKGFEFGAG
FT                   L"
FT   sig_peptide     complement(441001..441075)
FT                   /locus_tag="Lebu_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.596 at
FT                   residue 25"
FT   gene            complement(441301..441963)
FT                   /locus_tag="Lebu_0426"
FT   CDS_pept        complement(441301..441963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0426"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: fnu:FN1724 potassium uptake protein KtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38339"
FT                   /db_xref="GOA:C7NEH8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH8"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACV38339.1"
FT                   /translation="MAGYLVIGLGTFGRSIAQTLYENGKMVLAIDQQEERVQKVIDDEI
FT                   ASDAITLDVTDENSIKKVVNDDFNTAFVCIGKNTQSSVFITVILKEIGIKTIICKAKNE
FT                   LQGKILKKIGATSVVYPEETMAKETALGVIRPNITEHFKFSEKYRMFEIKAPKDFVGKN
FT                   LIELNLRNKYEMNIIGIKSKEELNIMPLPNTAISESDILLVIANIEKMALFWKKYNL"
FT   gene            complement(441978..443315)
FT                   /locus_tag="Lebu_0427"
FT   CDS_pept        complement(441978..443315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0427"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: fnu:FN1725 potassium uptake protein KtrB;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38340"
FT                   /db_xref="GOA:C7NEH9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEH9"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACV38340.1"
FT                   /translation="MLKKQKEISPYIIILASFIIIILIGGFLLSLPIATENGQKTNLLE
FT                   GMFTATSAVCVTGLTVNDVSKVYNLFGKTVIMILIQLGGIGIITFSAIVVMMISKKMGY
FT                   FTKKLIQEDINANTTFEIQKFVKKVLITVFTIEIIGAAILFLKFIQIFDYKKAIYYSIF
FT                   HSISAFCNAGFALFTNNLSDFKNSVIINTIIPLLIFFGGIGFAAILNIYQYFLKKDRRL
FT                   TTTTRIAIKMSIFLIIFGTILTFILEYSNNKTLGTLPFFEKIGAAFFQSVTTRTAGFNT
FT                   ISIAELREPTVFLFVVLMFIGASPGSTGGGIKTTTVGLILFGIVTTIKNKEHLEYNKRR
FT                   ISWKIYNKAMVIVFISIMYVVVILFLLIWLEDIRVIELGFELVSAFGTVGLSRDLTPQL
FT                   SDISKLLIMITMFVGRVGPLTIALALSKVKNSKGRYVYPKEDILIG"
FT   sig_peptide     complement(443208..443315)
FT                   /locus_tag="Lebu_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.219 at
FT                   residue 36"
FT   gene            complement(443373..443858)
FT                   /locus_tag="Lebu_0428"
FT   CDS_pept        complement(443373..443858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0428"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cpr:CPR_0773 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38341"
FT                   /db_xref="GOA:C7NEI0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV38341.1"
FT                   /translation="MNSKGTIEIQKCIYFTISKMFRMVNKIAEESFENLGIYPTHAFLM
FT                   IILKEEKNGLTVNQISEALAIAPSTVTRFVDKLVSKGYVEREKSGKNSFTKITEEGLKV
FT                   IPELNKAWKRIGDKIEELVGNDEYLRKTGEDFREFTNLLAKDKTYENMIEEFDFWVI"
FT   gene            complement(443886..445001)
FT                   /locus_tag="Lebu_0429"
FT   CDS_pept        complement(443886..445001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0429"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   efa:EF0699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38342"
FT                   /db_xref="GOA:C7NEI1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI1"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACV38342.1"
FT                   /translation="MKFYDEKNFLKLRNLLIIAVLVLLAILLFFKVYDYFAKPIRLVIS
FT                   TIFPFILSFVIVYCLMPFIDMISEKKEVAGFETDNKHKGKKKIKLNRTFAILLVLSVFF
FT                   IIFLYIILTIVPIITKQVSSLIDFLLKNQDKLQNNFFGFLESNNIDLRSSLMSSKDIII
FT                   SNAIKVLGSSFSLISSTFSLLFMTPIFTIMLIFSYDNIENGVKRFFRNIGREDLIILIK
FT                   NMDETIGKYILVTALDSMIVGIISFIIFYFLKMDYSMLFSVIVGFGNVIPFIGPFIGLI
FT                   PAILYAFTKSFKLVILIVVLITIVQTIEANIVKPWLTGKSVEMHPITTLLVVLIGGALF
FT                   GISGAFIAIPVYIIIKLTWVFCWEKYIVKNK"
FT   gene            complement(445024..446349)
FT                   /locus_tag="Lebu_0430"
FT   CDS_pept        complement(445024..446349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0430"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: fnu:FN0170 GTP-binding protein; TIGRFAM: small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Miro domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38343"
FT                   /db_xref="GOA:C7NEI2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI2"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV38343.1"
FT                   /translation="MKHTVAIVGRPNVGKSTLFNKLVGDRLSIVKDEPGVTRDRLYREI
FT                   EWSGKEFILVDTGGLEPRTEDFMMGKIKQQAQVAIDEADVIIFLVDGKAGITGLDEDVA
FT                   TVLRRQDKKVVVAVNKIDNYLRDQENIFEFYGLGFEEVIGISGEHKTNLGDLLDAVIEK
FT                   FEDKKIKQIEDGLNIAILGRPNAGKSSLVNKLLNEERSIVSDIAGTTRDSIDSSLRYNG
FT                   ETYTLIDTAGIRRKSKVEDDIEYYSILRAMKAIKRADVCVLMLDATELLTDQDKRIAGM
FT                   IYEERKPIIIAVNKWDLIEKNNNSVKEFTELVKADLAFLDYAPIVTISALTGKRTLNIL
FT                   EQAKFINEEYHKKITTGLLNQILAEMIAQNPVPTRKGRAVKINYATQVSQAPPKFVFFA
FT                   NNPELIHFSYQRYIENKLREYFGFEGCPIDIVFNRKSEKSFG"
FT   gene            complement(446808..447302)
FT                   /locus_tag="Lebu_0431"
FT   CDS_pept        complement(446808..447302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0431"
FT                   /product="protein of unknown function DUF441"
FT                   /note="PFAM: protein of unknown function DUF441; KEGG:
FT                   lpl:lp_1894 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38344"
FT                   /db_xref="GOA:C7NEI3"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI3"
FT                   /inference="protein motif:PFAM:PF04284"
FT                   /protein_id="ACV38344.1"
FT                   /translation="MESFIFLGLILLVGAITQNKSIVYATIFVLILKVLFNITENYKLK
FT                   GIDIQNFMIQFRKEGINWGVLVITVAILIPIATGEIGFSHLLNAFKSPIGWVAIISGIS
FT                   VSILSSKGVGLLSGQPEITVALVIGTIMGVVFFKGIAAGPVIASGITFCILRVIELFFK
FT                   K"
FT   gene            complement(447449..452458)
FT                   /locus_tag="Lebu_0432"
FT   CDS_pept        complement(447449..452458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38345"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI4"
FT                   /inference="similar to AA sequence:KEGG:FN0033"
FT                   /protein_id="ACV38345.1"
FT                   /translation="MVIDYSIPDKLKNSYRMKLSKEKEKLNSESRKFIENALKGTVKTG
FT                   EYEYEIFALVEIKKKIKNVKNVRLEDIFPKEIYPALDVMIGKYFRELFIEVCEKTVQTP
FT                   YTKGYYRKMILSSNYRDHLRDMWDILTRFVEFHILELDIMKILKKEYDTKQYGNIDAES
FT                   YLLAEINRSNKEVIEFLKEMILSDNNTFVLDYTTFRAIFSSNNRELVELVGKLLLAAKL
FT                   QEGLRQAICETMDGGTAENFDYMFKIVYDNDLLRFSSVKRALATWTGIGEMYADRVSKK
FT                   EIEIINKLVENPKYADELLKSEDNVEVLLGLWQKGREDVSMAVKAIEKLINTGKRHTVL
FT                   LASYYLDIIQNPKLSQKIAKKVIQKNPDDLEIYACYSGNLVGNVNTYQIFQRINNGKVK
FT                   LTDFFENEDEAKEFFGIFENLVKQMTKVRKDFSPCIFPWYSVTLYKVAIADKMAIISLF
FT                   LKGEYIDKILDYAKFLNYYTKEDILQLVAQKFENENHAKFVIDSLKDGAVTNKAFEIAK
FT                   KHNLVQKYCKEMEGMLKLKTSEVRKNLINLLYLQKKTAFYESVENLIKTKDVNKRLAAF
FT                   DLILKAKNEKKDDVKTLKKYVNLVKEPTSSEIVLINEINREEKKAVNEALKYNTDYEPN
FT                   FENKEFLEEKLDIKKIFTKSIDELLEIVKKLNDLYVKYENYEYKTVYGEEALLSNTFSP
FT                   IFSSDRKYDYGNQKLEDYPLEEVWREFYKTEIKDFKTLYQLYLFTKERFSAKEYLNYTN
FT                   EMLGFGANNLIEKIIFEQRKNNDLKHFEVNKGYYYSVGKISQIIHLLINEYKNEEKNKK
FT                   YCYKFGKTVFSYVYNHLDESKILTKQGKNHWGRDDAKEMYSSIFDNNLIFREAKNNMGY
FT                   YPNEKEFGEQFILKYEIYKKMYNYIQKKNGELNGELISLYEFAFAVTKGIITKDEFYIE
FT                   VLNRGNVKDNIRTLCNFIYNNEDSKKNQDEQKVMEFFRTEGQKIIDYILDSEFKRGENP
FT                   VEYSNTIHQIPIVKGVDNLIKILMALGNEKLERGGYYSYYYSDDSKKSNLSHLLKNSIP
FT                   DKTDTSELFAKKIKGSKISQQRLIEVAMYAPRWIPLIQKYLGWKGMESACYYFHAHISD
FT                   VSKNMESLFAKYTPISVEDLAVGAFDIDWFKSAYKELGKKRFEMLYEAAKYVSDGAKHS
FT                   RARMFADAVQGKLKLKETETKIQDKRNKDLVASYSLIPLKKARDKDLLHRYKFLQKFLK
FT                   ESKQFGAQRRASEAKAFEISLENLSRNAGYSDVIRLIWSMETALINEMQKYFEPKIIDE
FT                   ISVFIKIDEFGQTKTVFEKNGKTLKTMPVKLKKNKYIEEIKEVNKNLKEQYRRSKKMLE
FT                   EAMEDGTEFYNYEIKNLMENPVISPLLDTLVFKSENNLGYYSDGTLVTVNGEILELEES
FT                   QVLKIAHALDLYNSGKWSEYQQDLFTKQIKQPFKQIFREIYIKTQDEKGKENSLRYAGH
FT                   QIQPNKTVAVLKNRRWVADYEEGLQKIYYKNNIIAKIYAMADWFSPSDIEAPTLEWVCF
FT                   YDRKTFKPMLIDDIPDLIFTEVMRDVDLAVSVAHVGGVDPEASHSTVEMRKAIVEFNLK
FT                   LFKLKNITFTEKHAIIKGERAEYTVHLGSGVVHQRAGAEINVLPIHSQHRGRIFLPFVD
FT                   EDPKTAEIMSKIILFAEDTKIKDPFILEQIK"
FT   gene            complement(452590..453009)
FT                   /locus_tag="Lebu_0433"
FT   CDS_pept        complement(452590..453009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38346"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI5"
FT                   /inference="similar to AA sequence:KEGG:CD0341"
FT                   /protein_id="ACV38346.1"
FT                   /translation="MKVYVNVKQIGKKKNKIDKKEYEINEEIKTVKELLTEFVTINVKK
FT                   FNEGSTENDIVPYLTDKKINDLSDAGKISFGVDYNEQKQDLEKAIENALQSYEDGIYRI
FT                   FVNDEEVGEIHSEVNLNENDELTFVRLTMLAGRMW"
FT   gene            complement(453364..454464)
FT                   /locus_tag="Lebu_0434"
FT   CDS_pept        complement(453364..454464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0434"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: dsy:DSY0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38347"
FT                   /db_xref="GOA:C7NEI6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI6"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV38347.1"
FT                   /translation="MDFSIEIQLIAIMVASACSILGTFLVLKSMAMVSDAITHTILLGI
FT                   VVAFFAVHDLNSPLLIVGAGIVGVLTVYLVELLNSTRLVKEDSAIGVVFPLLFSIAVIL
FT                   ISKYAGNVHLDVDSVLLGELAFAPFNRVQIFGFSVAKGLVTTFVIFLINLSFVVIFFKE
FT                   LKISVFDKALAITLGMKPVLIHYMLMSLVSMTAVSSFEAVGSILVVAFMIGPPITAYLL
FT                   TDKLKVMIGLSLVLGAVASIIGFHFARFFDISIAGSIAVAIGVIFLLTLIFSPKKGLIF
FT                   TINRKRTQKMTFSVRILLIHLSNHVNTKQEKDECGIDTIDNHLRWNKGFLNKVIEKAKK
FT                   EKYIYVDSTVYKLSEKGEKYLQLNNK"
FT   sig_peptide     complement(454369..454464)
FT                   /locus_tag="Lebu_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.690 at
FT                   residue 32"
FT   gene            complement(454468..455424)
FT                   /locus_tag="Lebu_0435"
FT   CDS_pept        complement(454468..455424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0435"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: dsy:DSY0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38348"
FT                   /db_xref="GOA:C7NEI7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI7"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV38348.1"
FT                   /translation="MNILNLLITDHTFRTVALGCLLLGMVSGILGCFAVLRKQSLLGDA
FT                   VSHASLPGVCLAFLFTNVKNTEILLLGALITGIVCIGLIQLIQNYTKIKFDSALALILS
FT                   VFFGLGLVLLSYLNKLPGANKSGLNKFIFGQASTFIKRDVNIIFITGIILLIIIILFWK
FT                   EFKIVSFDSDFAKTLGFPSKKIEILISILIVTTVIIGIQAAGVILISAMLISPAVAARQ
FT                   WTDKLSIMVILAAFFGGISGLLGTLISISESNLPTGPVIVIIISIIVIISILFSNKRGI
FT                   VFKIIRNQKRKKEFREKLENKKAGLNNFKINNLERGK"
FT   sig_peptide     complement(455320..455424)
FT                   /locus_tag="Lebu_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.890 at
FT                   residue 35"
FT   gene            complement(455426..456202)
FT                   /locus_tag="Lebu_0436"
FT   CDS_pept        complement(455426..456202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0436"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ayw:AYWB_623 ABC-type Mn/Zn transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38349"
FT                   /db_xref="GOA:C7NEI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38349.1"
FT                   /translation="MNQNVSDDIIIRVEDLTIAYEDKPVLWDVELDIKKGILMAIVGPN
FT                   GAGKSTLIKAMLDLLKPVTGEVKFYDEKYSKVRDKIAYVPQRGSVDWDFPTTVFDVVEM
FT                   GRYGKVGWLKKVRKIDKEKTKEAIHKVEMDEFSDRQISQLSGGQQQRVFLARALVQDAE
FT                   IYFMDEPFQGVDSKTEKSIVNILKKLRDEKKTVIAVHHDLQTVKDYFDYVTFINVSVIA
FT                   SGPVEEIFTPENIEKTYKSKKATQNNGNLSEIEKER"
FT   gene            complement(456355..457290)
FT                   /locus_tag="Lebu_0437"
FT   CDS_pept        complement(456355..457290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0437"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   fnu:FN0668 high-affinity zinc uptake system protein ZnuA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38350"
FT                   /db_xref="GOA:C7NEI9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEI9"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACV38350.1"
FT                   /translation="MSKNNVLTKLNLVIAVCVAMMLLISCGKGGATSGKKIKVTTTTTM
FT                   LSDLVKTIGGDKVEVTGLMGEGVDPHLYSASAGDIEKLGNADIIVYGGLHLEGKMTEIF
FT                   EKLTSQNKNILNVGDKLDKSKIHLVDQNTPDPHVWFNTELWEKEAEAVEAELSKFDPKN
FT                   SDYYKENLKKYKAELNELTTYVKTRINEIPEKSRVLVTAHDAFNYFGEQFGLQVKAIQG
FT                   VSTDSETGTKNISDLANFIVQRNIKAIFVESSVPKKSIEALQEAVKARGKEVKIGGELY
FT                   SDSLGDKAHNSETYIKTVKANADTIVNALK"
FT   sig_peptide     complement(457195..457290)
FT                   /locus_tag="Lebu_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.713 at
FT                   residue 32"
FT   gene            complement(457283..457957)
FT                   /locus_tag="Lebu_0438"
FT   CDS_pept        complement(457283..457957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0438"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   regulatory protein MarR; SMART: iron dependent repressor;
FT                   KEGG: efa:EF1005 iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38351"
FT                   /db_xref="GOA:C7NEJ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ0"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ACV38351.1"
FT                   /translation="MSRSIEDYLKGIYTLKKKKEYSNKKLAEYLNISPASVSEMIKKLV
FT                   NDEYLTIDKKTVKLTEKGNNFALDIIRKHRVWEVFLFEKLGYEKEDVHKEAEILEHVTS
FT                   DKLLQKLEKFLFYPKECPHGSPIFYDLENLDEENIIKLSEAEEDDEIVILSVEDNIELY
FT                   DYLRDLDINLKEKYIVERKDPFNGPIYLKSEQNNEKIVAFNAADMIEVYKKNKDLEETD
FT                   NE"
FT   gene            complement(458436..459026)
FT                   /locus_tag="Lebu_0439"
FT   CDS_pept        complement(458436..459026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0439"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: rca:Rcas_0018 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38352"
FT                   /db_xref="GOA:C7NEJ1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ1"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACV38352.1"
FT                   /translation="MKQNTLISNIVKIESKEKEILKNVLLVLGGVAFLSLMAQVMIPLP
FT                   YTPVPITLGTFGVTLMALLYGRKLGTATILSYVAAGSLGAPIFAGAKAGSLFSPTGGYI
FT                   LGYIVSTILLGYLADKGVTKSYVKTILSLILSSTIILILGALQLSLFLPGKNAFMVGVL
FT                   PFLPGDALKSTAVTLLVPTLWKFIPKNNNDEKN"
FT   sig_peptide     complement(458910..459026)
FT                   /locus_tag="Lebu_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.810 at
FT                   residue 39"
FT   gene            459546..461330
FT                   /locus_tag="Lebu_0440"
FT   CDS_pept        459546..461330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0440"
FT                   /product="signal peptide peptidase SppA, 67K type"
FT                   /EC_number="3.1.3.26"
FT                   /note="KEGG: fnu:FN1271 protease IV; TIGRFAM: signal
FT                   peptide peptidase SppA, 67K type; signal peptide peptidase
FT                   SppA, 36K type; PFAM: peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38353"
FT                   /db_xref="GOA:C7NEJ2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ2"
FT                   /inference="protein motif:TFAM:TIGR00705"
FT                   /protein_id="ACV38353.1"
FT                   /translation="MKFLDFLKKFLIFSLKEIYSFFLKMSLFIFVIFIIGISAIAIFSS
FT                   KDKNEKMKKSYEYILFNVSDVTEDKIVGSNFLSDEKLSYMDILNSLDDIKNNNQVKGVV
FT                   IALDTINLSSAKIEELIKKFEELKANNKKVYAFGAYITNSNYKLASIADEVVMVPSASA
FT                   SLDLTGYHYSDLYYKGLFDKIGVNMEVVRIGNYKSYGEEYIGNDMTPELRSELTRILEN
FT                   RYNKFITDVAKNRKVDKNALNNDIVNGNITNLTPFSARDKGLVDKLEQFSTFTERLNIR
FT                   EDNIADITDYYQKRVQYEKTGNSRNGTIAVIYAEGSILYDANGVTEGTITPDNILQKIE
FT                   KATQTKNLKGIVLRVNSGGGSALASEVIYQELSKLKIPVYVSMADTAASGGYYISTAGK
FT                   KVFANSATITGSIGVVSMLPKLYNAQDKYGVRSNSISKGRYSDINDSFAPLSEESRAKI
FT                   SQSMEETYKEFKSRVSKNRKIDENTLENYAQGKIWLGDEAKDIKLVDGIASLDEVIKIM
FT                   AKDLNLRKNYAVENIYLEEDFSQKLKSLSNMITAKFNLSAQLEKSIPQAKKAFNEYDFA
FT                   MQNQNKPLYYLTYKLNLY"
FT   gene            461419..462171
FT                   /locus_tag="Lebu_0441"
FT   CDS_pept        461419..462171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0441"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="TIGRFAM: sugar fermentation stimulation protein;
FT                   PFAM: sugar fermentation stimulation protein; KEGG:
FT                   tme:Tmel_0826 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38354"
FT                   /db_xref="GOA:C7NEJ3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ3"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ACV38354.1"
FT                   /translation="MKIQNKTGIYTINYDKIVGFKERVTRFTVKFSFKKNLNSKENPKE
FT                   DFAHLHDTGRLTELLIDGAELLIKEADRKNLKRKTKWDVIAVKVHGEIILINTAFHRYI
FT                   TESIFHNEKISPFEKPLYIKPEIKYNNSKLDFYLETEKDKIYIEVKGCTLVNGNTAQFP
FT                   GSPSTRAIKHLKELIELKKEGFRTAVIILIFRKSEIFAPEHTIDKKFSETFYEALENGV
FT                   EIYPILLKYGEDGNVYFEKNVEIAEKSF"
FT   gene            complement(462368..462601)
FT                   /locus_tag="Lebu_0442"
FT   CDS_pept        complement(462368..462601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38355"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38355.1"
FT                   /translation="MKNTLKKIIAVLGITGISIVSFAVPPTNIRKPKTNISQPKKKLPP
FT                   KKKSPGKDDKRIKNFIKQHPVKKEESQRRRKK"
FT   sig_peptide     complement(462530..462601)
FT                   /locus_tag="Lebu_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            462818..463252
FT                   /locus_tag="Lebu_0443"
FT   CDS_pept        462818..463252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0443"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; SMART:
FT                   heat shock protein DnaJ domain protein; KEGG: cbe:Cbei_4404
FT                   heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38356"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ5"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACV38356.1"
FT                   /translation="MDYYRILEIKEDADFSEIKKKYRKLAIKYHPDKNPGDDEAVKKFR
FT                   EITEAYEVLGDEKKRKEYDNKRKFKNGQENNKNKNLKNKNNFSDNNFSFGKEFFKSASE
FT                   MKEMFENSFNLNKMGKKKVEMEKENIKGRFENFFDMQSKK"
FT   gene            463325..464143
FT                   /locus_tag="Lebu_0444"
FT   CDS_pept        463325..464143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0444"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: lsp:Bsph_3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38357"
FT                   /db_xref="GOA:C7NEJ6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38357.1"
FT                   /translation="MFWIFRRIFGNFRNIFRKPLGRGSIYRLERLRSVTGIKKNKNFNI
FT                   EKNSISVDKGIKKYEKRKLNARNQKSYKFLSLKNILIMLILIITFVFVHFSGYSTKSLY
FT                   LSIFVYIGVTLYLLIVERFFEKVEVEEEIRNIKNEREREHSVFLERVKEIENLEKKQIE
FT                   HIFLKDSEDYDMKIWKVGRATSLLIGKETPRNRVDIDVSEGIYSNLVSRAHGILNRVNG
FT                   IWYYEDLGSQNGSGIERNLDKRKMKLKKNIPVKVESGDIIYLATTKILLK"
FT   gene            464178..464810
FT                   /locus_tag="Lebu_0445"
FT   CDS_pept        464178..464810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38358"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ7"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1603"
FT                   /protein_id="ACV38358.1"
FT                   /translation="MKLDRCKNGHMYDVSRYSLCPYCKSEGLETEVLEDKINLVEEMED
FT                   EDRTTAYWSKDSVVDPVVGWITCIEGHDKGKDYRIVSERNFIGRGENMNIQILGDSMIS
FT                   RKNHCSISYNPKQRKFMLTPGDANGLIYLNGEAVYNTVELRAYSVMEMGESKFVFVNLC
FT                   GDYFDWEKEKSREDDSEKFRNKNFRKKSSKKGNLEVKIEDYEEMFQN"
FT   gene            465023..467392
FT                   /locus_tag="Lebu_0446"
FT   CDS_pept        465023..467392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0446"
FT                   /product="Serine/threonine protein phosphatase-like
FT                   protein"
FT                   /note="KEGG: cbe:Cbei_4400 serine/threonine protein
FT                   phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38359"
FT                   /db_xref="GOA:C7NEJ8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ8"
FT                   /inference="protein motif:COG:COG0631"
FT                   /protein_id="ACV38359.1"
FT                   /translation="MRKDEAKFITKFLSEAGTKAENSDFFGYVLLDNYAIWVVADGFDE
FT                   ENGAKIAAKIAVESVIEYFMLRPRFNYEVIKEMMNYANLKVKEKQEETQKYSLMHTSLL
FT                   IIISNYNSILYGNIGNTRFYHIRGGYIVSQSSDDTIAQLLVEEKALNTSDMRFHRQRND
FT                   LLQAIGDFGKIKPNIIKEPIELLEKDIFCMTTVGFWENIDDYDMENDLSRFEDKKQWLN
FT                   SLEKRILASLRENIENYTIAGVEIQAVASKEPMEKDKAKIIKKIALGVLIAVVIILFIV
FT                   IWNVKRRNNILQAATQYEKLADEEVIRKNFNNSIDNLKLEIGEYEKLKPKSRGVIGFLT
FT                   NAENKRMEADKKIKEISKKIDETEKLKRAFSDINEGNEMFNSGNYDEANVKYQQAKYNL
FT                   NENSYKRDELNTEEILTTLDSRINSTVKLKEAKSLETAGDNAVTQGSYNLAKVSYKNAS
FT                   DMYLENGRADYVSQVEKKLENIAEKEKTAYSGAMLAENKGDSLAQSNINSSREAYYQAR
FT                   QMYQVLGDTVKVGEIDNKIQELNSQQNAELQTANNLVQEGLSQITANNPAQAISIFTQA
FT                   KNIYRKMKDENNAKAVEKFINQAQEFIKFESQNAEKLKQQEIEYSEQLKQQQMQAQQEL
FT                   SIKETEIKAQQQEMEKERERREEISRKMENAINLEIQADTMVINGNYEESISKYENAKK
FT                   ILEEINETGNFGNQMAKIEDLNKKIGKSEGYLLKQKGDENFKNKKWKEAVEEFKGAKDN
FT                   LQKNGAKKEEIEEIEKKLKKAEKKANRKWWQFWKIF"
FT   gene            467409..468683
FT                   /locus_tag="Lebu_0447"
FT   CDS_pept        467409..468683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38360"
FT                   /db_xref="GOA:C7NEJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38360.1"
FT                   /translation="MVKNIKLDTYFFKEYEKIVEKNTYSAYVPNGNKGIWSIASYNEGK
FT                   KKKNSNFEKINLAQIGVRKTIEKYFENNDFSIENMEKIMKNSSKKVIFEKMNLEKNIEN
FT                   LERIESESLYSQLNIMIDKDNIIVGNSGKTAFILYRGNKIFGKISEEEIKNIKLEKNDY
FT                   LLAGSPEFWEVIDENELTEIHIDKKSKENIEKNLSEKVKKFEKKINKVIPFFSIFVEEI
FT                   ENIEENNLEDIENRKGNNHEKIFSKYLFLAIVFIFMFVSVGKNIQKNHLKSSKNPVIKN
FT                   KVSNKNFTINNFIKSNLSIVKKVKNDDFEKVKIKFGNDFFENEEIKKETKIEKEKKEKT
FT                   KFKNNFKRNIENMIISKNKNVDNKMEKQYKSVKKSKYKRIRNKNLYVENKNFKDEKNNK
FT                   ISELEKEIEKNWEILGRDRNGNVLG"
FT   gene            468854..469774
FT                   /locus_tag="Lebu_0448"
FT   CDS_pept        468854..469774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0448"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: lsp:Bsph_3606 MAP/microtubule affinity- regulating
FT                   kinase 4"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38361"
FT                   /db_xref="GOA:C7NEK0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK0"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACV38361.1"
FT                   /translation="MNFLSKGTRLKKKYKIINYVAKSKLSNIYLAKNEKNEKVIIKECF
FT                   PEEIVIRNGRYVFTNKYKKDFENFKKNFFKEKCILERFLKKSKKRKTKNESGIVKIVDF
FT                   FSENDTNYIVTEYFCGITLKKYILENRIGKKGLEVNEILKIFFKIADLVCQIHKKNIIH
FT                   CDLKPSNILINVRGNIKIIDLGTSVEKGGKIEFIKVSEGYSPIEIYSEKIKIDERSDVY
FT                   SLMAILYFMFCGKKVDGVIERFYKPELEFEREVILGFEKIEKFKKMEEVIKKGLEYERE
FT                   KRFGSVKEMVEEIKKFEPKVLKNCK"
FT   gene            469771..472476
FT                   /locus_tag="Lebu_0449"
FT   CDS_pept        469771..472476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0449"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: lsp:Bsph_3596 molecular chaperone-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38362"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK1"
FT                   /inference="similar to AA sequence:KEGG:Bsph_3596"
FT                   /protein_id="ACV38362.1"
FT                   /translation="MKGKKLKMKLFYEEELRKKSYYEMYQIAIEENLVNVHLETPTREE
FT                   LIALLMKYRGVKENYCIDEYNKNGLANVQHLFDSKLGERIHNENKIKVPHKIILYKELD
FT                   LMKEDNYKIEIPENVSSANVFLINANNYLCGIFQLEKDLKSRNKYFLISRKKFFRVEKL
FT                   RNNKFSFLFFKESDLKFIHKFYNLKEDELEPLYPYQMDYYKVEIENFIVRNLEMTNTPL
FT                   CIDFGTVNTAVGAYLDKNYVKELPTNDILNGNVVIDAINYVKFDDGERHYREIFPTLVY
FT                   VDDCSDSKNIKYSFGYDVLRKLEKNDYIVNGSIFYSLKRWVHEHNKLEKINDEFGNILY
FT                   VKRKDIIKAYLKYVVNRAEYMFKCKFKKIHASSPVKLKEQFLTMFQEIFTVENNYRRKN
FT                   SKNKENFEKEINESNKFSNERHYEYEIIRENAMDEAIAVLYNTIEIQIKKGRYKENEEY
FT                   SALIIDCGGGTTDLAACKYVINRDRISYYLDIRTSFENGDENFGGNDLTYRIMQFLKIV
FT                   LGAKYSKNQIISINDLIKYDNDMIYKVIDDGGVEKIFEKMNLEYEKYENIIPTKYSHFE
FT                   NKMSEEYRKIRNNFYMLWEAAENLKKEFFTSDGRLRTRFDIPRNYEKRNDIHITQLKSW
FT                   KIHTYENRIFHTITDYPKNIFTIKEIEKIVKADIYGMLRKFLNTYYKEGLLFEYSLIKL
FT                   SGQSTKISTFQEVLKEFVPGKMIEYKELSHRDDYELKLNCLDGAIKYLDYKRFGHMDVE
FT                   IVNEVPLVPYSVWVEKYDGEKVEMIQTSRKADILIGQIDKKISAEELKIYVYNAEGELK
FT                   KEMIYKNEDDYEEMDAEEILPEFTNIISQNDTDTIQNNTVRFFVYTDLNNWGFFIVPIQ
FT                   RKADQLYLGRKEYFPYEDNLSENSYFDGNH"
FT   gene            472494..473753
FT                   /locus_tag="Lebu_0450"
FT   CDS_pept        472494..473753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0450"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: cbf:CLI_0141 RND family marcrolide efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38363"
FT                   /db_xref="GOA:C7NEK2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK2"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV38363.1"
FT                   /translation="MRKKDEIIWILPTILIFILLLMIKFCIPKINKKYVIEKITRENIE
FT                   LFVDMKGTAVASNVTKIGINLNLSVDDVYYKTGDFVKKGDIIVKFSDYQKNNINEKKML
FT                   LAIKSSQLRNLEKQKKLGADVNQKIQELQGEISALKLEIQQELKNMPLIQRVVRSPFDA
FT                   YIVKINALKGGITNENEPVLILARKENLKIVSESVVNEKVKNLNIGNIAEIGISKRENK
FT                   KAGKEKTLEKLVKIEDGKNKEILSNKNLKESSDLYSEKKIVEGKLFKINKINNMSIFEF
FT                   FLDSFKELFLNENVDIRVFYQKKENILTVPKQAVVLKNKKSYIYLIDKNNLVKEREVLV
FT                   GIDNGEKIEVLGTDIEEGMEIVGNPDEKIGNNVIVERKKIQDEELENKRRLEKLEKENE
FT                   KLENRMNENEREIIRLKRKQ"
FT   gene            complement(473796..474953)
FT                   /locus_tag="Lebu_0451"
FT   CDS_pept        complement(473796..474953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0451"
FT                   /product="Putative protein of poly-gamma-glutamate
FT                   biosynthesis (capsule formation)-like protein"
FT                   /note="KEGG: ngk:NGK_0997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38364"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK3"
FT                   /inference="protein motif:COG:COG2843"
FT                   /protein_id="ACV38364.1"
FT                   /translation="MKKYILLILLSISVFLVLSFAAISTNSDFKDFITKFINSEKNFNN
FT                   QQNAANKNDEKKEFTIIGVGDIMLGSNYPSQDLLPKNDANILQNTQDILHNADITVGNL
FT                   EGTLFDTGGKPKSCGNPSVCYVFRSPSRYGKYFKEAGFDYLSIANNHSNDFGETGIRET
FT                   MKNLDSLGIKYAGIKGIVESAVLEKDGKKFGFVSFAPNLVTVKLSDYSYVKKLLTDLRP
FT                   KVDILVVMFHGGAEGAGAEHIPRKDEIFHGENRGNVYEFAHFAIDNGADIIFGQGPHVT
FT                   RAIELYKNKFISYSGGNFATYGKINISGSMGLAPIFKIKTDDKGNFISGEIIPVRQTHG
FT                   SFGPFVDNEKSVIKKIISLNKSDFPKGNGLSVNEDGKILKSDSSN"
FT   sig_peptide     complement(474888..474953)
FT                   /locus_tag="Lebu_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.838 at
FT                   residue 22"
FT   gene            complement(475568..476080)
FT                   /pseudo
FT                   /locus_tag="Lebu_0452"
FT   gene            complement(476742..477256)
FT                   /pseudo
FT                   /locus_tag="Lebu_0453"
FT   gene            477556..479060
FT                   /locus_tag="Lebu_R0018"
FT   rRNA            477556..479060
FT                   /locus_tag="Lebu_R0018"
FT                   /product="16S ribosomal RNA"
FT   gene            479402..481981
FT                   /locus_tag="Lebu_R0019"
FT   rRNA            479402..481981
FT                   /locus_tag="Lebu_R0019"
FT                   /product="23S ribosomal RNA"
FT   gene            482140..482252
FT                   /locus_tag="Lebu_R0020"
FT   rRNA            482140..482252
FT                   /locus_tag="Lebu_R0020"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 57.58"
FT   gene            482268..482344
FT                   /locus_tag="Lebu_R0021"
FT                   /note="tRNA-Asn4"
FT   tRNA            482268..482344
FT                   /locus_tag="Lebu_R0021"
FT                   /product="tRNA-Asn"
FT   gene            complement(483062..483439)
FT                   /locus_tag="Lebu_0454"
FT   CDS_pept        complement(483062..483439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38365"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK4"
FT                   /inference="similar to AA sequence:KEGG:31817"
FT                   /protein_id="ACV38365.1"
FT                   /translation="MAISMNTKVLYTTKANTLNGMFGNKNGNILVGNNAFEFYNSRNPE
FT                   DYIQIPWNEIIRVRAQLFFKDKYIRGFFIDTKNAGTYNFVVKNAGKTLKIMRDFLGNEK
FT                   IVRNKPLLSMKNIFNLFKKNK"
FT   gene            complement(483533..484450)
FT                   /locus_tag="Lebu_0455"
FT   CDS_pept        complement(483533..484450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0455"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IID subunit; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component; KEGG:
FT                   llc:LACR_1865 mannose-specific PTS system component IID"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38366"
FT                   /db_xref="GOA:C7NEK5"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK5"
FT                   /inference="protein motif:TFAM:TIGR00828"
FT                   /protein_id="ACV38366.1"
FT                   /translation="MAENKKVKLEKSDRFNIMLRSQFLQGSWNYERMQNGGWAYAIIPA
FT                   LKKLYPNKDDASAALKRHMEFFNTHPYIAAPILGVTLALEEERANGAPVDDAAIQGVKV
FT                   GMMGPLAGIGDPVFWFTVRPILGAIAASLAADGSLIAPLFFFIVWNVIRVAFLWYTQEF
FT                   GYQKGAEITKDLSGGLLQTITKGASILGMFVMGILVQRWTTINFPMVVSKVPLAKGAYI
FT                   EFPKGSVDGTQLQKILGDVAKGLSLSPEKVTTLQDNLNQLVPGLAALLLTFLCMWLLKR
FT                   KVSPIVIIFGLFAVGILGHLVGIF"
FT   gene            complement(484469..485275)
FT                   /locus_tag="Lebu_0456"
FT   CDS_pept        complement(484469..485275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0456"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="PFAM: phosphotransferase system PTS sorbose-
FT                   specific IIC subunit; KEGG: llc:LACR_1864 mannose-specific
FT                   PTS system component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38367"
FT                   /db_xref="GOA:C7NEK6"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK6"
FT                   /inference="protein motif:PFAM:PF03609"
FT                   /protein_id="ACV38367.1"
FT                   /translation="MDFNILSIILILIVAFLAGMEGILDQFQFHQPIIACSLIGIATGH
FT                   IKECVMLGGVLQLMALGWANVGAAVAPDAALASVASAIIFAKNNFKDQGTVIGTAVALA
FT                   TAGLVLTMVVRTLSVVIVHQADREAEKGNFKGVELWHMIALACQGLRIVIPALLLVFLD
FT                   PSIIQGALGALPEWFTKGMSIGGGFVVAVGYAMVINLMATKEVWPFFFLGFALAPVKEL
FT                   TLIATGIIGVAAAIIYLNVTNNKGNGGGDGGASSSGDPLGDILNDY"
FT   gene            complement(485291..486280)
FT                   /locus_tag="Lebu_0457"
FT   CDS_pept        complement(485291..486280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0457"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIA
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: efa:EF0020 PTS system, mannose-specific IIAB
FT                   components; TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIA subunit; PFAM: PTS system sorbose subfamily IIB
FT                   component; PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38368"
FT                   /db_xref="GOA:C7NEK7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK7"
FT                   /inference="protein motif:TFAM:TIGR00824"
FT                   /protein_id="ACV38368.1"
FT                   /translation="MVGIIIASHGEFAAGIKQSASMILGETEALESVVFMPSEGPDDLY
FT                   KKIQDAITKLGTEEVLFIVDLWGGSPFNQSNRFFEEAPETRAIVAGLNLPMLLAALSER
FT                   EDMETAHEVAEAIVPEGKDQIRVRPESLQPKDEGPKAVAQDDTPKGAIPEGTVIGDGKI
FT                   KFVLARIDTRLLHGQVATSWTKATNPNRIIVVSDTVSKDELRKKLIEQAAPPGVRAHVI
FT                   PLDKLVEVSKDPRFGNTKALLLFENPQDALYVIERGVEIKELNVGSMAHTVGKVMVNNV
FT                   LSMDQNDVDTYKKLRDLGVQFDVRKVAADKRADLFKLISEKQNEGLKL"
FT   gene            complement(486954..487029)
FT                   /locus_tag="Lebu_R0022"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(486954..487029)
FT                   /locus_tag="Lebu_R0022"
FT                   /product="tRNA-Thr"
FT   gene            487171..488214
FT                   /locus_tag="Lebu_0458"
FT   CDS_pept        487171..488214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: emi:Emin_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38369"
FT                   /db_xref="GOA:C7NEK8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38369.1"
FT                   /translation="MNKFYVIIIEITVVVLAGIYSILTWHFFGRDPKRKAIVPEFTESD
FT                   YISAMFVAYINGERDSKEILKLGVLSLMLKGYISEVAENGTGNRKYVLNLKNRDNLRLR
FT                   RETLFEEENNLLDVLSENELFENKLGIIRYKNRIVYFLEKKYKRIIYKNNYIFFIPIIF
FT                   GIGVSIVFILLELLQGNLESAIIGTMFIFIWLEYVHGMSRGILKFLYTIVMLGIIVAVM
FT                   VYMEIYLGLNLFILGIMFLIYEKVIGKYTVSGQRKMEYIEGLKMYFETAEKNRMDKFET
FT                   EEEKINYFTQIYPYVIALKMKDKKIGIFKDSLDFVNTMGSYADAQYYVNEYIEAQFPIL
FT                   RKRHIFW"
FT   gene            488274..489413
FT                   /locus_tag="Lebu_0459"
FT   CDS_pept        488274..489413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0459"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: cpy:Cphy_2907
FT                   cysteine desulfurase NifS"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38370"
FT                   /db_xref="GOA:C7NEK9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEK9"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACV38370.1"
FT                   /translation="MKIVYLDNAATTKMSDKVINEMTKSFSENYGNPSSVHTLGQRAKS
FT                   TVENARHIVAKNLKAETTEIVFTSGGAEGNNLVIRGFLKANKDKEKHIITSKIEHSTIL
FT                   KTFEQLEKEGYEVSYIGVNETGVVDIEELKRELREDTALVSIMFVNNETGVIQLIKEIG
FT                   EILAERNIFFHTDAVQAIGKLKILPKDLKINALTATAHKFYGPKGAGFVFIDKKYSVEK
FT                   EIWGGSQERNRRAGTENVHGILGLGVALEEVYENLEEISEKENKLQNYLENKLKIEIEK
FT                   LGKKIKINGEKANRIKTTTNVYIEGVDIQMLLVALDLRGICISGGSACMSGSLENSHVL
FT                   KAMGLTDEELKGSFRISIGKDTTIEEIDYFVENLIEVIL"
FT   gene            489653..490270
FT                   /locus_tag="Lebu_0460"
FT   CDS_pept        489653..490270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0460"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="KEGG: dth:DICTH_1166 Ser/Thr protein phosphatase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38371"
FT                   /db_xref="GOA:C7NEL0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL0"
FT                   /inference="similar to AA sequence:KEGG:DICTH_1166"
FT                   /protein_id="ACV38371.1"
FT                   /translation="MKKNEKKKKKYKFLCVSDIEILADMEEEFLKQRFKDVDFIMSAGD
FT                   VSNNYLDYLVSVLNKDLICVNGNHTYNKDYPLGFAKVINGKFIKYKGLRILGLDGSKVY
FT                   SFQEHQYSESQMKMKILKNIFFLRKGVDIVLSHASPEGIHDRDDGVHNGFKVFHKVIQH
FT                   FKPKLWIHGHIHLSNFMNYQDTLVGETMVSNTFGYRIFTIEK"
FT   gene            490324..492096
FT                   /locus_tag="Lebu_0461"
FT   CDS_pept        490324..492096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dth:DICTH_1165 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38372"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38372.1"
FT                   /translation="MENRTLMSVMEAEEAYKKFLKSARGIFGFSFKKKENLKSFSEIQK
FT                   EENAYNSVNLGIKEVSLDKIVGSVEKYADFDKNFVPKNNVVKQRWINIYIGYTSDSMLP
FT                   MVILYKIKDNYYVYDGNHRVSVAKFLNFATIEAQVEEFLPTKDTKDKVIYRERMIFEKE
FT                   TGLSDISLSEPIKYKYLQEEIESYKILLNKRKIENTDLKEASKKWYVNVFLPIKTILSK
FT                   NEIIKNYKGNLDDVFLSFLEHKYYLSKNIGKNVGYLYSMINFINLVKTNENRDLENICE
FT                   IQTQELMEKYKKLEKIDNELINTDFKKKMGKNKLLKNKIINYFSQGIEKLPNKYSEYLF
FT                   KNEEVANDAVLEKFGNYILNYVKILDAQKNNNLNNENKVLEKSEDTLDEIEVNKEKSEF
FT                   ENVETDVLNYILEIFLPIAEIFLEINEKDGFIFNEYEKLQNEFFNLLKLKNLLEAEGKF
FT                   VKYENIMSESIKLAIDTKNKKMLTGVQEFLVSEKKKEFLKNLKKPEIFQEILEKYGEIK
FT                   KYETYVKFFIALDNFGEEEFLNNLEKDLKEFYLQDDNVVEYKTEKVMKIENSSIFEDDY
FT                   EIGFIDFFCNKFVW"
FT   gene            492134..492925
FT                   /locus_tag="Lebu_0462"
FT   CDS_pept        492134..492925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0462"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: fnu:FN0391 HAD superfamily
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38373"
FT                   /db_xref="GOA:C7NEL2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL2"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACV38373.1"
FT                   /translation="MNNIKAIFMDLDGTVLTSEHKVSENLIKKLRELEEKGVKTFIATG
FT                   RTFISSKPFVEMLEIKNPVINYNGGRVTNPLNNEVIFEKPVEAQDVKELIKVSREKGIH
FT                   LNLYMDDKLYIENETDEGKKYSESVEIPYYVKNFDEFIGKTSTKALFITENSILLELKK
FT                   ELEEKLPHINFVFSKPHYLECLNKEVNKGLAIKELLKKYDISPEETMAFGDQWNDLEML
FT                   KFVKYGYLMGNATEELKQEFSKDKITLSNDEDGIYEVIKAL"
FT   gene            492960..496517
FT                   /locus_tag="Lebu_0463"
FT   CDS_pept        492960..496517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0463"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fnu:FN1383 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: DNA
FT                   polymerase III alpha subunit; PHP domain protein; nucleic
FT                   acid binding OB-fold tRNA/helicase-type; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38374"
FT                   /db_xref="GOA:C7NEL3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL3"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ACV38374.1"
FT                   /translation="MENKFVHLKLHTEYSLLEGVGKIDEYVEKAKKTGVKALAITDTSM
FT                   FGAIEFFKKCKNAGIKPIIGLEVFLDGLEKVGEFSLTLLAKNQNGYKNLSKLSSISYSR
FT                   FTRNRNKIKYDELKKYSDDLYILSGGINSEVVKGILDLENTQVRRVVEKLGKDFGDNFF
FT                   IEVPAVERLEKARKMLFDIVRKNKFDNFVITNDVYYPNRKDAVLQKIVESIKEGSKIDT
FT                   EKSENSEILYDDLYLKSENEIEKSFENKEYSEFYETGINNVEKIMENCNVDFEFHHFKF
FT                   PKYSLPQNISEKEFLRNLVFEGLFHKYLKKSVSDSEKLQLDKNFEIIQKEIAKDEIAGQ
FT                   KLKEVKIREELLKNNLENVLERAEYELEIIDKMGYNGYFIIVWDFIKFSRENGVYVGPG
FT                   RGSAAGSIVSYALNITEIDPLEYNLIFERFLNPERISMPDIDIDFDQEQREIVINYVVN
FT                   KYGAEYVAHIITFGTLKARLAIRDVGRVLNVSLVKVDKIAKMIPFNTELKDALNNIPEF
FT                   RKMYGTDREIKKVIDYSLKLEGKVRHASVHAAGVVISKDVLSDEIPTYSDGKTKIVSTQ
FT                   YQMKELEELGILKMDFLGLKNLTILRKTVENIEKRRKTKIVLNDIPLNDEKTYELLTKA
FT                   DTMGVFQCESAGIRSLMKKMKIEKFEDIIALLALYRPGPLRSGMVDDFINVKNNRTEIK
FT                   YIDDSLKYILEETYGIILYQEQVMKIVSEMANYSLGEADELRRAIGKKNPELMKKNREK
FT                   FVTNAEKNGVFSKKANEIYDLVEKFGGYGFNKSHSAAYALIVYWTAYFKANYPLEFFAA
FT                   IITTEVHNLDRFVVFVNEAKEKGINIFLPDVNLSDYDFEIEESFENNNEIKKMGIRFGL
FT                   FAVKGIGAALINEIKKERENGDFSSYEDFVYRMKQNGITKKQLESFILSGALDKLNGNR
FT                   FEKYKSIDKILEYSQKKYESEEDLQMILFSGEKKFKGKFEMEKADEFPQKVLLENEKEY
FT                   LGIYVSSHPLNEKKRLINIISHNKISEISQKELKKVRIIGIVKNVKKFATRAGKEPMVK
FT                   FEMEDFQKNIEVVCFPREYVTFGYKITEGQIMVLEGIVNSEQNKNTVILNNICNIENLE
FT                   ENKNLKLYILIDEEVKEKNQKLKEIILKNKGDNQVFLAFKTNEKKEVVKLSKKYNVNLS
FT                   LKFIRKVAKLFGIERIKLR"
FT   gene            496715..497482
FT                   /locus_tag="Lebu_0464"
FT   CDS_pept        496715..497482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38375"
FT                   /db_xref="GOA:C7NEL4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38375.1"
FT                   /translation="MNFFAKKLKNFFSVIFVIAIFITFTVLTFSENSEFLAIGNLKIVR
FT                   QEPLVIKREDLNITIEKNRTIKVNSVYTFENIGNYNVKSTFMFWLDTNVEKTDKKDFSN
FT                   KNTNNRGKFVKNIKFLTDYKKAQSLRAVINFDESIYENQVTDNIQREWFAISKVIPSME
FT                   EGKVAVYYDLINTKFSRNKDFVYSFDLVENFFNKNKAEVLYVNIYNKSDLKIKNIDFKG
FT                   YEFKNISKNNKKEHYQLLEGGVNLDGKLVIKFE"
FT   sig_peptide     496715..496807
FT                   /locus_tag="Lebu_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.629 at
FT                   residue 31"
FT   gene            497536..498090
FT                   /locus_tag="Lebu_0465"
FT   CDS_pept        497536..498090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0465"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: fnu:FN1329
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38376"
FT                   /db_xref="GOA:C7NEL5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL5"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACV38376.1"
FT                   /translation="MRIVAGVLKNRRIKSREGRETRPTLERIKEAIFSIIGEKVADAKF
FT                   LDLYSGTGNVSFEALSRGAKRAIMIEEDKEALRIIIENVNHLGIEEKCRAYKNDVSRAI
FT                   EILARKNEIFDIIFLDPPYKENISTKTIEKISEENLLERDGIIISEHSTYEKMADKIGN
FT                   FVKYDERDYNKKVVSFYRFEN"
FT   gene            498119..498340
FT                   /locus_tag="Lebu_0466"
FT   CDS_pept        498119..498340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0466"
FT                   /product="Exonuclease VII small subunit"
FT                   /note="PFAM: Exonuclease VII small subunit; KEGG:
FT                   fnu:FN1328 exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38377"
FT                   /db_xref="GOA:C7NEL6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL6"
FT                   /inference="protein motif:PFAM:PF02609"
FT                   /protein_id="ACV38377.1"
FT                   /translation="MAVKKQSYEENIAQIDEILEKLESEELSLDDSISEYEKAIKLIKD
FT                   SEKLLESGEGKVMKVLEKNGKLEMEKFE"
FT   gene            498459..499349
FT                   /locus_tag="Lebu_0467"
FT   CDS_pept        498459..499349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0467"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: fnu:FN1327
FT                   dimethylallyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38378"
FT                   /db_xref="GOA:C7NEL7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL7"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACV38378.1"
FT                   /translation="MLREYLEDKKKIVEGNLKELLGNYENKYPEKLSEAMEYAVMNGGK
FT                   RIRPILMYMICDLFEKNNCKSYDKIKEIAAALEFIHCYSLVHDDLPAMDNDDYRRGKLT
FT                   VHKKYNEAIGVLVGDVLLTEAFGIIANSKSLGDKNKIEIISKLSEYAGFFGMVGGQFVD
FT                   MESENKKVEIDTLKYIHAHKTGKLLTAAIELPMIALDIESEKREKMVEYSKLLGIAFQI
FT                   KDDILDIEGNFEEIGKKSNDAQNEKTTYPSIFGLEKSKKLLQEYLEKAKKIIENEFEGN
FT                   QLFLELTDYFGNRKK"
FT   gene            499446..500156
FT                   /locus_tag="Lebu_0468"
FT   CDS_pept        499446..500156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Formin Homology 2 Domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38379"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38379.1"
FT                   /translation="MKIKKLLMMVLVLLSVQMCGPEPKLDYNVTKSESYKISEKKMKKN
FT                   SLEVKKGFEADNDKFRNKAKEVTKKFIEDMMAKEFQNKNETFATQAMKQMVVNMIEKGI
FT                   EYQKSKIEEIRFFNDEEVQITQKVKVFDNSKGNIAKLQNEYELLKLVAQKLQYKDIQDM
FT                   SSQMEKMDKKEAFSKFMNGISGVIEDEFKKEENYTEMTTTVNMNKVNNTWHIKNLDEQI
FT                   KAIEMIFSNLSNSM"
FT   gene            500180..500959
FT                   /locus_tag="Lebu_0469"
FT   CDS_pept        500180..500959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0469"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   fnu:FN1561 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38380"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEL9"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ACV38380.1"
FT                   /translation="MFIENKSYYYIEEFEKYGITAVYTKKIAGNMSDYCPIENQEEGIQ
FT                   KKNREKLLEDLNLTDKQEVMAFQTHSNNVKTIDEDTTKYYYEKEEDIDGFLTKRKDIAI
FT                   FTFYADCLPIFVYDKENQVIGVWHSGWPGTFKEIMKSGLLEMKKNYGTKIENVIMALGI
FT                   GIGQKDYEVGNEFYDKFMEKFGKSDGKIVEESFWFNEETKKYHFDNTKFNELMALKFGI
FT                   KKENLIIANESTFNEKFHSYRRDGKNAGRATAMISFK"
FT   gene            500992..501552
FT                   /locus_tag="Lebu_0470"
FT   CDS_pept        500992..501552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38381"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38381.1"
FT                   /translation="MKKILTLAFLVIGVTTFSASCDWFKENTEYADKMVELVKKERLTN
FT                   KVYCDTDQKKMVYETVDNDTNEKYIEIGLSYNKNKKNSFTYEDILNSFVEFEKDVDKLY
FT                   PWVNLTKLEYQNAPRYYNYRMYVYNPETQNEYMAFLVTYDTSNGTWNKYYSNEFWNGEN
FT                   ENEKEIINVIKETGLKETDDIIY"
FT   sig_peptide     500992..501054
FT                   /locus_tag="Lebu_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.738 at
FT                   residue 21"
FT   gene            complement(501621..502199)
FT                   /locus_tag="Lebu_0471"
FT   CDS_pept        complement(501621..502199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0471"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   cbe:Cbei_0291 5-formyltetrahydrofolate cyclo- ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38382"
FT                   /db_xref="GOA:C7NEM1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM1"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACV38382.1"
FT                   /translation="MKNEKLNLQLEKDKIRQEILKKRNNLSTEEVEKKSDLIIQNLEKF
FT                   IKNAENIMIFMDMKNEVRITKLMKLYPEKSFFIPKITDSKNREMKINKYNENELVLHKF
FT                   GYYESSSSDFYNENILDIVIVPAVVFDFEKNRIGFGGGYYDTFLKKVREKNKKVLFIGI
FT                   CYDFQIVDEVPTESHDMILNFIVSENKVI"
FT   gene            complement(502237..502827)
FT                   /locus_tag="Lebu_0472"
FT   CDS_pept        complement(502237..502827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0472"
FT                   /product="cobalbumin biosynthesis protein"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   cac:CAC1383 adenosylcobinamide
FT                   kinase/adenosylcobinamide-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38383"
FT                   /db_xref="GOA:C7NEM2"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM2"
FT                   /inference="protein motif:PFAM:PF02283"
FT                   /protein_id="ACV38383.1"
FT                   /translation="MALIFVTGGAKSGKSKFAEELILSLNNGKQENVYLATSLVFDEEM
FT                   KEKVRLHKERRKNNWGTVETYKNFENSLNEYFPKTKNGIKNNMLVDCLTTMITNIIFEE
FT                   KDVDWDNFDKKSYVKIVEKLDKNVENTVNELLNITNQFENTIIVSNELGLGLVPSYPLG
FT                   RYFREIAGKMNQAVAKRADEVYFVVSGIPMKIK"
FT   repeat_region   502904..503089
FT                   /rpt_unit_range=502905..502941
FT                   /note="CRISPRs"
FT   gene            complement(503918..505906)
FT                   /locus_tag="Lebu_0473"
FT   CDS_pept        complement(503918..505906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0473"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain IV; protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: amt:Amet_4515 translation
FT                   elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38384"
FT                   /db_xref="GOA:C7NEM3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM3"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV38384.1"
FT                   /translation="MRIYDSNNIRNVGILGHSGSGKSNMVEGLEFTAGLTNRIVNNEND
FT                   TKITNSLSLHAIEYQTSKFNFVDIPGYGDFFGEVESGLAAVDGAIIIVDGTTDLTVGTE
FT                   TALELTDSRNIPRFIFVNKIDNEKADYEKILSQLREKYGKRIAPFHVPWGRGDEFRGHI
FT                   NVVDMFAREFDKNKNECATVDMPADMDDEINPIREMLLEAVAETDEELMDKYFNGEEFT
FT                   TAEIHRGLRQGVLDCSVIPVICGSTLKNIGLHTTFDMVKDYLPAPIDIEKIQPEKNTFV
FT                   CQIFKTTIDSFLGKVSYAKVYSGEIKQDSEVFNVNKKIKEKIGKIHTFVINKMDELQKA
FT                   IAGDIVVFSKFNSTKTSDTLSTNEKEASVKDITFPKPQLFVAIEPLNKNDDEKMSSGLN
FT                   RLMEEDPSFTWHRNLETGQTVLGVQGELHSATVIEKLKAKFGISIKTIELKVPYRETIK
FT                   GTSEVQGKHKKQSGGHGQYGDVLIKFSHVDEDFVFEETITGGSVPKSYIPAVEKGLRES
FT                   LKEGVLAGYPVTNIKAVLYDGSYHDVDSSELAFKIAANLAFKKGMLAAKPILLEPIMEL
FT                   TIIIPEEYIGDVMGDINKKRGRVMGMEAHKGTKQKIIAEAPMSETFKYANELKAITQGR
FT                   GYFEMKLVRYEELMGDLAQKVIDSRKK"
FT   gene            506270..507454
FT                   /locus_tag="Lebu_0474"
FT   CDS_pept        506270..507454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38385"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38385.1"
FT                   /translation="MERKVKNENKGLEAFGNDEIFDIIKNNLKNDKEYKVNFGYMNGFH
FT                   KSKIDNSQKLFKNSSFNQNISDSSEKNQFNFSSENSIPYVIINLSDDFSYENSSKYITQ
FT                   IKKNNKLGIKNLGYVTTNEYLKSIDKIYSEIDKYMEFFGENYISGIFFDELSSGKNLSE
FT                   VKYMSQLYNYVKTKYPDSLVVGNPGGTITDEMSKYADLWLTSEVSADDYINNWIPRNYE
FT                   FENNPANSSHIVHVIHSAKPEQYETLVNLSKERNAGFLMIINADENVENEDLIDEDDCD
FT                   DEILDFDKMEIIENDENISHEFVSSGKYNIAGDLKISNLDLFTLLNDYYKNSTKRDFFK
FT                   NMFNNNFDFGYNISNEFKIDYSYKIKDEIGNFEIKLTKNKNFSFFYSSIFKNVI"
FT   gene            complement(507728..507991)
FT                   /locus_tag="Lebu_0475"
FT   CDS_pept        complement(507728..507991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0475"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sgo:SGO_1740 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38386"
FT                   /db_xref="GOA:C7NEM5"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM5"
FT                   /inference="similar to AA sequence:KEGG:SGO_1740"
FT                   /protein_id="ACV38386.1"
FT                   /translation="MNKKKINTLVGSIGAFIGIIVFITYIPQIIANIGGQKAQPWQPLS
FT                   ASISCLIWVIYGWTKEPKKDYILIVPNAAGVILGFLTFITAI"
FT   gene            508125..509642
FT                   /locus_tag="Lebu_0476"
FT   CDS_pept        508125..509642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0476"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: cpr:CPR_2559 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38387"
FT                   /db_xref="GOA:C7NEM6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM6"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACV38387.1"
FT                   /translation="MDNQKKYIIALDQGTTSSRAIIFDKNLNIIEKAQKEFTQIFPQPG
FT                   WVEHNAMEIWASQRSVLTEVIAQSGISLKDVAAIGITNQRETVIVWDKNTGEPVYNAIV
FT                   WQCRRTAEICEELKNRGLEDYVNENTGLIIDAYFSGTKVKWILDNVKGAREKAENGELL
FT                   FGTVDTWLVWKLTGGKVHVTDFTNASRTMLFNIKNLEWDKKILKELNIPESMLPEVRNS
FT                   SEIYGKTRMGITIGEENGTSIPISGIAGDQQAALFGQAGFHTGDIKNTYGTGCFMLMNT
FT                   GNKCIKSNNGLLTTIAIGIDGKVEYALEGSIFIGGAVIQWFRDELRFFDKASDTEYFAQ
FT                   QVDDNGGVYLVPAFVGLGSPYWDMYARGTIVGLTRGSNKNHIIRAALESIAYQSKDLIN
FT                   AMKEDSGIEINSLKVDGGATANNFLMQFQSDILNTKVLRPEIIETTALGAAYLAGLAVG
FT                   FWKNKEEIKKNWRLNKEFLPNLSENLRKKYYKCWKKAVEKAKSWEED"
FT   gene            complement(509722..511404)
FT                   /locus_tag="Lebu_0477"
FT   CDS_pept        complement(509722..511404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0477"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; TrkA-C domain protein;
FT                   KEGG: fnu:FN1727 chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38388"
FT                   /db_xref="GOA:C7NEM7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM7"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ACV38388.1"
FT                   /translation="MAKDVLHELRDISSLKSRRNNIVLIFLCFLVGIFSGIIVGTYTLL
FT                   LKKMSIFREFFTTNLELPKIIIGIIVFILMGMAVQFMLSKYPLISGSGIPQVSGLLTKK
FT                   VKFKWFGELVTKFVGGILAIGTGMSMGREGPSVHLGALVGSGIKEVTKRSEVEEKYLVT
FT                   CGASAGISSTFNAPLAGVIFSLEELHKFFSPLLLICTLVASGTSNFISRMILGSHTSFQ
FT                   YNFMLPKDIPYYIFAIITVIFCIIITITGKAFSYFLLLIQRQYKKWKLNKYVKMLLFMI
FT                   IAYAIAVFFSDITGGGHELIEEMFGKNVLLRTLIIILVLKFFYTMLCYATGAPGGIFLP
FT                   MLVIGALTGKVYGEILNHYFSIPNEIIVHFMLLGMAAYFTAVVRAPITGITLILEMTGN
FT                   FSYLYMLIIVCTITYIFTELLKMEPIYERLYFNMFHKQILAEDKQNSENEKHARRLEML
FT                   EKWWKNKKIDIGVKSNRKNAKDKIVTLLIPVGANSEFDNKTVKDLNLPENLLIVSVRKA
FT                   GKDSIARGDTLIQSGNQLVIITDYTTAQKYAGELKEKGMKIVE"
FT   gene            complement(511429..512397)
FT                   /locus_tag="Lebu_0478"
FT   CDS_pept        complement(511429..512397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0478"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: cpf:CPF_2491
FT                   ApbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38389"
FT                   /db_xref="GOA:C7NEM8"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM8"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACV38389.1"
FT                   /translation="MMYKVQVRFLFHSDIKIKIPEIYDDSIFDKLFGILEDIDEKYNSY
FT                   SENSYIDKINKNSGHFVKVNDETIKILSKIIHLSKIIGGEYDITIMPLIRLWGFYKQNP
FT                   ILPSLDKIKKAKRLVDYKKIIIDKKRNRIKIEKNQEIITGSFIKAYAIEKIVEEMKKIG
FT                   IKDAIVNAGGSSIIAIDEWGIIAENPEEEREILRNKKGMPIKITQNQYAGDDEYNDLFE
FT                   IKIKNKSYSTSNQKNTYLLINNEKYGHIISPKTGFPSQNKQVGVITENAFFGDIISTGM
FT                   YNQTPEKFYEIMGKLSKEMEISGFLIDKDGEIFYFNMEKYF"
FT   gene            complement(512419..512886)
FT                   /locus_tag="Lebu_0479"
FT   CDS_pept        complement(512419..512886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38390.1"
FT                   /translation="MSNKKKIILFLGAVSLIAFGNYKQFTKNKAQTTVEGKTSEKATSS
FT                   VNGTAKEGKVSEKATSSAGAKTGTEGKNSEQATSSAGSNQKPQNNGNPTEAKSAQQPQN
FT                   KPVNQNEQSGNEKKSENNQNSNTQQQPKNSGDLKLDDTDVKDKFKLDTSKK"
FT   sig_peptide     complement(512824..512886)
FT                   /locus_tag="Lebu_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.758 at
FT                   residue 21"
FT   gene            complement(513092..514189)
FT                   /locus_tag="Lebu_0480"
FT   CDS_pept        complement(513092..514189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0480"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: afl:Aflv_2013 transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38391"
FT                   /db_xref="GOA:C7NEN0"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN0"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV38391.1"
FT                   /translation="MKYNLAFKYRIYPNKEQELLVNKTFGCVRFVYNTILYTANKIYEE
FT                   TGKNKIITPASLKSENQFLKEVDSLALSNAQLNVKRSFTNFFQKRAKFPKFKSKKTSVK
FT                   SYTTNCVNNSIRIEENKYLVLPKLKKIKLKYHREIPKDYKIKSVTLTNSNGNYYVSVLT
FT                   EFEKEIQKMPSNDKVIGLDFSMSELFVSSENQRADYPRYFKMLEKKLKKLQKSLSRKVK
FT                   FSKNWYKQKEKISKLHEYIKNCRGDFLHKLSKKLSEAYNTVAVEDLNMKGMSQALNFGK
FT                   SVGDNGWGMFLRMLEYKLMFSGKQFLKIDKWFPSSKTCSKCGNVKEELKLSERSYKCEC
FT                   CGIEIDRDYNAALNIKNIGKEMLKY"
FT   gene            complement(514194..514592)
FT                   /locus_tag="Lebu_0481"
FT   CDS_pept        complement(514194..514592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0481"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ctc:CTC00621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38392"
FT                   /db_xref="GOA:C7N8J9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J9"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV38392.1"
FT                   /translation="MSYNSNYHSVFDINYHMIFCIKYRRVVINDEISNRLKEIFEKICP
FT                   KYNIVLKEWEHDVDHIHMLINAMPNTELSKFVNTYKSASSRLIKKEFPEIRRRLWKEYF
FT                   WSRSYLVVSVGGAPLEIIKKYIQNQKEV"
FT   gene            514861..515700
FT                   /locus_tag="Lebu_0482"
FT   CDS_pept        514861..515700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0482"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: fnu:FN0267 ATP-NAD
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38393"
FT                   /db_xref="GOA:C7NEN2"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN2"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ACV38393.1"
FT                   /translation="MEKSEKLKNNDLNRKNKVEKVRIVKSGYGNENLLKDFYDYLKEKN
FT                   IQEVFGVEEADLIISLGGDGTMLIAAKEAITGNIPVLAVNMGSLGYLAEVKPQNAVKML
FT                   EDYENGNYKIEERAFLEVKYEDNIFYALNELVITKGGHEAHLIQVEVYSNDIFVNKYRA
FT                   DGIIVATPTGSTAYSLSAGGSIVHPGLNALSITPLAPQSLTARPIIVDGCEVLSFKATS
FT                   RDEAVHLNIDGNQWFQIQQNDLVSARLSKKKIRIVKPMDSDYYSILRQKLKWGDSVL"
FT   gene            515813..517492
FT                   /locus_tag="Lebu_0483"
FT   CDS_pept        515813..517492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0483"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: fnu:FN0268 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38394"
FT                   /db_xref="GOA:C7NEN3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN3"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ACV38394.1"
FT                   /translation="MLRELRLNNLAIIKNLDLEFNEKFIALTGETGAGKSIILNGISLL
FT                   IGERSHIDMIRNGEENLFAEGIFELNENQKKRLNELGFEIEDDELIITRFFDRSSKSKI
FT                   MVNGKRQTLSRLKELMVNIIDLVGQHEHQFLLNNEYHLHLLDRFLNDEGKELSRKIREN
FT                   VSEIKKLNLKIKNIEDEKSKIAEKKDVLEFQFNEINELDLKEDEDNELEEEYRILFNAG
FT                   KISEKLEETSQLLKEGEFSILTALGRAKRNLEQLSDLSESYSELSEKIESVLYEIEEIS
FT                   YSVDNSIGDVEINDTKLEKIVERIDKINKLKRKYGSTITEILEFKNKIEKDLSLVNFEN
FT                   EELENLKIQKKELVNQYFQDSERLSEIRMKIAENLQNTVDIQLSDLNMENAKFKVEIIK
FT                   KEEITAHGTDNAEFLITTNVGETFKPLAKIASGGEISRIMLALKSVFSEVDNISVLIFD
FT                   EIDTGISGETVRRVAEKLRELSRNTQIICVTHSPQIAGKAQQQFFIKKEIENNFTETKV
FT                   RELNTEERIREIARIISGDNITEASVSHAKEIMGLWDKKVLI"
FT   gene            517591..518445
FT                   /locus_tag="Lebu_0484"
FT   CDS_pept        517591..518445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0484"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase domain protein SAM domain protein;
FT                   integrase family protein; KEGG: lsl:LSL_0934
FT                   integrase/recombinase XerD/RipX family"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38395"
FT                   /db_xref="GOA:C7NEN4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN4"
FT                   /inference="protein motif:PFAM:PF02899"
FT                   /protein_id="ACV38395.1"
FT                   /translation="MQLKNFLEFLKFEKRSSQNTLNGYNRDLTQFFLFVKKDFSEIGEK
FT                   EISSYIDNLNKKLRKNSVLRKVSVLKTFYKFCYLNKLITKDPAGIIKNLKREYQPPETL
FT                   TLEEIKQIVDNCPNTPAGIQNRLIIKLLIVTGAMISEILNLKIKDIENQYDKFIKTLGK
FT                   NSKYQIKLIDNSFEIEIKNYLEIYRPKLKNANESLKIFPDIRREKFWKNLKIIAQNAKI
FT                   EKNVYPHIFRNSLVGILSEANADICIIQEVLGKVNITTAKIKKNVEKSKLKMIYNNIKL
FT                   GDD"
FT   gene            518450..518869
FT                   /locus_tag="Lebu_0485"
FT   CDS_pept        518450..518869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38396"
FT                   /db_xref="GOA:C7NEN5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38396.1"
FT                   /translation="MKEKRELKKDRDEKIRILIITTMVYFIFFLIEKMELITSYLGIII
FT                   LILLYMYANFNLINLFFTSKRTTFKVYAFLLLEVIYLFTGNISMLGSILYIILFSLLIF
FT                   SIRKDEGREEIPKITKFVQIFIVFKVVFVLSMLIF"
FT   gene            519014..519607
FT                   /locus_tag="Lebu_0486"
FT   CDS_pept        519014..519607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0486"
FT                   /product="protein of unknown function DUF1694"
FT                   /note="KEGG: nth:Nther_2842 protein of unknown function
FT                   DUF1694"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38397"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN6"
FT                   /inference="similar to AA sequence:KEGG:Nther_2842"
FT                   /protein_id="ACV38397.1"
FT                   /translation="METSINSSRTDVMKYMEEVTDRAVNAQVEKNLFLGEYKERIIKAL
FT                   TFDEIREKGIYYEIEKALENKEVAKMVISRHANFDDIKKYIEIAKRKKIPYKMIDNLLC
FT                   EGQIALVVVAKDAITHEDGDEIVVTSKLETCHIKHLPDVYYEAMESAICDFHMNIINKE
FT                   MPEYAKNYKNLTFMDKLLGSKCPICQKLGGKKRG"
FT   gene            519600..520868
FT                   /locus_tag="Lebu_0487"
FT   CDS_pept        519600..520868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0487"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   fnu:FN1520 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38398"
FT                   /db_xref="GOA:C7NEN7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN7"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACV38398.1"
FT                   /translation="MVDGFRITGKTPLNGVIKVSGAKNAALPIIIATLVAKGEYILKNV
FT                   PNLRDIRVTMKLLEDLGMITEKLDNNTYKIINNGFKRTEASYQIVKQMRASFLVMGPMI
FT                   ANLDEAVVSLPGGCAIGSRPVDLHLKGFEMLGADITRVHGYVHAKSDNLKGAEIPLGFP
FT                   SVGATQNIMMAAVKTPGKTIISNAAREPEIVDLGNFLNKMGAKITGLGTPNIEIEGVEE
FT                   LHAVEYSIMPDRIEAGTYVIAALVTEGDLKIQDARLEDLGVFKSELEAMGVKFKQDGDI
FT                   LSVIGKVKDLKPSKIKTLPHPGFPTDMQPQMMLLQTLVNGGSSMEETVFENRFMHVPEF
FT                   NRMGADITIRHGVAFVNGGLPLTGAEVMSSDLRAGAALVLAALAADGETIVNRVYHIDR
FT                   GYDRLELKLNTVGAKIERIKLDI"
FT   gene            521173..522048
FT                   /locus_tag="Lebu_0488"
FT   CDS_pept        521173..522048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0488"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: drm:Dred_2192 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38399"
FT                   /db_xref="GOA:C7NEN8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN8"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACV38399.1"
FT                   /translation="MKIKDLFEKKERLISFEIFPPNKNFSEEKLKNVTAELVEYKPDFI
FT                   SVTYGAGGKTKGGTIEMASHIKNNLKTEVLAHLTCVGSKKSEIHDYLQEAKSKNIKNIL
FT                   ALRGDVPQGETEEIYDKGDYKYASELISDLRKNSEFNDFSIGGAFYPETHYENNDLVDL
FT                   FHLKNKVEAGTDFLASQMFFDNDVFVKFKEQAEKLDIKVPLIAGIMPVTNAKQIKRIIE
FT                   LSKCSVPEKLDKLLEKYGDNPESMKKAGIMYASEQIIELLAYGIKGIHIYTMNKPEIAK
FT                   EIMKNIEFAR"
FT   gene            522189..523001
FT                   /locus_tag="Lebu_0489"
FT   CDS_pept        522189..523001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0489"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   bay:RBAM_035260 pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38400"
FT                   /db_xref="GOA:C7NEN9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEN9"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACV38400.1"
FT                   /translation="MSIKKVLTIAGSDTSGGAGIQADLKTFQERGVYGMNALTVIVTMD
FT                   PKNSWAHKVFPIELNVIKEQIDTVVNGIGVDALKTGMLPTVEIIEYVGSVLKDLKNPIV
FT                   IDPVMVCKVNSGSTENLFPENVTAMKKHLLPYATVVTPNLFEAAQLAGMEKIDTLEEAK
FT                   EAAKKICDLGAKNVVIKGRKFFAGEKSIDFLYNGKDFEFFESEKIDTEWNHGAGCTFSA
FT                   SITAELAKGATVSEAVSTTKKLITEALKQSFKLNNYTGPLNHKAFALK"
FT   gene            523133..523657
FT                   /locus_tag="Lebu_0490"
FT   CDS_pept        523133..523657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38401"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38401.1"
FT                   /translation="MEKISLEKLKNLMLKKYRKEINFRQLQKEFFKNDDERIEYIKTEL
FT                   EKAYNEKNGKSINTLILAIYMFELHSEKFVDILCKLTKEEWHGKHEDIVFYLQQLELPS
FT                   TIDCIYELAISNFEKYSWDDNFALVRKCCFALGDINTLKAKEKLELLLQSDEEMIRKHA
FT                   MEQLERCDFSD"
FT   gene            523696..524586
FT                   /locus_tag="Lebu_0491"
FT   CDS_pept        523696..524586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nma:NMA0696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38402"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38402.1"
FT                   /translation="MNVLIDEQKFKENYEILSDYKFDFEMEKRCIDYIKNKKGNQLSCM
FT                   RTLSSEYKVLASKNLLIENNLNSFRLNCHISEKLKILGTSKESKLYKASYSLFGLIMSN
FT                   NKEWISFLKNNLNYITSNDFNSKENTYIKSKDLHRNSFLSKTTILALLGDFEEVEKRSK
FT                   KYLEEPLTKSYYAYTKYDFMFFEALVNKNTEKMKRAIHKLLEPKIAKKILFDTDINYSF
FT                   YLNIYVLMYSKIALLHGFDLGINDKMAPKNLIDNTSLQSYEEPYDFMKKIDLVTLTPEK
FT                   WKEWTEDYSIIVPIT"
FT   gene            524830..525576
FT                   /locus_tag="Lebu_0492"
FT   CDS_pept        524830..525576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0492"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: tde:TDE0666 FeS assembly ATPase SufC; TIGRFAM:
FT                   FeS assembly ATPase SufC; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38403"
FT                   /db_xref="GOA:C7NEP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP2"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ACV38403.1"
FT                   /translation="MSLLELKNVKSEVEGKEILKGLNLTINKGEVHVIMGPNGAGKSTL
FT                   ASILVGHPKHELVDGEIILDGENINEDAVDERAKKGIFLSFQYPEEIPGLTVEDFLRTA
FT                   KEAVTGEKQYLMQFHNELVEKMEKLHINPEYADRHLNVGFSGGEKKKNEILQMAVLEPK
FT                   LAILDETDSGLDIDATKIVFEGVQKLKTKDTALLIITHYDKVLEYMKPDFVHILMDGKI
FT                   VKTGGQELVESIEKDGYAKMKKDLGL"
FT   gene            525596..527017
FT                   /locus_tag="Lebu_0493"
FT   CDS_pept        525596..527017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0493"
FT                   /product="FeS assembly protein SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: tpp:TPASS_0612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38404"
FT                   /db_xref="GOA:C7NEP3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP3"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ACV38404.1"
FT                   /translation="MGKMENRKKTYVADIERGVYDIKDEGHYRYKVDKGLTAEIINKIS
FT                   DRKNEPDWMREFRLKALEVYDSKPMTDWGPDLSDLDVNDIVHYLEPDSAPMNENWDDVP
FT                   SYIRDTFDRLGIPEAEKQSLAGVGAQYDSEVVYHSIHKDLEEQGVIYTDIETAIVEYED
FT                   IMKEHFMKLISINDHKFAALHGAVWSGGSFIYVPKGVKVKMPLQSYFRLNAPEAGQFEH
FT                   TLIIVDEGADLHFIEGCSAPKYKKNVLHAGAVELIVKKGARLRYSTIENWSRNMYNLNT
FT                   KRALVEEDGVIEWVSGSFGSRVSMLYPMSILKGDRSRCEFTGVTFAAAGQYLDTGCKII
FT                   HQGKQTSSTVHSKSISKNGGTAFYRGLLKVLPEATGSRSTVECESLMLDNLSSSDTIPI
FT                   IDINNDSVDIGHEAKIGRISDEAIFYLMSRGISEDEAKAMIVRGFVEPISKELPLEYAV
FT                   ELNKLIELELEGTIG"
FT   gene            527054..528181
FT                   /locus_tag="Lebu_0494"
FT   CDS_pept        527054..528181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0494"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: cbe:Cbei_1850 FeS
FT                   assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38405"
FT                   /db_xref="GOA:C7NEP4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP4"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ACV38405.1"
FT                   /translation="MLEKSSIQNLDNSDYRLKIFEEYKTLEKVNWKRVGYKYEEPETFK
FT                   EFNNLEVKNENQDGVVIKNINDSLQELESLKNDNDYGLGDFFKKQNFAFYNEGKYLKIK
FT                   ERKTVEKPIYLNYRANKENNFLVDYNVIEVEDFAKVTVIITYDSEDDTPVYHNGIIKVF
FT                   TGRNAEVKIIKIQTLNTNSSNFESSKIETLGQGKTQYYSVELGGKINAISHKSYLEEDS
FT                   AEVYVWPAYLADEDRKLDLEYSVVFRGRRTIGELQGRGAVKDTAKKVFRGNLYFKQGSS
FT                   KSEGREGEFAILLNDKIKADSIPTLFCSEDDVIGEHAASVGKVDESKLFYLMSRGLSEG
FT                   RAKKLIVESSFRPIMDNIDDEKLREKLFEELERRI"
FT   gene            528270..529475
FT                   /locus_tag="Lebu_0495"
FT   CDS_pept        528270..529475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0495"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; KEGG: tde:TDE2052
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38406"
FT                   /db_xref="GOA:C7NEP5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP5"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ACV38406.1"
FT                   /translation="MNYRKEFPIFKNRNNHYLDTAATSQKPKRVLDKIMEYYEKYNGNP
FT                   GRGSHTLSMEASNLMANARKTVQKFINAKYPEEVIFTKSTTESINLIAYSYGMEFINEN
FT                   DEIILGISNHHANIVPWQFVAKKKNAKIKFVYLAENGQFDIEDFKNKLSDKTKLVAISA
FT                   VVNVTGVIQPIKEIIEIARNKNKNIRILVDAAQSMLHFKHDVQELDADFLVFSGHKLFT
FT                   PMGIGVMYGKKDILDKMPPFLYGGDMIEFVTEQESTFAPLPNKFEGGTQNVEGAVTLEE
FT                   AINFIEEISYEKINEIENSLTKIALEKLKKLDFVETYFTKNVESAGIIAFNVKNVHSHD
FT                   VAFILDSYDVAVRSGHHCAQPLMKYLGVSSCCRASFSIYNNEEDIDKLIEGLLKVKEVF
FT                   EL"
FT   gene            529664..530104
FT                   /locus_tag="Lebu_0496"
FT   CDS_pept        529664..530104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0496"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   tde:TDE2053 NifU domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38407"
FT                   /db_xref="GOA:C7NEP6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP6"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ACV38407.1"
FT                   /translation="MNLEKIYQQTILEYSRRKELNREIENPTFAERGHNPNCGDDLTLE
FT                   IKTDENDVITDAAFIGSGCAISTASMAMLIDLVKGKTMEEAKEKVDLFFKMMKQEEKLT
FT                   GEESKKLGDAVLMEYVAQMPARVKCATLSWHSLKVIVEKNEK"
FT   gene            530137..534516
FT                   /locus_tag="Lebu_0497"
FT   CDS_pept        530137..534516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0497"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fnu:FN0281 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; DNA polymerase
FT                   III, epsilon subunit; PFAM: DNA polymerase III alpha
FT                   subunit; Exonuclease RNase T and DNA polymerase III; PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SMART: Exonuclease; phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38408"
FT                   /db_xref="GOA:C7NEP7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP7"
FT                   /inference="protein motif:TFAM:TIGR01405"
FT                   /protein_id="ACV38408.1"
FT                   /translation="MSTKYLKIKPSKDFSRKYEIRNFEIEYVSLFSRKKEMQVFIKVNS
FT                   FNADNEIQDLRQLLYKNFESEGLKLRMKMDINSELIKKDVVGFIKFAIESYKCESQRYQ
FT                   YIFASYEVENLEDTIFIKLPSHHLIEEAKRVEIKDRLTQRIHDCVDNLIKIEFVNGDFK
FT                   EIKEKIKAQNELNSIKSSELPQYENSNGNFNNGNSNSNFSNGGNFSNNNNNGNNNGNGF
FT                   RRKQIPDMDAVAFSTLDILNDGENVALEGKIFNLDMRETKNGKLMCDFMITDYTNSVSC
FT                   RIFFSTKKDVQVKLGDWVKVTGTFESDMYTGEKYIRTQKVEAIDSKDVKKEDNAPKKRI
FT                   ELHAHTNMSEMSGVMSIKDYAKRAKEFGHSGIAVTDYGVVHSFPFAFKEANEDFKVIFG
FT                   MEAYVVDDEQDLITNPKDKMIEDEIYVVFDIETTGFDPFNDKIIEIGAVKMRGREVIGE
FT                   FSEFVNPEIPIPQKITELTTITDEMVANAEKIETVLPRFLEFCTGTTVVAHNAKFDVGF
FT                   IKQKTIDQGLEYSPSVIDTLPLARTLLPELRGYGLANLVKYFGITLETHHRAVDDAKAT
FT                   AEVFQKFLNMILSKGILKLIEINTDLQPNIQNSETLNTMILVKNQAGLRDLYELVSRSH
FT                   IEFFGKRRPRIPKSLLNSMRENLLIASSASASERNRGELVNLYLRGTEKDDIEEKAKFY
FT                   DYIEIHPTANYTDRVEKRSKEIENYDIIREMNKYFYELGKKLNKIVVATGDTHYLEERE
FT                   VINRNVLLLGSGTMWKTEVAEGVKEYEFFDRKLYFKTTEEMLEEFKYLGEETAQEVVVE
FT                   NTHRISDMIEQVRPIPTGFYPPKIEGAEDEVRKMTYSKLKELYGENIDPDLKERVEKEL
FT                   NSIIQNGFAVLYLIAQKLVHKSVDAGYLVGSRGSVGSSIVAYLMGITEVNGLYPHYRCP
FT                   KCKHTEFMNEEGSGVDYPDKNCPECGTKYIKDGHAIPFEVFMGFNGDKVPDIDLNFSGE
FT                   YQGEIHKYTEELFGSDNVFRAGTISTLAEKNAFGYVKKYLEEVEGTPEIKERKAEVMRI
FT                   AKGCEGARKTTGQHPGGMIVVPKDKSIYDFCPIQRPANDMKATSKTTHFDYHVMDEQLV
FT                   KLDILGHDDPTTLRILQDLTGVDIYTIPLDDKEVMSLFSGTEALGVTPDEIGSPTGTSG
FT                   IPEFGTSFVKQMLVDTRPKTFAELVRISGLSHGTDVWLNNAQDYVRSGIATLSQIITVR
FT                   DDIMNKLIDDGLDKSLAFSIMEFVRKGQPTKNPEKWREFSKTMKEHGVEQWYIDSCEKI
FT                   KYMFPKGHAVAYVMMAVRIAYFKVHYPIEFYTAFLNRKVGDFKMTTMFRPVEDLKQAKM
FT                   ELDRKGTLNVKEKQELFLYEILIEMHYRKIELEQIDIYKSEAKLFTIQDGKIRMPLIAM
FT                   DGLGEAVAENIVSERKVDFLSIEDLVKRTKLNKTIVELMKEYGCLKDLSATNQQTLF"
FT   gene            534709..534888
FT                   /locus_tag="Lebu_0498"
FT   CDS_pept        534709..534888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38409"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38409.1"
FT                   /translation="MFKKILLMIILAMSVVGCELFDAKRWDRINREDAERGETCYRRAS
FT                   GEYYCKDRYGNRTY"
FT   sig_peptide     534709..534762
FT                   /locus_tag="Lebu_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.915 at
FT                   residue 18"
FT   gene            535782..537452
FT                   /locus_tag="Lebu_0499"
FT   CDS_pept        535782..537452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0499"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   fnu:FN2082 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38410"
FT                   /db_xref="GOA:C7NEP9"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEP9"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ACV38410.1"
FT                   /translation="MTDIEIAQNAKLKKIGEIAESIGLTEDDFEPYGKYKAKVSLEVLK
FT                   RNAGKKDGKLILMTAVTPTPPGEGKSTVTVGLTQALNKFGYKSIAALREPSLGPVFGMK
FT                   GGAAGGGMSQVVPMEEINLHFTGDIHAISAAHNLISACIDNHIHFGNELDIDVNNITFK
FT                   RVLDMNDRNLRSIVVGLGPKVNGVPRENSFQITVASEIMAIFCLADSITDLKERIGEIV
FT                   FAYNRKGEMLKVKQLNIQGAVAALLKDAIKPNLVQTLENTPVFIHGGPFANIAHGCNSL
FT                   LATKMALKLSDYVVTEAGFAADLGAEKFLDIKARLGNLEPNVIVIVATVRALKHHGGDK
FT                   DLKSENIETLTKGLVNLEKHIESMQKYNLPVVVAINKFITDTDAEIQVIKDFCAKMDVE
FT                   VANCEIWEKGGEGGKELVEKVMNAIEKNEKSDKKYTPLYDLNLSIQEKIEKIAKEIYGA
FT                   DGVNFAPKALNNIKKYVENGYDKLPICISKTQKSLSDNPNLLGRPTGFTITINEVRLSA
FT                   GAGFLVAMAGEIIDMPGLPRKPAAELIDIDENGVISGLF"
FT   gene            537492..537986
FT                   /locus_tag="Lebu_0500"
FT   CDS_pept        537492..537986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0500"
FT                   /product="5-nitroimidazole antibiotic resistance protein"
FT                   /note="KEGG: cpo:COPRO5265_0471 5-nitroimidazole antibiotic
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38411"
FT                   /db_xref="GOA:C7NEQ0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ0"
FT                   /inference="similar to AA sequence:KEGG:COPRO5265_0471"
FT                   /protein_id="ACV38411.1"
FT                   /translation="MENTKVKMRRRDREITDNEKIKEIIKACDCCRLGLNDNGKVYIVP
FT                   LNFGFTEENGNYTFYFHGTRTGRKLDIIKENNYAGFELDTNHEIYTKGDKACNYTARFQ
FT                   SVIGNGKVEIIENSQEKIKALLELMKHNTGKTEWEFDERMLKTVCVFKLVVEEMSCKEH
FT                   D"
FT   gene            538012..539133
FT                   /locus_tag="Lebu_0501"
FT   CDS_pept        538012..539133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0501"
FT                   /product="SMC domain-containing protein"
FT                   /note="KEGG: pnu:Pnuc_1118 SMC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38412"
FT                   /db_xref="GOA:C7NEQ1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ1"
FT                   /inference="similar to AA sequence:KEGG:Pnuc_1118"
FT                   /protein_id="ACV38412.1"
FT                   /translation="MLKKFTVQNFKNFEDITLDFGNIRNYNFKENVIKNNIISKMLILG
FT                   KNGSGKSNVGLAIFDIINHLTDKEKRLNEYKNYLNYNLSNKDNAFFCYIFQFDSDRVKY
FT                   EYKKIDSETIVEEKLYINDKLCIEYNKNKKIVKIEIEEYVKNFENFNKDLSVNEFEKIS
FT                   LVKYIKGNILLIKEKALYKFFDFIDNMLWIRSLQEGNTYMGYSNGSEKILKGIIDLNKV
FT                   KEFEKFLEEAGIKQKLVQNEDRILIEFKSGKQVDFYKIASSGTKILALLFFWMEISIKN
FT                   VSFLFIDEFDAYFHYSLSKFILERLFSNDNIKQVALSSHSTSLIDNEILRPDCYFVLND
FT                   KGKIKQFSEITDKKIEEYHNIEKMYRTEVFEYE"
FT   gene            539126..539866
FT                   /locus_tag="Lebu_0502"
FT   CDS_pept        539126..539866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38413"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38413.1"
FT                   /translation="MSKILMLTEGKDPDKKLIEHVVEKFQIKGEVIWAKIGTIYAFYKD
FT                   IKEKYDENMDIIRYIKYKYSDKISKEFKASEISYVYLFFDYDLHSKLNEEYKNIEKIYE
FT                   RINEISEINSFFENETENGKLYLSFPMIEAYHKPIGCNYIYEKNNFEEKLEDFTDFKKK
FT                   IKNETGNMGMKAIKSQYKKVINFYIDNSENILEMKFKDVEKNKILKFQNELLKEENKVK
FT                   IYPSIPIFLNEYYEIEKLQEKLKI"
FT   gene            539900..541126
FT                   /locus_tag="Lebu_0503"
FT   CDS_pept        539900..541126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0503"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tde:TDE1669 hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38414"
FT                   /db_xref="GOA:C7NEQ3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV38414.1"
FT                   /translation="MSKKYDFEIILSRKGQGSYKWEQMYEVLPELEDDIVPFSVADMEL
FT                   KIAPEITEGMKKYIDEAVLGYSGTYPKYYEAVIGWMERRHGFKVEKDWILCTPGVVSAI
FT                   YVAIKAFAKENEGVIMFTPVYYPFYSAITSNKRKLVDCGLVESKNENGEIKYSIDFEKF
FT                   EEFAKDENNKVLLLCSPHNPLGIVWSREDLKKIGKIVVENDLIVISDEIHFDIVMAGHK
FT                   HTVFQTLSEKFAEITITCTAPTKSFNLAGAGISNIIIKNEKLRKKFKAEMEKMSMHVFA
FT                   TLSYKACELAYAEAEEWLDEFLLLIDKNQKLVNKFFEEKFINLKALLIQGTYLQWLDFR
FT                   SLGLKNKELAEFMNKKARIFFSEGYTFGKAGGGFERVNLAVPTEYLEKMLERLYEVLKI
FT                   EFPKFCKNK"
FT   gene            541365..543032
FT                   /locus_tag="Lebu_0504"
FT   CDS_pept        541365..543032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38415"
FT                   /db_xref="GOA:C7NEQ4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38415.1"
FT                   /translation="MTKKLNNIIETGKEKMKVKNLKKIEIGLLALINAIIGFNANAANN
FT                   NTKIELPKEYSENITIEGQEKDVFDYDFNNDGINEKVVVSYSAVDNLLNAVVSIYTNQG
FT                   GKDILTYQVAFDKKFSIKEIQEMQKMLDKVKEYYPEYSKNIQPNETRYVTIYGDNRNSD
FT                   ISFDKVKFDNHSPKDLNNFLFIKKSSAMLDAPNGNAVASLKFSEKPLILFDMVSDASNS
FT                   QTKWYYTEFTKRNDTNMARKVKKDKDGKTVAENSTPVRGFVAGSEDNVSRRGFYWDKMV
FT                   KRMELINRFITETISSGKDLYIITEYKPLSHDKPSEKDKFGNKNNQSIVGYTNSKREGE
FT                   KINIPDQTVFRVIGEENKMLKIETPFYGGPYYIEKVEGTYQKAENIKGEVNKFIAIDPS
FT                   SQTEAIFQRDPKTGKYDVITYSFVTTGKDGYGSYETPHGAFQVAFTRPYMTFTRRARGG
FT                   DRTIAGRSDLAIAGSARYAVRISGGGYMHGIPVGLNFKGSTLNTGIASKIGTYKDSHKC
FT                   VRHFDDQIEFIVGWVNADSKIKDKDNTIPEEPVIALVL"
FT   sig_peptide     541365..541493
FT                   /locus_tag="Lebu_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 43"
FT   gene            543071..544855
FT                   /locus_tag="Lebu_0505"
FT   CDS_pept        543071..544855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0505"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   amt:Amet_2951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38416"
FT                   /db_xref="GOA:C7NEQ5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACV38416.1"
FT                   /translation="MIKRTKLKKSKFFIAALTMLSIMSANSFSASKKSSQQKQQHTEWK
FT                   QITLEPDLDGDGIKDKIDVEYAEMGGNIYLKFTPYVFTEKAKFEKGKQVEKTITKSDFE
FT                   EKFDNFVKGFIAEYPKKNGGSQPAVTEQPIETQDTNAETPAPAVENKPEETATTINNKT
FT                   DETDKKPVSQKKNTVNSEGNTENDKALDSLRESNMVKAQNTVLDNKNNDNSNNSAQNQN
FT                   INSSYSYIKQYFGKRTENLTFNFGYDKHSPRDMDEFVFIKTATSIRKEPNSNAKVIKSA
FT                   TYSQKYKTTGIVKTNVGNKSDEWYEVFFDNQLGYIPKSAVEKREFDWNDMMKKVDKTNK
FT                   FIKEAVSANKKIYVLDDYVPLGGGESGKRDKFGNRANQSEFGYIDKSFKDYINIPDRTI
FT                   MVVEEENDKYVKVKIDAYDNGVYYLKPSSKKYLKEAGITGEVSRFIYVDRSSQNEMIIE
FT                   KSGNGWNVVTSSFVTTGKDAGNSFATPYGTFLIAYSKPVMSYTGSGGGVVGDAKYAVRF
FT                   SGGGYMHGIPSVFEPKNTREQRKAATAKKIGTYPESHKCIRHYDDQIKFIYEWLGNSSP
FT                   GHSEGFRVPSVPTVMLVK"
FT   sig_peptide     543071..543160
FT                   /locus_tag="Lebu_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 30"
FT   gene            545030..545749
FT                   /locus_tag="Lebu_0506"
FT   CDS_pept        545030..545749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: tme:Tmel_0021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38417"
FT                   /db_xref="GOA:C7NEQ6"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ6"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACV38417.1"
FT                   /translation="MEFFRNFQFGVNELMWLGYLLLNFTAVILAYRFWGKAGLLSVVPL
FT                   SIVIANIQVGKMMTLFGVDTTMGNIAFGGIYLASDILSENEGKKYARKVVSLGFASMLF
FT                   TTFIMQIVLKIQVAPSDTMQGALNQVFGFMPRLAVASVTGFAASQAFDIWSYQAIRKLR
FT                   PDFKDIWIRNNASTMLSQILDNIVFSFMAFLGVYSMKEIIVIIFSTYFLKVVIALLDTP
FT                   FVYIATIWKNNGKVNEE"
FT   gene            545765..546469
FT                   /locus_tag="Lebu_0507"
FT   CDS_pept        545765..546469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0507"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: fnu:FN1995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38418"
FT                   /db_xref="GOA:C7NEQ7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV38418.1"
FT                   /translation="MIRYSVIKEKNPREIVLLKGFSCAYGKCAFCNYILDNTDDEEEMN
FT                   RVNLEAINQITGETRALQVINSGSVFELNDFTLSKIKEVCQEKNIKILYFEAYFGYINR
FT                   LDEIRKYFSEQEVRFAIGIETFDNEFRTKVLTKNFVTNDKVLEKIKKEYKMGLFMICIK
FT                   GQTKEMILRDIELAQEYFDEIALSVFVNNDTKVERDEELVKWFLTEIYPELNKNQNIEI
FT                   LVDNKDFGVYVQ"
FT   gene            546679..547317
FT                   /locus_tag="Lebu_0508"
FT   CDS_pept        546679..547317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0508"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   amt:Amet_0071 precorrin-6y C5,15- methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38419"
FT                   /db_xref="GOA:C7NEQ8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ8"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ACV38419.1"
FT                   /translation="MKNKINVLGLGPGNLDYTLPVVLKEIEKSDIIIGGKRHIESLGKY
FT                   AENKEYCYINADLQRVLDFIEENRNKKISLILSGDTGFYSMLTFMRKHFEAKELNVIPG
FT                   ISSIQYMFARVSEYWNDAFVSSVHGREVEYVQKLREFGKIGLLTDNKNTPQKIAEILLE
FT                   NGMEKAIIFVGENLSYENERILEFSAKEMVKVDEKFEMNVVVIYWNGKE"
FT   gene            547333..548730
FT                   /locus_tag="Lebu_0509"
FT   CDS_pept        547333..548730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apj:APJL_1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38420"
FT                   /db_xref="GOA:C7NEQ9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NEQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38420.1"
FT                   /translation="MKIKFKNLGPIESGEIDFNDLKGINLIIGKNNTGKTYLSYLIYSY
FT                   FKFMDKFNITSFTFLNNIVLNEKKIIDYDWFQKNYEEEIKIKLRKELITTFHVHNDFFR
FT                   NFEIVNIDLTDEMKKFKEKDAESRILVASKNKIKENKTIITKKKEHEIIFEIKDYFKNY
FT                   EDEFKSDSFDAEIIGISRNFKEKEMKQFGLEYLFRKLLLNIFIKIYFFPAERSGAVLFY
FT                   NQLLENRNNILRNLELSQDMNLLKDVSRYSEPVNEYIIRLNQLEEYENREETEIYKNLV
FT                   KDIDIQNIIEGEIIIKSNQIIYKNENDVELNMGLVSSTVKTLAGFFLYLKYQAQKGDII
FT                   FIDEIELNLHPENQRKIMKLINYLSKQGLKFVISTHSPVITQEMNNMIMFEKCKDKIDD
FT                   EIIKEYSIDRQNYGLRQEDVNIYFLNNKTIEQAEFGEDGVITETFNEVLGEIDNLYQEL
FT                   LFAMEEE"
FT   gene            548731..549411
FT                   /locus_tag="Lebu_0510"
FT   CDS_pept        548731..549411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38421.1"
FT                   /translation="MFDFINNNFDNSFSEIIKEELYLEEKKNKRANNKRVNNTGLHKVK
FT                   VLFNPDKYQVLKLTLDINNIDENLKRLLPFFKKEISSVDNVLFVKRLKDNKYFLFHIEL
FT                   KSKTIDNKLVKKYYSSAKLLYFIFEMLYLNYRDEKEKEKRILDFDFPKKIYNIPVLIAS
FT                   KSSSGGVEEIKVRNKEDIFYNNQNFKYLCRYCGLKSQKGIIILEKMCNKVNTFESSLDE
FT                   IEFF"
FT   gene            549522..552200
FT                   /locus_tag="Lebu_0511"
FT   CDS_pept        549522..552200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0511"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: fnu:FN1517
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38422"
FT                   /db_xref="GOA:C7NER1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER1"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ACV38422.1"
FT                   /translation="MIKEYKPSEIEKKWQDKWFEEDVFKSENKIEGKENYYVLEMFAYP
FT                   SGKLHVGHLRNYAIGDAIARYKKMKGFNVLHPFGWDSFGLPAENAAIDNGAHPGKWTKA
FT                   NIDNMRRQMKLMGLSYDWNRELSTYTPEYYKWNQKFFIEMYKKGLVYKKKSYVNWCPDC
FT                   NTVLANEQVEDGKCWRHGKTDVIQKELSQWYFKITEYAEELLQGHEELRGHWPEQVLTM
FT                   QKNWIGKSTGSEVDFILDYKFENDGNSHLKLNDNGEVVISVFTTRPDTLYGVTYATVAP
FT                   EHPLVEEIILKENPSIREAVERMINEDKIARTAEDKEKEGVFSGLYVINPVNGEKVQLW
FT                   IANYVLMDYGTGAVMAVPAHDERDFQFSKKYNLDLKIVVNPVDKNGNLEEVSVEKIENA
FT                   LVNSGVLVNSEEFNGLNSNEAKEKITEKLEKIGLGKKTVNYRLHDWLISRQRYWGTPIP
FT                   VIYDEDGNIYLEEEANLPVKLPTDIEFSGKGNPLETSEEFKNVILPNGKKGRRETDTMD
FT                   TFVDSSWYYLRYLDSHNDKEPFKKEDADNWTPVHQYIGGIEHAVMHLLYARFFHKSLRD
FT                   LGYVDTNEPFKRLLTQGMVLGPSYYSQNERRYLFPREVEMKDGKPVSKETGEELATKVE
FT                   KMSKSKNNGVDPEEIVKEYGSDSSRVFTLFAAPPEKELEWNMNGLAGAYRFINRLYLLI
FT                   SSTADFADKNVSKENNYGINLDARSEKDKEIQKKLHQTVKKVTDSIEDDFHFNTAIAAI
FT                   MELLNDMTTYKQNVIDKNDISSESKKVWHEVLEKVILLIAPFAPHVADELWSDLGNTTL
FT                   TFEEEWPAFDEKLTVENNFNLVLQVNGKVRDMLPAQIGISKDDAEKLAFSSEKVQKFIK
FT                   GKEVVKVIVVPNKLVNIVVKG"
FT   gene            552224..553060
FT                   /locus_tag="Lebu_0512"
FT   CDS_pept        552224..553060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0512"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: smu:SMU.796
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38423"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER2"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACV38423.1"
FT                   /translation="MAKIAVTGVTGNLGGMVSRLCKENGIKVRNLARNKEKAEKMGFSD
FT                   VFKSNYDKSEDTIKSLEGIDVLFMVSGSENSDRVQQHKDFIDVAKMAGVSQIIYLSFYN
FT                   ASKNSVFTLGRDHYATEEYIKENGFKYTFLRDNFYADFFVNLCREYGEIKGPAGNGKVS
FT                   VVVCSDVSEVVAKILENPEKWENQVLNMTGPEDLTMEEITKLASKYLGKEIKYIAETVD
FT                   EAYESRKIWKAEQWEYDSWVSTYTAIAENEQSGVSNDIEKVLGRKATSLMEYLKQL"
FT   gene            553307..554221
FT                   /locus_tag="Lebu_0513"
FT   CDS_pept        553307..554221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0513"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: swo:Swol_0935
FT                   LysR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38424"
FT                   /db_xref="GOA:C7NER3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER3"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACV38424.1"
FT                   /translation="MTLQQLKYVVTVAEKGTLSDAAKELFISQPALTKAIKELEDEMNI
FT                   RIFSRTNKGVIVSREGDRFLGYARQVLEQTNLLEEEYKKGNKITRRFSVSTQHYSFAVN
FT                   AFVDVIKKFGENKYDFTLRETQTNEIIEDVSKRKSEIGILYTSGANKNVIEKMIKRNNL
FT                   KFIELFTAKPHVFISFNHPLAKKESISLEDLKEYPYLSFEQGDYNSFYFSEEILSTLDR
FT                   DKNVKVRDRATLFNLAVGLNGYTVSTGIISKELNGENIIAKPLEVDEYMKVGIIMQKNI
FT                   ELSVYGKVYVEALKEHLKYTEIP"
FT   gene            554425..556713
FT                   /locus_tag="Lebu_0514"
FT   CDS_pept        554425..556713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0514"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /note="TIGRFAM:5-
FT                   methyltetrahydropteroyltriglutamate/homocy
FT                   steineS-methyltransferase; PFAM: Methionine synthase
FT                   vitamin-B12 independent; Cobalamin-independent synthase
FT                   MetE domain protein; KEGG: ckl:CKL_1763 5-
FT                   methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38425"
FT                   /db_xref="GOA:C7NER4"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER4"
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /protein_id="ACV38425.1"
FT                   /translation="MKTAIVGYPRIGENRELKFAIEKYWRNEITENELLKIAKELRKNQ
FT                   WLKQKEEKISFIPGNTFSFYDGILDTIILLNAIPKHYRDLGLNELNTYFAIARGYQGEK
FT                   GDVKALSMRKWYNTNYHYMVPELDDYAEIKLNSDKIFNELEEAEKLGVNTHPSVIGPFT
FT                   FYKLAKTTGNKDKKDYLDDIVNAYVELLRKCNKKNIEWIQIEEPQLVTDQTEEDINLFE
FT                   EIYMEILKNKKDVKVLLQTYFGDVRDCYKTITELDFDGIGLDFAEGRQTQKLIAEKGFP
FT                   KDKVLFAGVVNGKNIWKCDYKKVLNILNNLKEKVKNVVITTSCSLLHVPYTLRNEKKLS
FT                   ENILRHFSFAEEKLSELKELGELSQILWESSLEKAQENEFYIKNQEIITSERGMEDKEV
FT                   RDKVEKLTDNDFVRKGTRKERQIIQREKLNIPLLATTTIGSFPQTKEVKLNRSKFRKGE
FT                   INKKEYDKNVFSFIKECIELQEEIGLDVLVHGEYERNDMVEFFGENLAGYIFTEKAWVQ
FT                   SYGTRCVKPPIIFGDVKRTKPISVLYSEYAQKLTEKPVKGMLTGPVTILNWSFPREDIS
FT                   LSEMAFQIGLAIREEVLDLEKAGIKIIQIDEAALREKLPLRKEDWHKEYLDWGLKAFRL
FT                   CHSGVKVDTQIHTHMCYSQFEDIIKDIDNMDADVITFEASRSKLTILDFLKENNFETEV
FT                   GPGVYDIHSPRVPSVEEIVVALEIMIEKIGKEKLWVNPDCGLKTRGIVETVKSLENLVK
FT                   ATEIVKSRL"
FT   gene            556787..557929
FT                   /locus_tag="Lebu_0515"
FT   CDS_pept        556787..557929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0515"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="PFAM: Methionine synthase vitamin-B12 independent;
FT                   KEGG: sgo:SGO_0747 putative methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38426"
FT                   /db_xref="GOA:C7NER5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER5"
FT                   /inference="protein motif:PFAM:PF01717"
FT                   /protein_id="ACV38426.1"
FT                   /translation="MCTINAPHRHDTVGSFLRPERLKKVRNDFEKGRIDREELTKVEDE
FT                   EIKKIVDKQIELGYTSVTDGEFRRSYWHLDFFWGFNGIGHIHADKGYEFNGVVTRDDTA
FT                   IVTGKISGENHPFVKHYTFLRDLVKDKRGVEARFTIPAPAQFYAELVREDKHVAALLKV
FT                   YPDFKGLEDDIVNAYKTVINDLYNEGLRTLQIDDCTWGCLVDDNFIASFIEKSDRDKEV
FT                   IRHEFSEKFLNINNRVFQNNPKDLVINTHVCRGNYASTWFGQGGYDKIADELFGKEDVN
FT                   AYYLEFDTERAGTFESLAKVSGDKKVVLGLITSKNPTLEEKEVIIARIREASKYVPLDR
FT                   LYLSPQCGFASTEEGNRLTEEEQWAKLRFIKEIADEVWGK"
FT   gene            complement(558024..558935)
FT                   /locus_tag="Lebu_0516"
FT   CDS_pept        complement(558024..558935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0516"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="TIGRFAM: prolipoprotein diacylglyceryl transferase;
FT                   PFAM: prolipoprotein diacylglyceryl transferase; KEGG:
FT                   fnu:FN0489 prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38427"
FT                   /db_xref="GOA:C7NER6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER6"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ACV38427.1"
FT                   /translation="MRPYLFKIGGFELRIYSLMYILAFLFGMFICLADDVAEKRGVDDR
FT                   KTIEDFVFATIVAGLIGARLYYVIFKFSDYAGDPLSIFYIWQGGLAIHGGIIGAFVGAC
FT                   LFARKSKVNLWVLTDMGVGPLLFGQFLGRFGNLANGEVHGVPTFTPWNVIFSGKFSEWW
FT                   AKYQTLGVAEQAQFKQLVPWGLTFPLDTPAGSEFPNLPLHPAMLYEGALNLIGFLILWF
FT                   YFRKKEYNPGVLSMIYLIIYAIIRTFVSTFRAEDLLIFGIRLPYIISIIMIIIGIVGIK
FT                   YFSRPERKFVPAEKENSENNKN"
FT   sig_peptide     complement(558834..558935)
FT                   /locus_tag="Lebu_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.929 at
FT                   residue 34"
FT   gene            complement(558974..560059)
FT                   /locus_tag="Lebu_0517"
FT   CDS_pept        complement(558974..560059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0517"
FT                   /product="Serine--pyruvate transaminase"
FT                   /EC_number="2.6.1.51"
FT                   /note="PFAM: aminotransferase class V; KEGG: csc:Csac_1303
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38428"
FT                   /db_xref="GOA:C7NER7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER7"
FT                   /inference="protein motif:PRIAM:2.6.1.51"
FT                   /protein_id="ACV38428.1"
FT                   /translation="MSSKLLLTPGPTNIPEEYLEILGSDIIHHRTPKFREIMKENNENL
FT                   KKIFKTTNDVAILTSSGTGSMEAAIVNFFSKGDKVLAINTGYFGDRFRKIGEIYGLNMI
FT                   NLQYEFGESYNLDDVKKVIAENPDLKGILATHSETSVGILNNIKALGDLTKNTEILLVV
FT                   DTISGLVVNEFDFDGWHVDVAIAGSQKAFLIPPGLAFVAVSDKAKKAMETSDLPKYYFD
FT                   LKQYEKYFDASAETPYTPAIALILALNQSLKDLVKNGIENTINQKRDLRKYVEEKAQKL
FT                   GFELLVKNEENRTNTLISVYREGIIIKSVITALEEKGYTVTGGKGKYAESLMRIGILGQ
FT                   ISKEQIDDFFVIFEEEIKKQL"
FT   gene            complement(560103..560939)
FT                   /locus_tag="Lebu_0518"
FT   CDS_pept        complement(560103..560939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0518"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: fnu:FN1224
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38429"
FT                   /db_xref="GOA:C7NER8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER8"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ACV38429.1"
FT                   /translation="MLINKVKKVKITDKITIGNDKIFLIAGPCVIESEDLVTEVAGKMK
FT                   EITDKLGIQYIFKASFDKANRSSISSFRGPGLEKGLEILSRVKEKYGVALATDIHEPWQ
FT                   CKEAAKVIDLLQIPAFLSRQTDLLVAAAETGKAVNIKKGQFLAPWDMKNVVKKFEEVGN
FT                   ENIMLCERGASFGYNNLVVDMRGLLEMRKFGYPVVFDATHSVQIPGGQGETSGGNRAYV
FT                   YPLARAAVSVGVDGVFAEVHPEPDKGLSDGPNMLKLDDVENILEKLLQYDKLTKEL"
FT   gene            561127..562248
FT                   /locus_tag="Lebu_0519"
FT   CDS_pept        561127..562248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0519"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: tpd:Teth39_1623
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38430"
FT                   /db_xref="GOA:C7NER9"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NER9"
FT                   /inference="protein motif:PRIAM:2.7.7.22"
FT                   /protein_id="ACV38430.1"
FT                   /translation="MDRVALIMAGGSGTRFWPLSTNEKPKQFLDLVSEKTMIRETIDRI
FT                   KDLISVEKIFISTNIKYFDIIKKELPEISDRNIIFEPMARDTAACIGYAACIIKKIYKD
FT                   SVMAVLPSDHLIKKEKEFLESLEFAFLEAEKNKIVTLGIKPTYAETGYGYIEYVDNRKK
FT                   GKYEKKTIAEKTFKSYRVKRFREKPNKELAEKYIEQGNYLWNSGMFVWKTEFILQEIKK
FT                   HMETHKLVLENIEELLENVDLCEIYGEKLSNFVKDEFDKFEKISIDFGVMEHTKSVSVI
FT                   PVDIGWNDVGNFKSLEDIFPKDEDRNVVQAENFEKFESEGNIVINKENDKIIAAIGLEN
FT                   IVIVNTKDALLVCHKDKSQEVKKILNKIELKNK"
FT   gene            562267..563244
FT                   /locus_tag="Lebu_0520"
FT   CDS_pept        562267..563244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0520"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: fnu:FN0903 polysialic acid capsule expression
FT                   protein KpsF; TIGRFAM: KpsF/GutQ family protein; PFAM:
FT                   sugar isomerase (SIS); CBS domain containing protein;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38431"
FT                   /db_xref="GOA:C7NES0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES0"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ACV38431.1"
FT                   /translation="MQIDIIKEAKSVFDIEITELEKLKNRIGDSFQKLVNTIMELKNNK
FT                   VVVTGIGKSGIIGEKIAATLASTGTTAVFLNAAEALHGDLGIISNGDVVIAISNSGNSD
FT                   EILSILSPIRKIGGKIVGFTGNPNSTLGKYADITINVGVEKEACPLGQAPMSSTTSTLV
FT                   TGDALAVCLMKLKNFSESDFAKYHPGGSLGKRLLLHVSDLMHIGEELPVVKKDEKIENV
FT                   LMTLTKKKLGAVCISDTGFGNGKLLGIITEGDIRRALEHKEKFFDYKASDIMISTPVTI
FT                   EKDAMALDALHLMENRKSQISVLPVVENGNVVGLIRVHDLIGLR"
FT   gene            563264..564721
FT                   /locus_tag="Lebu_0521"
FT   CDS_pept        563264..564721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0521"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   rca:Rcas_0772 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38432"
FT                   /db_xref="GOA:C7NES1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES1"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACV38432.1"
FT                   /translation="MDNKNLLKGTMVYSLMNLVTKMGSFIFLPIITRLLTQEEFGIVGT
FT                   LAPITSLFTVILGLGLYNAQMKKYVDLKENEDEFGSYMFSSTLIIVVFNVVTYIFLFTP
FT                   PAQKLFSYIVDLSKVSYYPLIIVSILIATSNAFNNLAVTLFRMKRMYMKVAIGSVVSLF
FT                   TTYILAIYFIQYLKWGVFGNQFANLIALLIVFLFYFKDYFGKFRFKLNLDYVKYSLRNG
FT                   LPLIFIELTDQVVNLSDRLVLAKFVSLAVVGGYTLAFTGGRVLSVITGSFVNSWTPEFY
FT                   EAMKEDRTNPRITRSVENFIAIISFACVIAQLFAPEGIKLIFPKSYYQAINYMPLILAG
FT                   IVVQALFCLDYFFHFHEDSIYIFYFTMFAMIFNLVGNIIFIPKFPEIGPIIAAWTTLLA
FT                   FLFRAIMEMIIIRKKYKISFNYKKLFLYFIIIVNPVIFYLSNDQLSWMKFGLKIVYLAI
FT                   VTKLLVNREVYAKITNLVNGIKRKILK"
FT   gene            564755..565633
FT                   /locus_tag="Lebu_0522"
FT   CDS_pept        564755..565633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0522"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cdf:CD2773 putative beta-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38433"
FT                   /db_xref="GOA:C7NES2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACV38433.1"
FT                   /translation="MKFTVFTPTFNRKELLEKLYKSLQKQTYTDFEWLIVDDGSTDGTG
FT                   EKVKEFLEESKLDIKYFYKENGGKQRAYNFATDKANGELFICLDSDDEYVENGFETILK
FT                   YWEKYEKDANIAGMGYLSMYPDGEIIGSSFPEKEMISTQFDIYNKYGVKGDKGLMFRTE
FT                   IIKKYKFPVFDEEKFITEAVIYNRICEKYKMVYVNEKIEIKEYQEDGLTAKYNNLLLRN
FT                   PKGQALYHNEINTQNLSFKQKVLNNAVYYKFCRAAGYKFGKIFKENKNKLFLIFALGIG
FT                   EYMWQKEKNKK"
FT   gene            565691..566785
FT                   /locus_tag="Lebu_0523"
FT   CDS_pept        565691..566785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0523"
FT                   /product="tRNA(5-methylaminomethyl-2-thiouridylate)-methyl
FT                   transferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="KEGG: fnu:FN1920 tRNA (5-methylaminomethyl-2-
FT                   thiouridylate) -methyltransferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)- methyltransferase;
FT                   PFAM: tRNA (5-methylaminomethyl-2-thiouridylate)-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38434"
FT                   /db_xref="GOA:C7NES3"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES3"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ACV38434.1"
FT                   /translation="MNKKLDDKKVVVGMSGGIDSSVAALLLKQQGYEVIGVTLKHLPDE
FT                   LSENPGKTCCSLDDINDARYTCYNLGIPHYVLNVVEEFKKDVMEYFIKMYNAGKTPSPC
FT                   VICDEKVKIKKLVEFADKMGIKYISTGHYSKVSENNMLLWDKNNRKDQTYMLYRLDKDI
FT                   VERFLFPLAEYEKSEVREIARQNGIHTHNKPDSQGICFAPNGYIPFLKKVLGNDVKKGN
FT                   FVDKNGKIIGEHIGYQFYTIGQRRGLGLNLGKPFFVLELRPETNEVVVGDFEELLIKEI
FT                   EVINYKFHYSLENIIGKKLTARPRFSSKGLTGELKILKNEESNENRIIFEFDEKTHENS
FT                   EGQHIVFYLNDEIVGGGEIKLLLK"
FT   gene            complement(566836..567390)
FT                   /locus_tag="Lebu_0524"
FT   CDS_pept        complement(566836..567390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0524"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein;
FT                   Resolvase helix-turn-helix domain protein; KEGG:
FT                   cpr:CPR_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38435"
FT                   /db_xref="GOA:C7NES4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES4"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACV38435.1"
FT                   /translation="MGRKSKISNELRIELVKKILKGKETIQNLAKEYDVAKSSLMTWKK
FT                   KYLELGEKSIMVDEKNKHYTRETRIKAVKSYLNNEGSLFEICKKYGITSVSVLNYWIRD
FT                   YKKSVDENGNYKIFKKHIRKSVESKIEAVTFCQKHDYDYNLTTQKFDISYQQIYSWVKK
FT                   YEAGGAEALIDNRGKRLSDRK"
FT   gene            complement(567437..568120)
FT                   /locus_tag="Lebu_0525"
FT   CDS_pept        complement(567437..568120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0525"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: afl:Aflv_1282 predicted
FT                   membrane protein, hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38436"
FT                   /db_xref="GOA:C7NES5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES5"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ACV38436.1"
FT                   /translation="MSKKTKNRNKQLLAKIHKQAEDFSRGEEIANFVSHTVGAGLAIIA
FT                   FIILIIRASWTRDIGTIISFMAFGSGLIVLYTMSSIYHGLKPGTAKMIFEIFDHSAIYI
FT                   LIAASYTPFLYLVVNPPTNKIVLIIQWTVCFLGIAFKAFFTGKFKLLSTLLYLIMGWMI
FT                   VFAWGDLINNINRVSLVYLIAGGVLYSLGTIFYSWKICKFNHMIWHIFVILGSVSHFLA
FT                   VYYLV"
FT   gene            568638..569264
FT                   /locus_tag="Lebu_0526"
FT   CDS_pept        568638..569264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0526"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   fnu:FN1834 biopolymer transport ExbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38437"
FT                   /db_xref="GOA:C7NES6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES6"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACV38437.1"
FT                   /translation="MFKYLINGGIFMWVILFASICGLAIILEKTYTFLTKEKKLTENEK
FT                   NKLYKSLRTGNREEILRLCKDKTDSVSKSVTKIVSNMDINFAELDNSHRQVIEGIISES
FT                   ILEQTTELEKGMSLLGTVVNAAPQLGLLGTVTGMITAFSALTRNGESTARIVASGISEA
FT                   LYTTAFGLIVAIPALVFYNYFNRQIDIIVAEMERAALQFLSRVKD"
FT   gene            569308..569724
FT                   /locus_tag="Lebu_0527"
FT   CDS_pept        569308..569724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0527"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   hch:HCH_02701 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38438"
FT                   /db_xref="GOA:C7NES7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES7"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACV38438.1"
FT                   /translation="MKFSKRRRRQNVDISMLNLIDVIFMLLIFFMIATTFNNYSQFQLS
FT                   VPKTSTKLEQKENTKIEVIFNKDKKYFLKINDNIQEVSKENISSEFSKLPKEVLKNITL
FT                   TADEHLEYKDIVDTMSILKNMNIENISLNIQNKN"
FT   gene            569771..570754
FT                   /locus_tag="Lebu_0528"
FT   CDS_pept        569771..570754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: heat shock factor (HSF)-type DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38439"
FT                   /db_xref="GOA:C7NES8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38439.1"
FT                   /translation="MKYYIISAAINFGILLIPIATPVLKQKLEEKKEKQTIVVDLKNSI
FT                   LEENKTKSTVDTDSNEESNGTAGLQKGNPQNKNNAISETQNIEPSKQPKNPKQPKLSPE
FT                   QPIQPKQPQQPAPQPPKVPQNTPPKEQPKPTSRPIIPPVTSTPKTATQPVISQSTGNSA
FT                   STKPVQNTITASNSTISNNSGHKNTPSNSGTSHGNKNGNTTNGSSTGSKNGNGTGTSGN
FT                   STSSGNGNDKKSGSTRGGGCRRGVDFSVSYNSHLEVPTANQRLKRKETIVATIRFTRGG
FT                   SVAIQSVTGGNSQSQAAARRAASNVHVSFLTDNCSSGIVTLQFNIN"
FT   gene            570844..571920
FT                   /locus_tag="Lebu_0529"
FT   CDS_pept        570844..571920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0529"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: gtn:GTNG_2342
FT                   proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38440"
FT                   /db_xref="GOA:C7NES9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C7NES9"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACV38440.1"
FT                   /translation="MEKRTEKLSRILNELNIDGLFITDLYNLRYFTGFTGTTGVALATK
FT                   NGNFFFSDFRYKTQATKQVSEMGFEFVEVSRGSLQTVGEYIKKFGLKNVGFEDVNVAFS
FT                   LYQTIKDIFKVELVPVGNKLVMERMVKSEEEIALIKKAVEISDVAFSEALKIIKEGVSE
FT                   KEVSSYMEYIQRKLGADDRSFTTIFASGYRSAMPHGVASDKKIQKEEFITMDFGAYYEG
FT                   YVSDMTRTVYYGDNISDRHVEIYNTVLEAQILGVNTIKEGIMSDDVDKVVRNFLTEKGY
FT                   GEYFGHGLGHGIGAEIHELPYLSSASHIELKENMVVTSEPGLYFDGWGGVRIEDDVVVK
FT                   KNGSEALNKSNKELIILH"
FT   gene            complement(572022..572675)
FT                   /locus_tag="Lebu_0530"
FT   CDS_pept        complement(572022..572675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lmf:LMOf2365_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38441"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38441.1"
FT                   /translation="MVMKNIVPKLKMKRKDFWKYISISHENAKNNNEFVDYLINILSKK
FT                   TDEEIFDFEIITTELMRESYNEKLWCASYLVNGDTASWSFDFFRLWLISQGEKIYYSII
FT                   KNQDNLAKYINISFEKKLLTNYFENENFAFIPAYAFSRKNYSHNILNKENYKINNKTIF
FT                   QDDFIDSYNKKLNNYKRKIGYINKKYPKIIFHWCTQFPNSMKEVCPTLFKKMYS"
FT   gene            complement(572768..573364)
FT                   /locus_tag="Lebu_0531"
FT   CDS_pept        complement(572768..573364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38442"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET1"
FT                   /inference="similar to AA sequence:KEGG:Bcer98_0952"
FT                   /protein_id="ACV38442.1"
FT                   /translation="MEKYVMFRGKIIDKWYDFDKRAHYHIVATDNNGKKYDLAVNIGSI
FT                   YAKKNEIISSNLKVYYTKNYNSQKDIIQEMLLQKVGITECNENLHLDYIKMKLFPHEKM
FT                   IQMKGFDEKNIFLTEIIEKYVMKAINNDDYEVFAFGRLYANGKGLHDIHMNQGSTGKFK
FT                   KHDAPYSDGGLFFRNKQNNKIAVIFIAFVSQNLDV"
FT   gene            complement(574005..574589)
FT                   /locus_tag="Lebu_0532"
FT   CDS_pept        complement(574005..574589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_2323 CRISPR-associated helicase
FT                   Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38443"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38443.1"
FT                   /translation="MRKLKYTLLFVMLIFGLNSCLTTMVGWGICEQYGCTPSPKKNGIE
FT                   GVEIFAKENFLEFKSYFESLKKRETVMVKAGNNETFNVNLPKSFILKKIKDGYYLYDEE
FT                   KKIGFFVIEDLRVSQSYDKRDIEKIFNGSDRKDYKIINVNKDVQTLKDKKGLILKLKKF
FT                   SENYYALASFYESDEHSKEIQEIYDYLLEKM"
FT   sig_peptide     complement(574512..574589)
FT                   /locus_tag="Lebu_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.666 at
FT                   residue 26"
FT   gene            complement(574591..574794)
FT                   /locus_tag="Lebu_0533"
FT   CDS_pept        complement(574591..574794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38444"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38444.1"
FT                   /translation="MPDYDKDLVEQRNNVLKEELRNTDPRNPSLERSGTEIQNFERKNN
FT                   LQQNNNNNLEDVLKNLRERIGK"
FT   gene            complement(575022..576389)
FT                   /locus_tag="Lebu_0534"
FT   CDS_pept        complement(575022..576389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0534"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="KEGG: fnu:FN1014 dihydrofolate synthase; TIGRFAM:
FT                   FolC bifunctional protein; PFAM: Mur ligase middle domain
FT                   protein; cytoplasmic peptidoglycan synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38445"
FT                   /db_xref="GOA:C7NET4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET4"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ACV38445.1"
FT                   /translation="MKINEVLEKIFNMRTINKKITKESLNQNNEKLKKIYELLGEPCKN
FT                   KKIIHIAGTNGKGSTATFLENIFFAGGYSVAKFTSPHILKFNERILINKKMISDEDVVK
FT                   YYEVVMDILEKNSFQINFFEIATFMALLYFEEKNPDFIFLETGLGGRYDATNVVNSTIA
FT                   VITNISFDHVSLLGNSLDKIADRKAGIIKNRQLCIYAQNLPELENAVKKETDNSVNILK
FT                   KYENLQVELDTQNYKTIVKILESENLDESENIEDKKNKHNLEKTFILPLFGKFQANNFL
FT                   IAYEIAKIYGISDEIIQKGLDEISLAGRFEIFSPKPITILDVAHNHDSVRVLVENLNEL
FT                   FKNDEVIFILSILGTKDIANIFEKILEKNYKIFITSLKEVTYGLSANEIKKNLENSNIL
FT                   TNNIIFEDNILDAYNQAKQMVLQKNSRYKAIVVCGSFYEIAKFKKLCGKRNEHFLQ"
FT   gene            complement(576560..576829)
FT                   /locus_tag="Lebu_0535"
FT   CDS_pept        complement(576560..576829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0535"
FT                   /product="ribosomal protein S16"
FT                   /note="TIGRFAM: ribosomal protein S16; PFAM: ribosomal
FT                   protein S16; KEGG: fnu:FN1392 SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38446"
FT                   /db_xref="GOA:C7N8G5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8G5"
FT                   /inference="protein motif:TFAM:TIGR00002"
FT                   /protein_id="ACV38446.1"
FT                   /translation="MLKLRLTRLGRKKVPFYRIVAMEALSRRDGKAVAYLGTFNPLAEE
FT                   EKQVVLKEEEILKYLSHGAQPTETVKSILTKAGVWAKFQETKKK"
FT   gene            complement(576946..577302)
FT                   /locus_tag="Lebu_0536"
FT   CDS_pept        complement(576946..577302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38447"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8G6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38447.1"
FT                   /translation="MIKLTKKLITIFGSILLLSCTSYSNSGNEVKKYPVINDTRKKIAS
FT                   QRFNCNGKEFIVLYITADKIQLIDKLSNSSFQLDQVVSASGLRYSDGKNEIHIKGNNAI
FT                   LNQDGNDISCHIVK"
FT   sig_peptide     complement(577222..577302)
FT                   /locus_tag="Lebu_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.666 at
FT                   residue 27"
FT   gene            complement(577355..578002)
FT                   /locus_tag="Lebu_0537"
FT   CDS_pept        complement(577355..578002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0537"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: cko:CKO_00603 putative
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38448"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8G7"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACV38448.1"
FT                   /translation="MRKNKFITAVCVVSAFVGSNLQAKTTKSKKVSSNHTPNKNSSTKT
FT                   SNSGKNTGIYSIPSKNTSPLLETKMSELRQKHTKVMTSGSAQEKRRVKIEKKLLTSYSK
FT                   WKGTKYRLGGDSKDGIDCSALTRRVYRETFNQELPRVSTQQIKKGRRVAAKDLKSGDIV
FT                   YFKPENRINHTAVYVGNSLFINASSSKGVVISSLKSPYWRKYFKYGVRAHNA"
FT   sig_peptide     complement(577931..578002)
FT                   /locus_tag="Lebu_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(578337..579533)
FT                   /locus_tag="Lebu_0538"
FT   CDS_pept        complement(578337..579533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0538"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: mem:Memar_1051 protein of unknown function
FT                   DUF306, MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38449"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8G8"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACV38449.1"
FT                   /translation="MKKRFFLVGIFTMLLLCCGFLNAAVKRVAVSTNLNGTSWKLTEIR
FT                   KNGRNSRIPEKANVTINFLKYNINGFGGTNGYSGSYKLNRNSTLSATVTSTLIGGSQEL
FT                   MNLEQDFFDILQSNPIIKYNNDTLTLTNRAGDIWTFKNPNTINQNDKDSLPLSNLNGTS
FT                   WKLTQINKNGWKSYISENTNVTINFSKNKINGSGGINGYSGNYKINRNSTLSTRVTSTL
FT                   MGGSLDLMNLEQDFFDILQSNPVIKYSKDTLTLTNKDGDIWTFKNPNTVNQKDKDSLSL
FT                   LNLKKRLLNTSWKLIDISDRKMRKILTTNETRITLNFSEDRIHGDSGVNNYFSNYIMAS
FT                   DIIMIGPIGSTKMAGPDKFMKLESQYLNILQNSKKIKLDNNRLTFTTDDGKTLTFKEM"
FT   sig_peptide     complement(579462..579533)
FT                   /locus_tag="Lebu_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(580088..581269)
FT                   /locus_tag="Lebu_0539"
FT   CDS_pept        complement(580088..581269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0539"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   cdf:CD2693 putative sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38450"
FT                   /db_xref="GOA:C7N8G9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8G9"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACV38450.1"
FT                   /translation="MKKIGLVPRLIIAITLGILLGLILPSPVIRIFVTFSSLFSKYLSF
FT                   VIPFMIIGFVVTGISDLRQGAGKLLGITTLIAYLSTIIAGSLAYLMATNIFPKILNFAS
FT                   FAAVENPEKNLLTPYFEIPLAPMFDVTSAIVFAFIMGLSISWLRNRGEGQTTYNLFREF
FT                   SKIITKLLSTSVIPLLPIYIFGTFMNMTYSGQMFATLSIFLKVFVCVVILHVLYVSALF
FT                   TFAGGLSGKNPFTCLKNQIPGYFTALGTQSSAATIPINLECAKRNGISPEIREFVVPLC
FT                   ATIHLAGSIITITSCVVTVLMMNNMSYGISTIFPFILVLGVAMVAAPGAPGGAIMSALP
FT                   FLGMVGIASNSPLASLLIALYITQDSFGTAANVSGDNAIAIIVDWIYHKFIKK"
FT   gene            complement(581526..581984)
FT                   /locus_tag="Lebu_0540"
FT   CDS_pept        complement(581526..581984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0540"
FT                   /product="septicolysin"
FT                   /note="KEGG: cco:CCC13826_0326 septicolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38451"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H0"
FT                   /inference="similar to AA sequence:KEGG:CCC13826_0326"
FT                   /protein_id="ACV38451.1"
FT                   /translation="MKIAEALILRADIQKRIAQLKTRLNNNAKVQEHEEPTENPELLLI
FT                   ELDSLISQLNDLIIKINKTNTLSKIDGISLVELIAKKDTLSQKAGILREFIEIASQKIN
FT                   LYSTTEIKVFSTVNVPAQQKQLDKLSKEIRETDTKLQQANWTIDLIEE"
FT   gene            582227..583192
FT                   /locus_tag="Lebu_0541"
FT   CDS_pept        582227..583192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0541"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG:
FT                   spw:SPCG_1133 acetoin dehydrogenase, E1 component, alpha
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38452"
FT                   /db_xref="GOA:C7N8H1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H1"
FT                   /inference="protein motif:PRIAM:1.2.4.1"
FT                   /protein_id="ACV38452.1"
FT                   /translation="MELSKGKLLNIYERMLSIRNFDLKVNQLVKRGMVPGMTHLSVGEE
FT                   AANVGAIAALNADDLITSNHRGHGQVIAKGIDLNGMMAEIMGKATGTCKGKGGSMHIAD
FT                   LESGNLGANGIVGGGHGMAVGAAYTQKVKNTGKIVVCFFGDGATNEGSFHEAMNLASVW
FT                   NVPVIFYSINNGYGISTSINKVTNVEHLYKRAVAYGMPGYFIEDGNDVLSVYETFEKAV
FT                   EHVREGKGPVFIESITYRWFGHSSSDPGKYRTKEEVDGWKLKDPNLKFRNYLLENNIAT
FT                   EEELVELEQKSKKQIEDAVEFAKNSPEPTLESAFEDIFAN"
FT   gene            583208..584200
FT                   /locus_tag="Lebu_0542"
FT   CDS_pept        583208..584200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0542"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: sgo:SGO_1132 acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38453"
FT                   /db_xref="GOA:C7N8H2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H2"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACV38453.1"
FT                   /translation="METKLMSVKEAIITAMSEEMRKDENVFLMGEDVGIFGGDFGTSVG
FT                   MLEEFGPERIKDMPISESAISGAAIGAAMTGLRPIVDVTFMDFIVYMMDNIINQAAKTR
FT                   YMFGGKGQVPVTFRCAAGSGVGSAAQHSQSLESWFTHIPGVKVVAPGTPADVKGLLKSA
FT                   IRDNNPVIFLEYKAQYNMKGEVPTDPEFIIPLGKGEIKKEGKDITIVTYGRMLERVMKA
FT                   VEIAESEGISVEVVDPRTLIPLDKEIILNSVKKTGRVILVNDAHKTSGFIGEISAIISE
FT                   SDTFDYLDHPIVRLAGEDVPIPYNHALETAMVPSVEKIVEAIRKVKNKQ"
FT   gene            584251..585285
FT                   /locus_tag="Lebu_0543"
FT   CDS_pept        584251..585285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0543"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   spx:SPG_1063 pyruvate dehydrogenase complex E2 component,
FT                   dihydrolipoamide acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38454"
FT                   /db_xref="GOA:C7N8H3"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H3"
FT                   /inference="protein motif:PRIAM:2.3.1.61"
FT                   /protein_id="ACV38454.1"
FT                   /translation="MENNELRATPAARKLAQQMGLDLFHVKGSGANGRIHKEDVETFKF
FT                   EKQIRISPLARKIALDHNIELENVVGTGHNGKIMRDDILKLIAKPQETEDLARHEKAVV
FT                   AEEKAVAQQDIEIVPMTAMRKVISKRMTESYLTAPTFALNYEIDMTEAIALRKKILDTI
FT                   LESTGKKITITDIISFAVIKTLLKHKFVNSSLSEDGTQIILHNYVNLAIAVGFDGGLLV
FT                   PVVKGADKMTLSELVVESKKIVKKALDMKLTPDEQTGSTFTISNLGMFGVQSFNPIINQ
FT                   PNSAILGVSSTVEKPVVVNGEITVRPMMTLTLTIDHRVVDGLAGAKFMQDLKNALENPI
FT                   ALLI"
FT   gene            586010..587111
FT                   /pseudo
FT                   /locus_tag="Lebu_0544"
FT   gene            587222..588913
FT                   /locus_tag="Lebu_0545"
FT   CDS_pept        587222..588913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0545"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide- disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   HI0933 family protein; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: sgo:SGO_1130
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38455"
FT                   /db_xref="GOA:C7N8H4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H4"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ACV38455.1"
FT                   /translation="MTEGQIIKWNKKEGEKVEEGEILLEIMTDKTSMELEAEESGYLIK
FT                   IVKGDGETVPVTEIIGYIGAEGEVAPEAGSASPALENTASQSVPEKVAAASEPKKEKAE
FT                   DEFDIVVIGGGPAGYVAAIRAAQLGAKVAVVEKSEFGGTCLNKGCIPTKTFLKNAEIIE
FT                   GIEMAGKRGIILESEKYTIDMPKVVQLKNDIVKTLTNGVRGLLKSNEIKMYNGIGKINK
FT                   DKDVVVNGETVLRADKIILAGGSKVGKINIPGIESKKVLTSDDILDLQQIPKSLTVIGG
FT                   GVVGIELGQVFLSFGSEVTVVEMMDRIVPGVDRESSVVLRKELEKKGMKILTSTQIKEI
FT                   FDDGHNLTIKVDGHDDIVSEKALLSIGRVPDLEAVGELELEMEKGKIKVDKYMETSISG
FT                   IYAPGDINGIKMLAHAAFRMGEVAAENAVQGNHREIRLETTPSAIYTVPEVAMVGLTEE
FT                   EAKEKYDIKVGKFQFAANGRALASGETAGFVKVITDKKYGEILGVHIVGPSAAEIINEA
FT                   SGLMAMEITVDEVIKTIYAHPTYSEALFEACADALDEAIHLPKKRK"
FT   gene            588951..589946
FT                   /locus_tag="Lebu_0546"
FT   CDS_pept        588951..589946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0546"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="TIGRFAM: lipoyltransferase and lipoate-protein
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   ssa:SSA_1173 lipoate protein ligase A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38456"
FT                   /db_xref="GOA:C7N8H5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H5"
FT                   /inference="protein motif:TFAM:TIGR00545"
FT                   /protein_id="ACV38456.1"
FT                   /translation="MKYYVNKSNDPAFNIALEEYCFKQLRDIDEIFLLWINEPTIVVGK
FT                   YQNTIEEINTEYTREKGIHVVRRISGGGAVYHDLNNLNYTIISNKQEDKEGFNFKEFSK
FT                   PIIETLAELGVKAEFTGRNDLEIDGQKFCGNAQAYIKGRVMHHGCLLFDVNFGELGNAL
FT                   KVSKDKIESKGVKSVRSRVTNILPHLKQPITVNEFGEKIMEYMKKHYPEMEEYKFTPEE
FT                   LKIIEENAEKKHRNWEWIYGTSPEFNITREKRFTNGKIQIFATVENSRIKNIKFYGDFF
FT                   GKNEDLSEIENLLKDTKYTREAVKEKLETVDIEEYFSRFTVDEVVEVIVG"
FT   gene            complement(590005..590997)
FT                   /locus_tag="Lebu_0547"
FT   CDS_pept        complement(590005..590997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0547"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: pph:Ppha_0673
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38457"
FT                   /db_xref="GOA:C7N8H6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H6"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACV38457.1"
FT                   /translation="MIIKKYNQFEIFRFIGALSVLYYHATVHSSFSLGKIPFLLEHGIA
FT                   WVFFFFLLSGFLLTYVYSNKNLDTQIFYKTRFFKFYPVYLLSLILTLKFKGTIIYNMLL
FT                   VQSWIFNRSLSYNSSAWYLSVLAFLLLLFPALLQFKKNKYFVYFVLIINLYVYYFFNYL
FT                   FKLNSNSGTVLEFIKYNPLMYISTFTLGMLLYDKIKNIKKRNIYSFFTIIYIIFLLFAP
FT                   YNKFLPYNSTVISLSFIPLIVFLYLDNGFFSKFLGNKIFIYLGSISYSIYILHRPLYIL
FT                   FEKFIGEIRTHADFAIYFLIVFFVSNLTKYFIENKFYQYLCKKYLNKAV"
FT   gene            591292..592899
FT                   /locus_tag="Lebu_0548"
FT   CDS_pept        591292..592899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0548"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   amt:Amet_1445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38458"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H7"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ACV38458.1"
FT                   /translation="MAGDMKKYLNLDFEKIEKMTQIKKDYIEGKTDFETTKKLVRENFD
FT                   KMTASEFAYSEQKIKELGFDDNTVHNKMNDVLGLFEDIIVKDEFTLPEGHPINTYILEN
FT                   KAARKLIAEMKEEYGKKFIKNKWLEFYDKLSQFNPTHLARKQHQLFSILESKGFDRPSR
FT                   IMWSFDNGVRDSISEARKLLENDKIEEFLEKQENVWELTLDIMHKEEEVLFPTSMKMIS
FT                   EDEFKAMRAGDDEIGYFLIEKPKGFYPENSEQLNDTLASNSEHNISEAQNIVQNTQSAG
FT                   NFMNDLATLMAKYNMGNQKEENEVFDVKQGKLTLEQINLIFQHMPVDLSFVDENEIVKF
FT                   YTDTKHRVFPRSAGVIGRDVKNCHPRESVSSVLEIIDNFRSGKQDEIDFWLEMRGKFIY
FT                   IYYVAVRDENGVFKGVLEMMQDVTRIRSLTGERKLVTWESEGKQEKQENYEENKNEFKS
FT                   KYNFTGKTVIGDIVKKYPYIKEYMPLISPEYKRLLDPIQYMMMSKIATLQMIAMRGELE
FT                   LDYLIMMIEAKIDEEENK"
FT   gene            complement(592988..595453)
FT                   /locus_tag="Lebu_0549"
FT   CDS_pept        complement(592988..595453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0549"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: tde:TDE2411 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38459"
FT                   /db_xref="GOA:C7N8H8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H8"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACV38459.1"
FT                   /translation="MKIDKAELKDNILRELRRQYGKTLEEAHEFELYNAISKVALDYAM
FT                   EKWYNTKKTYAKKQVKQMYYFSAEFLMGRFLGNNLINLQINDVIKETLNELGVDINKIE
FT                   DREMDAGLGNGGLGRLAACFLDSLATLSLPGHGYGLRYKYGMFEQKIENGFQMEYPDDW
FT                   TKYGDPWSIKRMDRVFEVKFGGQIEVHRDEFGKEYFKRVNTETVHAVAYDVPVIGYGND
FT                   TVNTLRLWEARSPEGFDLKLFNDQTYLQASAKAVQAEDISRVLYPNDTEKDGKQLRLKQ
FT                   QFFFTSASLQDIIRRYKSVFGNDFSKFADKVAIQLNDTHPVVAIPELMRIFLDKEKLGW
FT                   DEAWNICKNVFAYTNHTILSEALEKWDISLFQPLLPRAYQIIEEINRRFVAELQEKYPG
FT                   DWERINKMSIIGNGQVRMAWLAIVGSHKVNGVAALHTEILKNIELKEWNELYPEKFLNK
FT                   TNGITQRRWLLKANPELAALITELIGDKWITNLYELKKLEQYLDDDNILNRVSEIKLHN
FT                   KEKLAKYIKDTTGIEVNPNSIFDIQVKRLHEYKRQLLNVLHIMDLYNRLKENPYLDVEP
FT                   RTFIFGAKSAAGYRRAKGIIKLINAVAEKVNNDSDINGKIKVVFLENYRVSLAEKIFPS
FT                   ADVSEQISTASKEASGTGNMKFMLNGALTLGTMDGANVEIVEEVGLENAFIFGLSAQEV
FT                   ENYQAHGGYNPFDEYNSVEGLKKVVDQLGDGTYDDNHTGIFRELQNSLLYGVDGSRPDV
FT                   YFLLKDFASYREAQDRLQNAFKDRREWTRKALKNIANAGKFSSDRTIAEYAKEIWNIEP
FT                   VQVQDYIES"
FT   gene            complement(595760..597919)
FT                   /locus_tag="Lebu_0550"
FT   CDS_pept        complement(595760..597919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0550"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   sgo:SGO_1856 ATP-dependent proteinase ATP- binding chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38460"
FT                   /db_xref="GOA:C7N8H9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8H9"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACV38460.1"
FT                   /translation="MSRDFNSMDDLFNSLMGGMRGFNSENRRYLINGREVTPEEFAQYR
FT                   ATGQLPINNEMQTQASQGQNVKQDGILAKLGRNLTQEARDGKLDPVIGRNKEIQETSEI
FT                   LSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAGTQYR
FT                   GSFEENIQNLLKEVKELGNVILFFDEIHQILGAGNTGDGGSKGLADILKPALSRGELTV
FT                   IGATTQDEYRNTILKNAALARRFNEVKVNAPSAEDTYKILQGIRNLYEKHHNVILPDNV
FT                   LKAAVDFSIQYIPQRSLPDKAIDLIDVTAAHLAAQHPVTDVHAVEHQIEEQKVKQAEAV
FT                   KSEDYEAALNAKNRIEELENKIKNHTEDMKVTATINDVAESVERMTGIPVSQMGASDIE
FT                   RLKGMNKRLKAKVIGQDKAVEAVARAIRRNRAGFDEGNRPIGSFLFVGPTGVGKTELAK
FT                   QLALDMFGTKDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNNNTLTERVRRNPYSII
FT                   LLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEKGLVENAD
FT                   KQEIIERLKPYFRPEFLNRFNAVIEFSHLNKKDLSQIVDLMLIEVNKTLSKKEIDLAVS
FT                   DAAKEFLTEEGYDEVMGVRPLRRVIEQQIRDNVTDFHLENLDAKHLVADLEDGILVIKE
FT                   KSETDKKTEEKKVSKNKKSSKKDTE"
FT   gene            complement(598060..599841)
FT                   /locus_tag="Lebu_0551"
FT   CDS_pept        complement(598060..599841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0551"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: lsp:Bsph_1475 oligopeptide-binding protein OppA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38461"
FT                   /db_xref="GOA:C7N8I0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV38461.1"
FT                   /translation="MKKWKLIITLLVLIFVVSCNPGKKRSEMPGAKLNLSLFPEKTSNN
FT                   EPAVEGGTLQVAIVKDDPLVGVFNETFYSDGYDGEIISMFLSSSIFEVDENFEITDTGP
FT                   ATLTVDAKNKKATIKIKDGIKWSDGQPLTADDIIFPYEIIGNKDYTGVRYTEETQKIVG
FT                   MKEYHDGKAQNISGIKKIDDKTVEISFLQLGQSIYTVANGLSGNAIPKHYLKGIPIKDL
FT                   ISSDKIRIKPVTLGPYNLTKVSRGESLEFTANPYYYKGKPKIEKAIVQVVNSQSIVAAL
FT                   KAGKYDFVISMPDSLYNNYKDLKNIETLGQQDLYYSYLAFKLGHYDKTKGENVTDPNAK
FT                   MSDVRLRQALVYGINVEEIAQAFYFGLRQQATSAIPPVFKKYFPKDLQGYPYNPEKAKQ
FT                   LLDEAGYKDVNGDGIREDKNGKPFEIKMAFMAGGDVAEPLAQNYIQSWKKIGIKAVLTS
FT                   GRLLAFQNFYKKVQGDSKDIDVFFGAWGVGTSLDPTGSAGRKSQLNFSRFVSDENDRLI
FT                   GEILGEKSLTVPNYKAEAYKNWQKYYIGQAAEVPLMYRYKLYPVNKRLKNVYIGYDSSK
FT                   KDEGIHKWELTAITPMR"
FT   sig_peptide     complement(599785..599841)
FT                   /locus_tag="Lebu_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.359 at
FT                   residue 19"
FT   gene            complement(599861..600793)
FT                   /locus_tag="Lebu_0552"
FT   CDS_pept        complement(599861..600793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0552"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fma:FMG_0274 oligopeptide
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38462"
FT                   /db_xref="GOA:C7N8I1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV38462.1"
FT                   /translation="MSNNEILKENNEKVENFDEIKKSDKPTGISVIVREILKDKLALAS
FT                   LIILIILFGIIFIGSLFANQKEIMKISLLDKYAIPMKEGFWLGSDSGGRSILGQLILGA
FT                   RNSIIIGFTITILTSGIGIFFGLIAGYYGKWVDNVIMRVIDFITILPTLMIIIVFVTIV
FT                   PKYTIATFVLIMSAFYWVGAARLIRSKALAESQKDYILASKTMGTKDFTIIFREILPNL
FT                   SSIIIVELTLGFAGNIGIETGLSFLGFGLPLSTPSLGTLVGYAADPEVLSTKLWIWLPA
FT                   SILILIMMLCINYVGQALNRAADAKQRRG"
FT   gene            complement(600805..601767)
FT                   /locus_tag="Lebu_0553"
FT   CDS_pept        complement(600805..601767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0553"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lsp:Bsph_1473 oligopeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38463"
FT                   /db_xref="GOA:C7N8I2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV38463.1"
FT                   /translation="MWKTVLRRILVMIPQLFILSLLIFVLAKLMPGDPFTGLITPQTDP
FT                   AALEELRRKAGLLDPWHIQYVRWLKNAVSGNLGMSYTYNVPVKTLIGERAVNTFILSLL
FT                   SLILTYCIAIPLGMLAGRYQNSFLDKFVTFYNYVSYAIPTFVLSLIMIWFFGYTLGWFP
FT                   TTGSVTAGLSTGTLGHILDRIYHIILPAVTYALLGTTWIVQYLRNEVIDAKNLDYVKTA
FT                   KSKGVPENKVYSRHIFRNSILPIAAFFGYSITGLLGGSIFIEKIFSYPGMGGLFVNSII
FT                   TRDYSVVTALILLFGFLTLLGSLLSDIILSIVDPRIRIE"
FT   gene            complement(601771..602733)
FT                   /locus_tag="Lebu_0554"
FT   CDS_pept        complement(601771..602733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0554"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: ssv:SSU98_1870 ABC-type
FT                   oligopeptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38464"
FT                   /db_xref="GOA:C7N8I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38464.1"
FT                   /translation="MSFIEVKDLKVHYPIRGGFFNKVIDYVYAVDGVNFTIEKGKTYGL
FT                   VGESGSGKSTIGKAIIGLEKIKSGKIIYEGKEIDGKFRNRRSEYNRNVQMIFQDSLSSL
FT                   NPKKRVIDLISEPLRNFENLTLDEEKRKVSELLEIVGMNREDIYKYPHEFSGGQRQRLG
FT                   IARAVATKPKLIIADEPVSALDLSVQAQVLNYMKDIQEQFGLSYLFISHDLGVVKHMCD
FT                   YMFIMYRGRFVETGTKNDIYKNPEHFYTKRLIAAIPEVHPEKRLKNKKRRIEIEKEYLK
FT                   NEKKYYDENGRVFDLKKLTDTHFVALKDEIVKNNGKGGK"
FT   gene            complement(603350..604342)
FT                   /locus_tag="Lebu_0555"
FT   CDS_pept        complement(603350..604342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0555"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: lsp:Bsph_1471 oligopeptide transport ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38465"
FT                   /db_xref="GOA:C7N8I4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I4"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV38465.1"
FT                   /translation="MEQTETLIRINNLVTSFRIKDEYFPAVDNVSLELRRNEILAIVGE
FT                   SGCGKSTLATSIIGLHNPINTKLTGEINFEGKNLVEIDEEEYNKIRGNKIGMIFQDPLS
FT                   ALNPLMRIGEQIEEGMIYHTKLSKTEREARMLELLENVGIKNPKRVARQFPHELSGGMR
FT                   QRVMIAIALSCKPEIIIADEPTTALDVTIQAQILDLLKTLQSEINAGIILITHDLGVVA
FT                   EMADRVAVMYAGEIVEIANVNDLFNNPKHPYTRSLLNSIPQLDTESEKLHVIQGIVPSL
FT                   TKLTRTGCRFSQRIPWIKESEHEKNPTLHEVGENHFVRCTCWKNFHFEK"
FT   gene            complement(604662..605114)
FT                   /locus_tag="Lebu_0556"
FT   CDS_pept        complement(604662..605114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38466"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38466.1"
FT                   /translation="MKKLIIIALFFTSILGFTQTFSRAGIGSVDLPSGFESRDGTNNYQ
FT                   NFENKNLNINVKISVYPSTVNFDNIYSSDKGTWKVDDSNTTKATYDSKSREYVFTNYSS
FT                   GISIITMCFIGYKKNKYCVQISQPAKDVSKNSSLTERILKSYTYYK"
FT   sig_peptide     complement(605040..605114)
FT                   /locus_tag="Lebu_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.800 at
FT                   residue 25"
FT   gene            605287..605371
FT                   /locus_tag="Lebu_R0023"
FT                   /note="tRNA-Leu1"
FT   tRNA            605287..605371
FT                   /locus_tag="Lebu_R0023"
FT                   /product="tRNA-Leu"
FT   gene            605457..605541
FT                   /locus_tag="Lebu_R0024"
FT                   /note="tRNA-Leu2"
FT   tRNA            605457..605541
FT                   /locus_tag="Lebu_R0024"
FT                   /product="tRNA-Leu"
FT   gene            complement(605724..606338)
FT                   /locus_tag="Lebu_0557"
FT   CDS_pept        complement(605724..606338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38467"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38467.1"
FT                   /translation="MKKLLLLGALVSSIAMADVIEVRVGGDLTNRATFKDTDNQNWKIN
FT                   DDALKNGFEITGEYRTPIAENLEIGGGIAYRYNKLSSKNYPGLTMKGINSVPIFFTTRY
FT                   NFKNASEITPYVKGNLGLAITSGKVESKNILADESLKFESGIYYGIGTGLQYKNFVADL
FT                   SYNVNTMKTKYSFNMPGYKEEGKFNTNHGTLTLGVGYSFGF"
FT   sig_peptide     complement(606285..606338)
FT                   /locus_tag="Lebu_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 18"
FT   gene            complement(606519..607634)
FT                   /locus_tag="Lebu_0558"
FT   CDS_pept        complement(606519..607634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0558"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: ctc:CTC02290 nicotinate-nucleotide--
FT                   dimethylbenzimidazole phosphoribosyltransferase;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazolep
FT                   hosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38468"
FT                   /db_xref="GOA:C7N8I7"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I7"
FT                   /inference="protein motif:TFAM:TIGR03160"
FT                   /protein_id="ACV38468.1"
FT                   /translation="MKEKSEKILFDTIKKIKPLDKIRMKKKENELNSLLKTPKGLGKLE
FT                   ELAIKLEGMSENYKPKKKMVLVMAADNGVEHEKISKSKRVITQYVVEAMLNGKSSINAL
FT                   AAVYNADVKVVDLGIDKRSDTKKEINLTGTIEKKLMEFGTENIAKEAAMSYETTVKAIN
FT                   TGIELVNKFVKEGYNLFATGEMGIGNTTTSSAILKVLTNLPLDDIVGYGSGIDDKTLEH
FT                   KKNVVKKAIDINELTNFFSKNEKNKMNEEIYKQKIIDVLAKVGGLDIAGMTGTFLGCAE
FT                   NRIPVVIDGFISAVAALVAYKICPICKDFMIASHLSEEPGMKYIMRELDLKPMLFMNMK
FT                   LGEGTGAVMMFPVIEGACNITKVVRKYPDVN"
FT   gene            complement(607636..608949)
FT                   /locus_tag="Lebu_0559"
FT   CDS_pept        complement(607636..608949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0559"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: fnu:FN0540
FT                   glutamate-1-semialdehyde 2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38469"
FT                   /db_xref="GOA:C7N8I8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I8"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACV38469.1"
FT                   /translation="MNTNNSKIIYEKAKKAIPGGVNSPVRAFQSVDKEYPIFIKSGNGS
FT                   KLYDEDGNEYVDMIGSWGPMILGHNYPQVLEIVKKELENGTSFGLPTKKEVELAELVKS
FT                   CFPSIEKLRLTTSGTEAAMASVRLARAFTGKNKIVKFEGCYHGHSDSLLVKAGSGLLTF
FT                   VHQDSNGITEGVVKDTITLPFGDFEKLKETLESEKDIACVIIEPIPANMGLIETKKEYL
FT                   EKIREITKKEKVVLIFDEVISGFRISLGGAQEVFGITPDLTVLGKIIGGGYPVGGFGGK
FT                   KEIMDLISPVGNVYHAGTLSGNPISVAAGIETISILKKNTEIYENINTKTENLINQINE
FT                   LIKKYSIPASVNHFGSLFTIFFSKEKVDTLEKAISSNDEFYSIYFDTMLENGIIVPPSK
FT                   YEAHFISYVHNNEDMEKFLTGTEKTFEKISEKIKNEEK"
FT   gene            complement(609166..609240)
FT                   /locus_tag="Lebu_R0025"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(609166..609240)
FT                   /locus_tag="Lebu_R0025"
FT                   /product="tRNA-Cys"
FT   gene            609367..609624
FT                   /locus_tag="Lebu_0560"
FT   CDS_pept        609367..609624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cco:CCC13826_2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38470"
FT                   /db_xref="GOA:C7N8I9"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8I9"
FT                   /inference="similar to AA sequence:KEGG:CCC13826_2193"
FT                   /protein_id="ACV38470.1"
FT                   /translation="MSEKNLKILGWIGTLLSVIMYVSYVPQIMGNLHGNKTFFLQPLAA
FT                   TINCTIWTSYGLLKEKKDYPLSAANLPGVIFGLLATITAF"
FT   gene            609812..612457
FT                   /locus_tag="Lebu_0561"
FT   CDS_pept        609812..612457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0561"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: fnu:FN2011
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38471"
FT                   /db_xref="GOA:C7N8J0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J0"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ACV38471.1"
FT                   /translation="MPNELNKVYSPNEIEDKWYKIWEEKGYFNAQHNAEKPGYSIAIPP
FT                   PNVTGILHMGHMLNNSIQDTIIRYKRMSGFDTLWIPGMDHAGIATQNKVERMLADEGTS
FT                   KEEIGYDEFLRRTWEWKEKHGGLITKQLRKLGVSLDWTRERFTMDEGLSEAVKEVFIKL
FT                   YNDGLIYRGEYIVNWCPHDKTALADDEVNHEDKNGKIWEIRYPIKDSDEEFVIATTRPE
FT                   TMLGDTGVAVNPNDERYKHLIGKTVILPLMNREIPIVADEYVDMEFGTGVVKMTPSHDP
FT                   NDFEVAKRTGLAFLNIFTEDAHVNENGGKYQGLKRFDARKAILADLKEQGLLVGVKDHK
FT                   NAVGHCYRCNSVIEPRVSTQWFVKMEPLAKRALEVVKNGKIQITPKRWEKVYYNWLENI
FT                   RDWTISRQIWWGHRIPAYYSEDGTVFVAKSLEEAKIQAREKFGKDVNLTEETDVLDTWF
FT                   SSALWPFSTLGWPNETEDLKKFFPTNALVTGADILFFWVARMVMMSLYIKDEIPFNYVY
FT                   LHGIIRDEKGRKMSKSLGNSPDPLDLIAKYGADAIRFSFLYNTSQGQDIHFSEKLLEMG
FT                   SAFANKVWNASRFVLSNLEDFDVSTTVDKSELKLEDKWILSKLQTASKLINENMEKYEL
FT                   DAAAKLTYEFFRGDFCDWYVEIAKTRVYGQEGSDKVVAQWVLRHVLDKGLKMLHPFMPF
FT                   ITEEIWQKLQTGEETIMLSDFPKEEKEFINIEAEKEFDYLKEVISAIRNIRGETNVSPS
FT                   KKIEVIFKTADENARNILQNNAKILDKLANIEKYEFNLEIPKLVGFRLVETTEIYVPLA
FT                   DLIDLDKEIEKLEKSIAKIQKDLDKTLKKLSNESFVKKANPEAVKKERRIKEELENKIA
FT                   KLTESMSLYR"
FT   gene            612595..612708
FT                   /locus_tag="Lebu_0562"
FT   CDS_pept        612595..612708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38472"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38472.1"
FT                   /translation="MKKLLILVLLAIALSSCVSANVGVGPGGVHGGVGVYF"
FT   sig_peptide     612595..612657
FT                   /locus_tag="Lebu_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.776 at
FT                   residue 21"
FT   gene            612727..612837
FT                   /locus_tag="Lebu_0563"
FT   CDS_pept        612727..612837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38473"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38473.1"
FT                   /translation="MKKMFILFMILFAITACSSANAGSKGKGEVRIGVGF"
FT   sig_peptide     612727..612795
FT                   /locus_tag="Lebu_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            612852..613280
FT                   /locus_tag="Lebu_0564"
FT   CDS_pept        612852..613280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0564"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   fnu:FN1548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38474"
FT                   /db_xref="GOA:C7N8J3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J3"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACV38474.1"
FT                   /translation="MGALFWAILSGTFAVLEIIIPGLVTIWFALSALIVMFFSNFSNDS
FT                   TIEFFVFAVLSLIFLIFTRPVLRRYIDMQKKNGFNSSMKGADVKVEKIVDARRIEKEYE
FT                   VKFKGSIWTGISEEIFSAGEIVKIKEFRGNKIILERKY"
FT   gene            613311..614210
FT                   /locus_tag="Lebu_0565"
FT   CDS_pept        613311..614210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0565"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   fnu:FN1549 stomatin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38475"
FT                   /db_xref="GOA:C7N8J4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J4"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACV38475.1"
FT                   /translation="MLFLPLVVVLIVTTLIYVLKAVKIVPESRVLIIERLGKYDRSLSS
FT                   GLSFLNPFFDRVARSVSLKEQVVDFPPQPVITKDNATMQIDTVVYFQITDPKLYTYGVE
FT                   RPLSAIENLTATTLRNIIGDMTVDQTLTSRDIINTKMRQELDDATDPWGIKVNRVELKS
FT                   ILPPADIRVAMEKEMKAEREKRANILEAQAKREAAILVAEGEKQAAILRAEAKKEEQIK
FT                   EAEGRAEAILSVQKAQAEALRLLNEAAPTKAVLSLKGMETFEKVADGQATKIIIPSELQ
FT                   NLAGMVSAFSELSKTDKQ"
FT   gene            614380..615297
FT                   /locus_tag="Lebu_0566"
FT   CDS_pept        614380..615297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0566"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="KEGG: cpf:CPF_0565 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38476"
FT                   /db_xref="GOA:C7N8J5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J5"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACV38476.1"
FT                   /translation="MIYTLTLNPALDYDMYLKDDLQAEHLNLAHEVNYRAGGKGINVSK
FT                   VLKNLDVESTAIGFVAGFVGDFIIRDLKKDNIKSEFVELEGNTRINVKINGNDKETELT
FT                   GVSPEITAEKLQELINKISDLKDGDILVLSGSVPASISSKIYKELSENVKANVEIVLDT
FT                   RGNLLQDNIHNNLFVKPNIHELREMFNEKLETKAEIVEKCKFFLDKGVKNVILSRGGEG
FT                   ALLVNKDFVLEASVPKGQLINSIGAGDSMVAGFIAGFVKGLSPEDSFRLAVASGSATAY
FT                   SYGLAEKDLVNKLYDEIEISKETF"
FT   gene            615433..617388
FT                   /locus_tag="Lebu_0567"
FT   CDS_pept        615433..617388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0567"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose- specific IIB
FT                   subunit; phosphotransferase system EIIC;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; KEGG: smu:SMU.872 putative PTS system,
FT                   fructose- specific enzyme IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38477"
FT                   /db_xref="GOA:C7N8J6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J6"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACV38477.1"
FT                   /translation="MKISDLLIKDRINLDVKSTNKVDIIKELARLHEKTGVLNDYDGYV
FT                   KALMAREEQSSTGIGEGIAIPHAKTEFVKKPALAMGRKPEGIDYDSLDGEPATLFFMIA
FT                   APDGANNTHIETLARLSQLLLDDDFKEALENAKTADEVLEIINKAEAEKFAEEEKKEAV
FT                   PVQTLSDENAPYIIAATACPTGIAHTYMAAEALKKAADEMGINIKVETNGADGRKNVLT
FT                   DEDIKKATGVILAINRNIEVDRFDGKPLIQVEAKEGINNAKALIQQVLDGKAPIFHASG
FT                   SSTASSESASSEKKGLYKHLLSGVSYMLPLVISGGILIALAFLVDTLTGHANAGKDFGS
FT                   THELAKLLMTVGKAAFGLFLPILGGYIAYSISERAALSAGLVAGFLATTPIIKDGPVSG
FT                   FIGALIGGFLAGYVVKFLVWAFAGLPRALNGLKMILFYPVFSVLITGTIMWLVVNPLAT
FT                   ALNVWMNNGLASMQGASAVLLGALLAGMMAVDMGGPINKVAYVFGTGTLTAATMTSGGT
FT                   FPMAAVMAGGMVPPIAIALASQIFKNKFTEQEKEAGLTNYIMGLSFITEGAIPYAAADP
FT                   ARVIPASVIGSAITGALVGLFQIKIPAPHGGILVMGLSKNAAGHSGFLMYLIAILIGSI
FT                   IAAIVLGFLKPSIKKD"
FT   gene            complement(617474..618754)
FT                   /locus_tag="Lebu_0568"
FT   CDS_pept        complement(617474..618754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0568"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   bga:BG0212 surface-located membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38478"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J7"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACV38478.1"
FT                   /translation="MKNYLKGINQRIGNIFVNIRTLEELERKTGYTVDEEGNILEYNKN
FT                   LKKVENFIKNGEFTKAKKILKKMRKLHRMGYYELGKYYYFCEGNLSKAESNLYIAFENG
FT                   IIKAGYYLGLLEEKSGNMNLARNWYVTSFNFSEQSIMKLFYIAIMEQNFWAIDGYFYYI
FT                   LQYGENAKNLYEFAKYYFWGKNFEKIKEIQDKLTNGSHILYLTKEILHNINCMLGDEKD
FT                   KEYIKCAENAKTLELQKDFNAEFLYKKSAEYNEYGNVGLAKFYGKFAKSDKYEKLEKIF
FT                   KNNFLKQIRSEAAYQLGKYNEYENNLYDAINWYEISAKNGNYKSFYKLSKLQNKKFTET
FT                   ETTLQNDYFKYLKNSADLGYAQAMIEMVLDPNLNSLESFEMAEKILGQNNVFELTQAIS
FT                   NEAKIIYFGNEIKEVLEINYEEEKTIQ"
FT   gene            complement(618936..620033)
FT                   /locus_tag="Lebu_0569"
FT   CDS_pept        complement(618936..620033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0569"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: afl:Aflv_2013 transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38479"
FT                   /db_xref="GOA:C7N8J8"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J8"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV38479.1"
FT                   /translation="MKYNLAFKYRIYPNKEQELLINKTFGCVRFVYNTILYTANKFYEE
FT                   TGKNKIITPASLKSENQFLKEVDSLALSNAQLNVKRSFTNFFQKRAKFPRFKSKKTSVK
FT                   SYTTNCVNNSIRIEENKYLVLPKLKRIKLKYHREIPKDYRIKLVTLTNSNGNYYVSVLT
FT                   EFEKEIQKNPSNNKVIGLDFSMSELFVSSENQRADYPRYFRMLEKKMKKLQKSLSRKVK
FT                   FSKNWYRQKSKISKLHEYIKNCRRDFLHKLSKKLFEAYNAVVVEDLNMKGMSQALNLGK
FT                   SVGDNGWGIFLRMLEYKLMFLGKQFLKIDKWFPSSKTCSKCGNVKEELKLSERSYKCEC
FT                   CGNEIDRDYNVALNIKNIGKEMMEY"
FT   gene            complement(620038..620436)
FT                   /locus_tag="Lebu_0570"
FT   CDS_pept        complement(620038..620436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0570"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ctc:CTC00621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38480"
FT                   /db_xref="GOA:C7N8J9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8J9"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV38480.1"
FT                   /translation="MSYNSNYHSVFDINYHMIFCIKYRRVVINDEISNRLKEIFEKICP
FT                   KYNIVLKEWEHDVDHIHMLINAMPNTELSKFVNTYKSASSRLIKKEFPEIRRRLWKEYF
FT                   WSRSYLVVSVGGAPLEIIKKYIQNQKEV"
FT   gene            complement(620585..622675)
FT                   /locus_tag="Lebu_0571"
FT   CDS_pept        complement(620585..622675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0571"
FT                   /product="outer membrane insertion C-terminal signal"
FT                   /note="TIGRFAM: outer membrane insertion C-terminal signal;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug; KEGG: cff:CFF8240_1760 TonB-dependent heme receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38481"
FT                   /db_xref="GOA:C7N8K0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K0"
FT                   /inference="protein motif:TFAM:TIGR03304"
FT                   /protein_id="ACV38481.1"
FT                   /translation="MLKKLMILSLIAASLMAFGEEKNDTFDIMLEETVVTGIKNDDIQK
FT                   SGQIKNTTVVTYQDIHDKGYNTVEEVLKHTPGINFVNNGFGYIADVRGQGEQGATKNVK
FT                   ILVDGTPLNILDTSHAILPLNSIAVEDIEKIEIVNGGGTVLYGGGTTGGVINIITKKTQ
FT                   DEFMKSKIYYQNSSFDTNKYGIGTSVKFADKFLLNLGYEGIDGKGYRYRDKKNGKNLRG
FT                   GFTYDITDNQTLSFKATRYDEDTKESDGIKKVQMDRDRRQDGDTLTDSNLKRTEFSLNY
FT                   EIKPTDNLAFSLLGYNQKTVRKYEQSIPAEKANLSGMRPGNSRPNPGGSSRPGGNMPNF
FT                   SAGQVNHITKGGFKDTKNGIDLKGKYNYGSGDIIFGYEYIKNKSSRNAYGGLYMWSQKL
FT                   FSTSNVDIDMEKDTHSVFIQNKHSFTDKLDGILGYRYEHADYDIYRTDGTNSVNNKSKK
FT                   NNNAYEAGLNFKYSDTGNVYAKYERGYRSPSPAEMVDKTPTTGYILNNLKSEKYDTYEI
FT                   GVKDILGPSFVSITGFYTKKDDEILRNMIGHGIHWTHRNLPKTERKGIELFAEQYLEPF
FT                   RINESVSYIDAKITKGTDKGKKIPYVSRIKATLGANYEVVKGLNITADLNYFSDSVDEK
FT                   YEKIKAYSTTDLGMNYTHKTGLGLQAGIKNVFNKKYYRYKNGDSYIPEAERTYYVGVSY
FT                   NF"
FT   sig_peptide     complement(622616..622675)
FT                   /locus_tag="Lebu_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            622860..623618
FT                   /locus_tag="Lebu_0572"
FT   CDS_pept        622860..623618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0572"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: cac:CAC0718
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38482"
FT                   /db_xref="GOA:C7N8K1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K1"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACV38482.1"
FT                   /translation="MNETIKQLQDRRSVREFTGENIKEKDLQAILYTAQRAANSVNGQQ
FT                   TSLIVIRDKQKLEKIAELCGGQKHIAEASVFVFVVMDFYRGVYAAESVGKRNIGPLSAD
FT                   GILVGAIDAGIVVNALQTAAIALGYGTTVIGAIRKNSKEIIKMLGLPKYVFPLIGSTIG
FT                   VPAERPLTRVKPRVPLDTFAFEDKYDAEKVKEGVEFHEKDINKWRKENGTPQLPSYKEM
FT                   IVRIYENFYNESKKELEEQGFKFADKLEEE"
FT   gene            623630..624247
FT                   /locus_tag="Lebu_0573"
FT   CDS_pept        623630..624247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apj:APJL_1216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38483"
FT                   /db_xref="GOA:C7N8K2"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K2"
FT                   /inference="similar to AA sequence:KEGG:APJL_1216"
FT                   /protein_id="ACV38483.1"
FT                   /translation="MNFLAHSLISLEIDEKENKKTLYANFAGDFYKGLVETIELPDELK
FT                   EGVVLHRIIDKISDRNENFLNELLTEKFGIFKGIVSDMYIDHFLSKNFDSLFNDNLNNI
FT                   ENKILYNIKINEKFFPDNFKRTFQWLKSGKVMSSYQNINFLERAFYGISQRVRKGEILK
FT                   SAIIELQKNYNLFEEKAIKEFFYVKSESIKVFNKNRRIKKKC"
FT   gene            624241..624816
FT                   /locus_tag="Lebu_0574"
FT   CDS_pept        624241..624816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38484"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38484.1"
FT                   /translation="MLKLKRMLISLLVLGNMVAVSGVANAAPAKKETEQVKTYDSLKTA
FT                   ASDYAKALQEISNYGSREMLKSINPDVDVYISKVNNPTLKKQWEDTNTMLLEQFEVSVY
FT                   KVDEKGDKGEVVFLIKGYDEAALNKYLGDNTSKYVTKVDKAKGEVEVDIDKYIKLQYEY
FT                   LKKTKKINLATSTINFKKDKNNKWQVVK"
FT   sig_peptide     624241..624321
FT                   /locus_tag="Lebu_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            625927..635796
FT                   /locus_tag="Lebu_0575"
FT   CDS_pept        625927..635796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0575"
FT                   /product="Autotransporter beta-domain protein"
FT                   /note="PFAM: Autotransporter beta- domain protein; KEGG:
FT                   fnu:FN1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38485"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K4"
FT                   /inference="protein motif:PFAM:PF03797"
FT                   /protein_id="ACV38485.1"
FT                   /translation="MSNNLRQIAKDLRSFVKRCKDVHYSDSLLITFLVTGLLTTFAPSI
FT                   IRADVAEDQQEVSAQAYDTITDLRQSFLRAKKENQKALRGANAELAQLLKEGDQVVKSP
FT                   WASFQFGTGYTNNDWGTSYKGRGGKKLEYYSRTNDLTKYVFDASKHQYGATNLNLPRNQ
FT                   EPNTLAITPANIHEPYKPYDVTKLDAIALPTAPTFEPNMPAPNGVTPYDFTYYGTTASR
FT                   SASTAVSEDVIANNAVRFNNLNSGYATYTSNTNETLSSSAVTANTNANTPSNGGTFDIG
FT                   TTNKRLYDSGWWWSSNHGTEFASVTSINDGNFNIYDRHTSSASWVAGTFNTDSNYSGVV
FT                   VNGGGPYSGYDDGAYGAAPTRTYTGNSQSDLEANARFHARVAYAAAHPEVHWNTITTLS
FT                   DAALGLTFGYTHPDPAPLDPTRQAYAAKLNGTEISWQSRDTGVVTYSPTAWTTGHQYNH
FT                   KADSSIKIADGNVSLYKNNFTIVDGNSRKRTGLHVATGGTARLTGLNVFSISGKNNNGT
FT                   LVDGGTLNTSGTNTYKITSGSENNGIEIASGTVKMRDTTNFDISGTKNNNGILLTTGDL
FT                   DTEGVNMTLTGTEHIGFNNQGGTSAKIKGGTLKIASGTTKSNLIYANADTETKEITFQV
FT                   GTTANGNNNGVYVNGSAKLTDKGSNYTVNGSENNGIYSKTSGDIKVTDPTFTIGGDKNN
FT                   GIYGTSTGNANITVERAALGASNDFTVTGTNNNGIITNGTGNLKVNRIRFDVSGIANNG
FT                   DPGAQNNAIYIKGAAPTEIVGSAFTISGRDNNAVLAKGAAALDIKGETSFDISGNENNG
FT                   VYIDGTASTTAYTDYNSSFTVTGTNSNAVYAKKGAVELKGTSMDIQGSNNNGLIVFKQS
FT                   DVTPVKIGNNGSRRASFTVSGDGNNNGIYATNGSTIDSIDGANFTVSGNGIGLLVGDST
FT                   GKAKVTTIKNATFNVDNTEAVSDGTGTGIYLYQSEDTVLGDNARIDGNGNDILITLRNR
FT                   DHNNKITLGGGPGTNRTLLNATGDNNVGINIQEGRTNQTTTAEILTDSQKGWNLHFEGK
FT                   NNTGIKNNYFANTLTIKNELPNNSSPSSLYDSGVMSIYGDDGIMFANLGYVQAGTLRLD
FT                   GISMQGKRSIGAAFLNNQYREIGTPPLNNELGNSGIFNGTGVALQGSIGANSGPHLDSS
FT                   NSVAIFANTGQRKEFRETAVGHGSGSSAAISDLTVTGLNVGLNQFANNSVLLWSERGTK
FT                   IKVTNTLGTAGTYTSSGGNGHVSDGVMIEGGKTVHGYNTNDDVVSTGSVIAYATGFLDA
FT                   GKHGYSNLPSISYLPSEVEFGTGVNVDMVAKKGTALLANHGAKITAKGVRAGGIESILA
FT                   YADGKHTTINNGIVDYTPSQIEIDGHVIAADNNLLGKNNVAGVLDAGKVKAVDLPNTYN
FT                   NIAAYATGGGTVTIKGAKVSDTVLEKASGTLDPAAAPATKESLVFGMAAYATGEGSVVK
FT                   YDNSATSVVTGVYGGVYATDKGQVEFAGDMINQNNYGTTITTKTTADGSVTAMGANAER
FT                   RNGRGTSSDVKDNKGNTTTNDHKNVTPFYVKRTREGDTTIDDSGIVFTSKKTNIDMYDG
FT                   ILLTGNQYNVNNYTAGNTYNTIRDYYKDATKPAGLEGDKWTMAKYRGMSNVTASILSDH
FT                   YAVELGVINQADGLKWDDDGNTNDPASPVRTNYLGSIGENFAGEMNIVNKDLSHNATNA
FT                   SNTKVGNRFNSTLLNSTLEIGSTEVDLEDADKTDVSTVGSSVNDPFNDIKMEGTLVTIK
FT                   SGTTVKGDVADGYRAGQGLNMANRLNRWESPTSVTSRWIKNGNDKSGYVNKGKIDVYGG
FT                   SKTAPITGMNVAFGTAQNIGSATDGEIKIDHGYGIYATDASLIKNTGKIEVTGKYAPTN
FT                   ISTLRSNRNFSAEPAPSGNNYGIAGISDTEIINYNVNDDWSQTINALDIEQSGANAETK
FT                   VEGDLAVGIYGENRNNALASNIKIKYDNSSRTNAGIDVSNPNVTLSTARGVGIALVNGS
FT                   STTYADGALNAGGEITLKGFGGNIGQFGAAHNDILTGKNGVGVYAESAEIKVDSAKFAV
FT                   ETKDNGIGLWAMDDTVIARGADHDKIFNYNYYGAKDKNGFAMAFGGRNTNATTAANYMD
FT                   ILFSNTADATNVNLKNEDATGRTGTNKGIVGLLVNTNDAADKVTNYGKIEEDTSSKTNL
FT                   KAYGALVNKGTFINHGDITLNASLMNDKNSTITTADMKKVNVGILANDHSERARDNSYI
FT                   ENYANITIGQDADSKHNVGSWAIYGYNIKTGAKLDGTEVVYKINRNSNGIYSGDGNVDI
FT                   QKGTVLKVGNDTVLGHVRPTQVVNGITMPSRQPDTTGTGYADPDDLLSGLDNPRERDSA
FT                   VGVYINNNRGLSDEARTINVAADMDIDRFSHGIVLAEKDGGAVTTVNMGTSAATAPRIK
FT                   LAYSTANNPGGQVHSTKPYEPEIFSEEVNEQGNAVYYYSADTNSKAKSYANVTMDGDYN
FT                   TAYFTKGSVTNYGNIDLRSQYDLELRNNDPDHIPVGYGSVGIISENTTDPSINEGKIIT
FT                   GLSDTQNMMYSVGMGAGRNFYRIDPSTRERVYDRTEGQGYVVNNGEIVVQEENGIGMLA
FT                   TGRGSRAINNGTIRLVGKNGVGMYIDREAIGENHGTITGDAENLKGVVAINGGYIKNYG
FT                   TIKVEGTGSYGIVTDSSKFTLDANGNPIAYHTDTSSAEYRNGTTAGQANGHGGTDLYGG
FT                   TETSIEEGTTGNPKTTGVGTTITRPNIVPLTSVTIDGVEQPIFNFNNDADVVGKQAENI
FT                   LVTSSIQTVATGATELQIPIWLRAKDEYGNPAWPRYNSPQMSEVTRIGMYVDTSGVRYT
FT                   NPIDGIEKLTNLGKVNLYFGPEITEYTNSKAIRIANNKKEVAPGQYVVEENNILKPFND
FT                   ALRRLPGGATINPLSSSLTWQVSANIDDNNQITELVMSKVPYHSFAFDGDKRLINFTNN
FT                   LDNIYEIARPGSEEKMIFNKLNSIGNGEGHILAQAFDQMRGHIYGGIQQRTNATSNLLT
FT                   DELAQLRSENNASKDSNKIKAFGRREEYKTDTAGLPDWHSNAGGFVYLHEDETVKLGDR
FT                   SGWYAGVVNNYFTFKDLARSYENQAMLKTGIFKQTPLDEDGTFTFTIGGDAFFGKTNTK
FT                   RRFWVVDKEFRAKSDYYTYGADINAKLEKEFRLTEGFSIVPNVGLDLQYGRFSTVNEDG
FT                   DMALKIKSDDYYSVKPRAGVDFRYSQPVFKKSNFVASVGLAYETELGRLNDVDNEAKIK
FT                   GAWTDYYSIKGDKEDRKGNFKSDLKLGLDNGRLGFTVNTGYDTKGHNFRAGLGLRALF"
FT   gene            636013..637431
FT                   /locus_tag="Lebu_0576"
FT   CDS_pept        636013..637431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_1624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38486"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38486.1"
FT                   /translation="MNKKIIFSFIFLLGVFSCTPLSKGLSMKSEVYNADNVEFYYDLTY
FT                   KKDGETQYERQIWDQAYDILDKAQDFFLMDIFVFNDYVGKGVKEKLQPLPIAEEFAQKI
FT                   LEKREKDPNVEIYLILDESNTFYGAFDNKTHKKLEQAGVKIGYVDLTKLRDPMLIYSTP
FT                   WRLFIQPFGNPKNRGKLKNPIYEGTDKITIRSLLRALNAKANHRKLIMNENTAMLTSAN
FT                   PHAEGSKHSNVAFKFSSPIIKEIYEAEKPVAQITKKDGSLKKKLPNKDFSKIPVSKNEK
FT                   IKLQYFTNDVTVKDISQELKNAQFGEKVIIAQFFLSDRGIINDIRKAARRGVKFEIILN
FT                   NSTAGFPNKAAAGELMKYARKHNYDINVKFYNKGEEMYHVKMLSILKKDYLITYGGSTN
FT                   FTRRNMRNFNLENELKIISAYDQKISKDILDYYDRLWTNRDGEFTLPYDEHKNEKLMND
FT                   LLFRFMEINGFGIF"
FT   sig_peptide     636013..636081
FT                   /locus_tag="Lebu_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.706 at
FT                   residue 23"
FT   gene            637471..638445
FT                   /locus_tag="Lebu_0577"
FT   CDS_pept        637471..638445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0577"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bca:BCE_2172
FT                   serine/threonine phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38487"
FT                   /db_xref="GOA:C7N8K6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV38487.1"
FT                   /translation="MEGKLKEEKIKIEKINENDYNKIFVISDLHGQYDLFLKLLEKINL
FT                   KREDLLVIMGDICDRGEKSYEIYMKCMKMIKLGYNLKFILGNHEDMLLEDLENDYPLRY
FT                   ETEFSIYRNSKYFNKKSMEEWYEENFFKEIKWLVKWLKNCPLIISGNESIFVHAGLDLQ
FT                   TKLEKQERETVLWTREEFWIDEESVLEEYRSKNIYFGHTPNINGRISEKTDKIWDIDCG
FT                   AFFTHFLGCVEVKSKEKIYVFENEFIQFSEVSGKVFLELWNEEVAEFINSEKYKIKSGK
FT                   GEVIILEKLDKNEKKFLTNFWKKYEKLFGKNIANYIRACLKTL"
FT   gene            638943..640754
FT                   /locus_tag="Lebu_0578"
FT   CDS_pept        638943..640754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0578"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; KEGG: fnu:FN0634 GTP-binding
FT                   protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38488"
FT                   /db_xref="GOA:C7N8K7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K7"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACV38488.1"
FT                   /translation="MNKIKNIAIIAHVDHGKTTLVDALLKQAGTFGEHEKVDERIMDSN
FT                   DLERERGITIFSKNASFHYNGYKINIVDTPGHADFGGEVQRILKMVDSVLLLVDAFEGV
FT                   MPQTKYVLKQALEHGLRPIVVVNKIDRPNSDPDAVVDSVFDLFVDLGANDIQLDFPVVY
FT                   ASAKNGFAKLELEDEDKDMKPLYDKIMEHVEDPEGDVNEPLQMLVTNTEYDEYVGKLGT
FT                   GRIYNGKIEKNQEITLIKRNGDLVNGKITRIYGYDGLKKVEMEVAFAGDIVTVAGIEQI
FT                   DIGETVASKENPKPLPLIDIDEPTLAMTFMVNDSPFAGQDGKFVTSRNILERLQKEVNH
FT                   NVSMRLEMTDSPDAFIVKGRGELQLSILLENMRREGYEVAVSKPEVIFKEENGQKLEPI
FT                   ELAIIDVADEFVGVVIEKLGLRKGEMVNMNQGSDGYTRLEFKVPSRGLIGFRNEFLTET
FT                   RGTGIINHSFFEYGPFKGEVTGRRRGVLIAMEPGTSLGYSLNNLQPRGILFIGPGVEVY
FT                   EGMIVGEHSRENDLVVNVCKGKKLTNMRAAGSDDAVKLAPPKEFTLELALEYIENDELV
FT                   EITPNFIRLRKKYLNANDRKKFENSKN"
FT   gene            640792..641217
FT                   /locus_tag="Lebu_0579"
FT   CDS_pept        640792..641217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38489"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K8"
FT                   /inference="similar to AA sequence:KEGG:GSU2727"
FT                   /protein_id="ACV38489.1"
FT                   /translation="MDNIKLEEKLKAELSEEKIKFIEKYSLEINSKRQWITRRNNTPER
FT                   LYFSHKFILRNNILEIVFRKYQLCFAKLKYFRANIEKYDFYKYTPKEGFIKTQLWDVEF
FT                   FYHKKSEKIIDLRYLQQIRKVEDFLELIEWLDSFEKE"
FT   gene            complement(641360..641884)
FT                   /locus_tag="Lebu_0580"
FT   CDS_pept        complement(641360..641884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A2357 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38490"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8K9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38490.1"
FT                   /translation="MKKILSVLILIFLTIVSCGGKHITQKDFENSMNVLQRGDTSILAG
FT                   NDSETAEALKIFSDAYKKITYKINKVTVNDNESILNVTMKSPVLTGVMQKVQKKSMQNA
FT                   KNLMGKSGKELEEESKKMLSEVISQKLNSPDLKYNEETFDVIYTKKGNTWELNSEKNAK
FT                   FQKVVTLGIQM"
FT   sig_peptide     complement(641822..641884)
FT                   /locus_tag="Lebu_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.543 at
FT                   residue 21"
FT   gene            642140..642958
FT                   /locus_tag="Lebu_0581"
FT   CDS_pept        642140..642958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0581"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: lmo:lmo1116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38491"
FT                   /db_xref="GOA:C7N8L0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV38491.1"
FT                   /translation="MKIEEIAEYMRKNIEKNCTVEGIAKEFGYSKFEFSKKFKRKTGFS
FT                   ASRFLSFLKIEKALDIIINENEDIITSQIRTGYNSSGTFSNIFKKYTGISPSNYKKTIK
FT                   EFYKIIREYVNSSGIEEISYGRGLKINGNNTRNFLCVNLVYPENYESEITFLGLFKNCI
FT                   PDDLPDFGKVLISDKTKSRCIFENIPERKYWLMGCSIKKGSDLKEFFYLKDSIRAKENK
FT                   AIVLPTDNEYTLKFRKPVSSDFPVLINIPKLVKEVTEINTDSILSVSDNE"
FT   gene            complement(643119..644117)
FT                   /locus_tag="Lebu_0582"
FT   CDS_pept        complement(643119..644117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0582"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   ckl:CKL_0621 extracellular substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38492"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L1"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ACV38492.1"
FT                   /translation="MKKIMRGVLLFGMLGGMLLSCGNKKSNNSQDGKKDSQVSEKIYKI
FT                   GLSQIVDHPALNAAKQGFKDALAKAGIKADYDDKIANNDMSNQTLIMQQFEADKKDLVF
FT                   AVTTPTAQAAKNQVTGNTPVVFASVTDPKSAGLEGIPNVTGTSGAAPVNENLKLMRELL
FT                   PEAKKIGIIYNSSEQNSVSEVNNLKKLAGQYGFTVVEKAVTNGTEMVAAANLIAKDIDI
FT                   YYAIQDNTVASYFAALLDVFNKSKIPVLATNDVYSNAGGLISQGTTDYNIGYRSGEIAA
FT                   EILLKGKKPSEIPIETVKNLQIEINKQNMELLGIKIPDSILKQAKMVETKK"
FT   sig_peptide     complement(644049..644117)
FT                   /locus_tag="Lebu_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.466 at
FT                   residue 23"
FT   gene            644536..645537
FT                   /locus_tag="Lebu_0583"
FT   CDS_pept        644536..645537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0583"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: dth:DICTH_0132 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38493"
FT                   /db_xref="GOA:C7N8L2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L2"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV38493.1"
FT                   /translation="MSTIRDVAKHAGVSIATVSRILNNDEYFGVTRETKQKVLEAVKKL
FT                   NYKKKNTKRKNAQSNVSIIKSFDEKIESEDPYFVSLRLDLEYALKKKGIKSKVFELQMF
FT                   EKDEEILMNFIVCNAIIVIGETKRSQLDFLKSLNDNIICVDAYNFDNSIDYIKFDMKHS
FT                   VKIVIDYLLKLGHKKIGLLVGRNQIVRNLVDFREKYFIEIMKELELYDERFVKVDEFSP
FT                   ESGYEMMKEILKLEDRPTAIFCANDSIAMGAYKAIREHNLKIFDDISIIGFNDLKISQY
FT                   MIPPLTTLRIDTKIIAQETINVLMELLEHNRSYRKKVYLPVELIERESCGSI"
FT   gene            645880..646302
FT                   /locus_tag="Lebu_0584"
FT   CDS_pept        645880..646302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0584"
FT                   /product="galactose-6-phosphate isomerase, LacA subunit"
FT                   /EC_number="5.3.1.26"
FT                   /note="KEGG: ser:SERP1795 galactose-6-phosphate isomerase
FT                   subunit LacA; TIGRFAM: galactose-6-phosphate isomerase,
FT                   LacA subunit; sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; PFAM: Ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38494"
FT                   /db_xref="GOA:C7N8L3"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004783"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L3"
FT                   /inference="protein motif:TFAM:TIGR01118"
FT                   /protein_id="ACV38494.1"
FT                   /translation="MKIILGSDVDGNELKDYIKNYLLENGYDVIDKSENKDFVETTYSV
FT                   AQTVLADDDSLGIVFDAYGAGSFMVATKIKGMIAAEVSDERSAYMTRRHNNSRIITIGS
FT                   EIVGKGLAKNIVKDFLSAPYDGGRHQIRVDMLNKMC"
FT   gene            646352..646867
FT                   /locus_tag="Lebu_0585"
FT   CDS_pept        646352..646867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0585"
FT                   /product="galactose-6-phosphate isomerase, LacB subunit"
FT                   /EC_number="5.3.1.26"
FT                   /note="KEGG: llc:LACR_D05 galactose-6-phosphate isomerase
FT                   subunit LacB; TIGRFAM: galactose-6-phosphate isomerase,
FT                   LacB subunit; sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; PFAM: Ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38495"
FT                   /db_xref="GOA:C7N8L4"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004784"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L4"
FT                   /inference="protein motif:TFAM:TIGR01119"
FT                   /protein_id="ACV38495.1"
FT                   /translation="MKIAIGCDHIVTDVKMALSDFLKSKGYEVLDCGTYDFTRTHYPIY
FT                   GRRVGEAVVTGKADLGVCICGTGVGINNSVNKVPGIRSALVRDMTSALYAKEHLNANVI
FT                   GFGGAITGKLLLFDIVEAFIKAKYKKTEESEKLIEKIKAVETVNPEQKNEDFFDEFLEK
FT                   WDRGEYKD"
FT   gene            646996..647934
FT                   /locus_tag="Lebu_0586"
FT   CDS_pept        646996..647934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0586"
FT                   /product="tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="KEGG: sgo:SGO_1517 tagatose-6-phosphate kinase;
FT                   TIGRFAM: tagatose-6-phosphate kinase; 1-
FT                   phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38496"
FT                   /db_xref="GOA:C7N8L5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005926"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L5"
FT                   /inference="protein motif:TFAM:TIGR01231"
FT                   /protein_id="ACV38496.1"
FT                   /translation="MILTVTMNPSVDISYPLEKFNLDTVNRVVKVSKTPGGKGLNVTRV
FT                   LKQLNDEVVATGLIGGALGTDIQKKLLEKGIKNNFFEISGETRNCIAILHEGNQTEILE
FT                   KGPTITKSESDNFLEHFEKLVKSKEIKIIAISGSLPDGLEINYYSKMIEICEKYKKSVV
FT                   LDCSGKALLEVLKNEYKPKVIKPNTEELSQLIGKDVSKNPDELKKVLKDKLFEKIEWII
FT                   VSLGADGAFAKHNDKFYKVNVPNIKVVNPVGSGDSTVAGITSAIHENASDQDLLRKANV
FT                   LGMLNAMEKLTGFVNLENYDKLFNEVEILEI"
FT   gene            648028..649005
FT                   /locus_tag="Lebu_0587"
FT   CDS_pept        648028..649005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0587"
FT                   /product="tagatose 1,6-diphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="KEGG: llc:LACR_D03 tagatose 1,6-diphosphate
FT                   aldolase; TIGRFAM: tagatose 1,6-diphosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38497"
FT                   /db_xref="GOA:C7N8L6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L6"
FT                   /inference="protein motif:TFAM:TIGR01232"
FT                   /protein_id="ACV38497.1"
FT                   /translation="MKLSAQKRKYLENLSDKNGFISALAIDQRGALKKMINKNQEKEAT
FT                   AEQIKEFKVLVSKHLTKYSSSILLDPEYGLDAAKARDKNAGLLLAYEKTGYDANAVGRL
FT                   PDCLVEWSAKRLKEEGADAVKFLLYYDVDESEEINIQKKAYMERVGAECVAEDIPFFLE
FT                   ILSYDCKIDDNSTAEFAKLKPRKVIEAMKVFSDPRYNVDVLKVEVPVNMKFVEGFSDGE
FT                   TVYTKEEAANYFKLQEEATSLPYIYLSAGVSAKLFQDTLKFAHDSGAKFNGVLCGRATW
FT                   ANGVEVFAKEGEKATVEWLNTIGRKNIEELNEVVEKTATSWKEK"
FT   gene            649096..649413
FT                   /locus_tag="Lebu_0588"
FT   CDS_pept        649096..649413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0588"
FT                   /product="PTS system, lactose-specific IIa component"
FT                   /note="TIGRFAM: PTS system, lactose-specific IIa component;
FT                   PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: smu:SMU.1492
FT                   PTS system, lactose-specific enzyme IIA EIIA-LAC)"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38498"
FT                   /db_xref="GOA:C7N8L7"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L7"
FT                   /inference="protein motif:TFAM:TIGR00823"
FT                   /protein_id="ACV38498.1"
FT                   /translation="MTKEDVTMIGFEIVAYAGDARSKLMIALNKAQNGEFEEAEKLVKE
FT                   AEECLVGAHNSQTDILAKEAAGEDLEMSFIMIHGQDHLMTTILLKELMKHLIELYKRGA
FT                   K"
FT   gene            649414..651117
FT                   /locus_tag="Lebu_0589"
FT   CDS_pept        649414..651117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0589"
FT                   /product="PTS system, lactose-specific IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: spv:SPH_1305 PTS system, lactose-specific IIC
FT                   component; TIGRFAM: PTS system, lactose-specific IIC
FT                   subunit; PTS system, lactose/cellobiose family IIB subunit;
FT                   PTS system, lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38499"
FT                   /db_xref="GOA:C7N8L8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004801"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR041713"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8L8"
FT                   /inference="protein motif:TFAM:TIGR00394"
FT                   /protein_id="ACV38499.1"
FT                   /translation="MKKLIEFIEKGKPFFEKLSRNIYLRAIRDGFIAGMPVILFSSIFI
FT                   LIAYVPNAFGFFWPKNIEALLMKPYSYSMGILAFLVAGTTAKSLTDSVNRSMPATNQIN
FT                   YLSTLLASMVGLLLLAADPTKDGISTGFLGTKGLLTAFLAAFITVTIYKFCVKNEVTIK
FT                   MPSEVPPNISQVFKDVIPFTLSIVLLYVLEILVRHFIGTGVAEAVGKLFGPLFSAADGY
FT                   VGITIIFGAYAFFWFVGIHGPSIVEPAIAVVTYANIDANLNLMRAGQHADKILTSGTQM
FT                   FIVTMGGTGATLIVPFMFMWLCKSKRNKAIGRASAVPTFFGVNEPILFGAPIVLNPVFF
FT                   IPFIFAPVVNVWIFKIFIDVLGMNSFTANLPWTTPGPLGIILGTNLQVLSFILAALLIV
FT                   VDFIIYYPFIKVYDKQILEEERLGTTNNELKEKVAANFNTKKADNILEKAGVEKTGAVK
FT                   NNITKETNVLVLCAGGGTSGLLANALNKAAKEFDVPVKAAAGGYGAHREILPEFDLVIL
FT                   APQVASNFEDMKAETDKLGIKLAKTEGAQYISLTRDGKGALDFVQAQFQD"
FT   gene            651170..652573
FT                   /locus_tag="Lebu_0590"
FT   CDS_pept        651170..652573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0590"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /note="KEGG: smu:SMU.1490 6-phospho-beta-galactosidase;
FT                   TIGRFAM: 6-phospho-beta-galactosidase; PFAM: glycoside
FT                   hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38500"
FT                   /db_xref="GOA:C7N8L9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR005928"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7N8L9"
FT                   /inference="protein motif:TFAM:TIGR01233"
FT                   /protein_id="ACV38500.1"
FT                   /translation="MSKKLPEDFIFGGATAAYQAEGAIKIDGKGPVAWDKFLEENYWYT
FT                   AEPASDFYHQYPVDLKLCEEFGINGIRISIAWSRIFPNGYGEVNPKGVEFYHKLFAECK
FT                   KRKVEPFVTLHHFDTPEVLHSNGDFLNRENIEHFVNYAKFCFEEFSEVNYWTTFNEIGP
FT                   IGDGQYLVGKFPPGIKYDFEKLFQSHHNMVLAHAKAVNLFKKNGYHGEIGMVCALPTKY
FT                   PYDPNNPKDVRAAELDDIIHNKFILDATFKGEYSKNTMEGVNHILQVNGGKLDLREEDF
FT                   EELKAAKDLNDFLGINYYMSDWMAEYDGETEIIHNATGNKGSSKYQIKGVGQRKANESI
FT                   PRTDWDWIIYPQGLYDQISRVKKDYPNYKKIYITENGLGYKDVFEDNTVYDDARIDYIR
FT                   QHLEVISDAIKDGANVKGYFLWSLMDVFSWSNGYEKRYGLFYVDFETQKRYPKKSAYWY
FT                   KKVSETKEV"
FT   gene            652755..653222
FT                   /locus_tag="Lebu_0591"
FT   CDS_pept        652755..653222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0591"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="TIGRFAM: copper transport repressor, CopY/TcrY
FT                   family; PFAM: Penicillinase repressor; KEGG:
FT                   lci:LCK_p400008 TcrY"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38501"
FT                   /db_xref="GOA:C7N8M0"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M0"
FT                   /inference="protein motif:TFAM:TIGR02698"
FT                   /protein_id="ACV38501.1"
FT                   /translation="MKENCKIDKKQHITDAEWEVMRVVWANSEVTSKFVTEVLCEKMNW
FT                   KQATIKTLLNRLLEKNILKKREIGNKYIYSTDFTEKEVANNYILGTFDKICKTKVGEMI
FT                   GKVIENSELSFDDLDLILKAVEEKRKTAVEEVLCDCVEGQCNCEHNGHKHI"
FT   gene            653257..655485
FT                   /locus_tag="Lebu_0592"
FT   CDS_pept        653257..655485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0592"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: aoe:Clos_1066 heavy metal
FT                   translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38502"
FT                   /db_xref="GOA:C7N8M1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M1"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACV38502.1"
FT                   /translation="MTEKNYTVTGMSCAACANAVEKALNKNNDINASVNIATEKLNIEY
FT                   DEKKYDFDKIREIVKSAGYGLVEDMTEDKKLELYQEKITSLKNRLILAIIFVVPLLYIS
FT                   MGHMLGATLPEFLNPKVNPLNFALAQFVLTLPIIYAGRDFFSHGFKNLVRKSPTMDSLI
FT                   AIGATAAVLYGIYATFRIVTVDPEAHMDLYYESAGTIITLILFGKLLEAKTKGQTSSAI
FT                   KKLIGLQPKKAKIIENGAEKEVLIEKLKVGDIVIVKPGEKIAVDGRIVEGATSVDESML
FT                   TGESLPVSKKIGDKVVGGSINKNGSIRFEATEIGKNTVLSQIIKLVEEAQGSKAPISRM
FT                   ADIVAAYFVPIVIGIAIITGIAWFLSGSGLVTALSFFIAVLVIACPCALGLATPTSIMV
FT                   GTGKGAENGILIKSGEALETAHKIKTIVFDKTGTITKGKPVLTDLIAYGNYNENELLKI
FT                   TASVENDSEHPLAEAIVNEAKEKNIEIKPYEKFRAMPGYGIRATFEGKEVQIGNRKLME
FT                   NRKINVEISQKDYDILSNEGKTPMYISIDNELAGLVAVADVIKETSKEAIEKLKKMGIK
FT                   TIMLTGDNEKTAKFIAKQVGIDDVISEVLPYQKSQKVKELQEKDEFVAMVGDGINDSPA
FT                   LAQANVGIAIGNGTDVAIESADIVLIRNDLRDVAGAIALSKVTITNIKENLFWAFFYNV
FT                   LGIPFAAGIFYAFFNGPKLDPMIAAFAMSFSSVSVLGNALRLKFFKVK"
FT   sig_peptide     653257..653316
FT                   /locus_tag="Lebu_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.691 at
FT                   residue 20"
FT   gene            655552..655809
FT                   /locus_tag="Lebu_0593"
FT   CDS_pept        655552..655809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0593"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   lsl:LSL_1389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38503"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M2"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACV38503.1"
FT                   /translation="MKVELDNLVSMKEANQNFSKVARMVDKDGAVVILKNNIPKYILVD
FT                   YNLTKEVEKKPVKFAEDNELEMVSSKILKKYKKTFEELAK"
FT   gene            655806..656180
FT                   /locus_tag="Lebu_0594"
FT   CDS_pept        655806..656180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0594"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   lsl:LSL_1388 death on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38504"
FT                   /db_xref="GOA:C7N8M3"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M3"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACV38504.1"
FT                   /translation="MILLSKKQIIKLHSELVKEFGGIDGIRDKGLIESSISNVYQSYFG
FT                   VEKYPTIEEKAARLCYSFIKNHAFLDGNKRIGIYVMMVLLELNGISLSCSDDELTELGL
FT                   KIADSSIGYSEILEFIYRFQ"
FT   gene            656355..657338
FT                   /pseudo
FT                   /locus_tag="Lebu_0595"
FT   gene            complement(657615..658955)
FT                   /locus_tag="Lebu_0596"
FT   CDS_pept        complement(657615..658955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0596"
FT                   /product="magnesium transporter"
FT                   /note="KEGG: aoe:Clos_2073 magnesium transporter; TIGRFAM:
FT                   magnesium transporter; PFAM: MgtE integral membrane region;
FT                   MgtE intracellular region; CBS domain containing protein;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38505"
FT                   /db_xref="GOA:C7N8M4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M4"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ACV38505.1"
FT                   /translation="MKEIIETLLKEKKYFEIKKQLNELNAVEISDILNQFKIPELVIMI
FT                   FRLLKKDKAADVFPYLDSEHQEMIIHTSTDIETREIFDKLYFDDIVDIIEEMPFDVVKK
FT                   ILKNTDKKDRHLINQLLKYPDNSAGSIMTTEYVDFQKNMTVSEAIELLRKTGKDKENIY
FT                   TCYVTSENGKLEGVLSLKELIAKKDNIAIEDIMNKNFISVHTDDDQEVVADLFKKYDFI
FT                   VMPVVDHEGRILGIITIDDVMDVVDQEVTEDFHKMAGITSPTDDSYLKTNIFTMARQRI
FT                   GWLAVLMISDTISGNIIQGYEKVLAKSIILTAFIPMLMSSGGNVGSQSSTVVIRSLALG
FT                   EISPKDAFKVLRKEISIGIMVSIVLSILNFIRLITLEKINPTIAFIVSITLVFTIIISK
FT                   IVGALLPLGAKILKSDPAVMATPLITTISDAVTLVIYFKFATTFLKL"
FT   gene            complement(658966..660312)
FT                   /locus_tag="Lebu_0597"
FT   CDS_pept        complement(658966..660312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0597"
FT                   /product="magnesium transporter"
FT                   /note="KEGG: ctc:CTC01350 Mg2+ transporter MgtE; TIGRFAM:
FT                   magnesium transporter; PFAM: MgtE integral membrane region;
FT                   MgtE intracellular region; CBS domain containing protein;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38506"
FT                   /db_xref="GOA:C7N8M5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M5"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ACV38506.1"
FT                   /translation="MENNTIQKLINEKKYFEIRKYLNNLNTVEVSELLNQFESSELIMI
FT                   FRLLSKNRAADVFSYLDTEHQEMIINTMTDVETKNIFDELYFDDIVDIIEEMPSNVVKK
FT                   ILKNTDAKDRHTINLLLKYPDNSAGSIMTTEYMDLKKDMKVSQAIAKIRDTVENMENIY
FT                   TCYVISEDRKLEGVISLKELITNEDDTIVGNIMNRNFVSVHTNDDQENVAEIIKKYNLI
FT                   VLPVTDIENRLLGIITIDDIMDVVEQEATEDFHKMAGITPVEESYLKTSAFTMARQRIS
FT                   WLIILMISATFTGRIIKSYEDVLQSVVILSSFIPMLMDTGGNAGAQSSTIVIRALALGE
FT                   VNAKDTFRILRKEFFISFIVAVVLAAINFLRIMTLTKTPLNVALTVSITLIFVVMISKI
FT                   IGAFLPVVAKTFKMDPAIMAGPLITTILDALTLSIYFKFATIFLSNMIK"
FT   gene            complement(660699..660797)
FT                   /pseudo
FT                   /locus_tag="Lebu_0598"
FT   gene            661097..661324
FT                   /locus_tag="Lebu_0599"
FT   CDS_pept        661097..661324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38507"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38507.1"
FT                   /translation="MSTDGFRGYIFHAVENIKFPHKNEELTMFLVNNAGILLKAENMFI
FT                   QNADCFIKVEFGLFKRCIIGRTEKDLGSYE"
FT   gene            661405..661902
FT                   /locus_tag="Lebu_0600"
FT   CDS_pept        661405..661902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0600"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbh:CLC_2024 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38508"
FT                   /db_xref="GOA:C7N8M7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV38508.1"
FT                   /translation="MNIRKAKMNDLDEITAIEAECFPASEAATRESFEGRLLIYPNYFW
FT                   ILEEEGKDGNKKIVSFVNGMVTDSPNLEDEMYENPHLHDEKGNWQMIFGVNTLPEYRKR
FT                   GYAEKLINELIFEAKSKGRKGVVLTCKDKLVSYYSKFGFENEGVSESVHGGAVWYEMRL
FT                   RF"
FT   gene            complement(662180..663223)
FT                   /locus_tag="Lebu_0601"
FT   CDS_pept        complement(662180..663223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0601"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sgo:SGO_0565 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38509"
FT                   /db_xref="GOA:C7N8M8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M8"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACV38509.1"
FT                   /translation="MKAVVVNQEGTGIEVVEKELRGLKAGEALVDVEYCGVCHTDLHVA
FT                   HGDFGKVPGRVLGHEGIGIVREVADGVTSLKPGDRVSIAWFFEGCGRCEYCINGQEILC
FT                   RDVINAGYSADGGMAEQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVGKPQPG
FT                   QWVVIYGAGGLGNLGVQYAKKVFNTHVIAVDINDDKLALAKEVGADYIINGAKEDPVAK
FT                   IKELSGLGAHIAVVTAVSKVAFNQGIDSVRAAGKVVAVGLPSETMDLPIVKTVLDGIEV
FT                   IGSLVGTREDLREAFQFGAEGLVVPVVQTRNIDEAPEIFKEMEEGTIQGRMVIDMHSHS
FT                   CGCGHKH"
FT   gene            complement(663676..664191)
FT                   /locus_tag="Lebu_0602"
FT   CDS_pept        complement(663676..664191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38510"
FT                   /db_xref="GOA:C7N8M9"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8M9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38510.1"
FT                   /translation="MKKSINFIILGAILSIIAISTYIFTQNQIEIPKEMIISAVKSHFP
FT                   IKKSMYTLGDMKLSNPTVYFENDKLIIDADYEFKDRATSELTTGKAKFESELEYKNSNL
FT                   YLWNFNLKKLITKDGKDTKPDKYALTLISTISYELQYKKPLLYLGSNKKFNSIKSVKIK
FT                   NNKVLGEK"
FT   sig_peptide     complement(664114..664191)
FT                   /locus_tag="Lebu_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            664408..665295
FT                   /locus_tag="Lebu_0603"
FT   CDS_pept        664408..665295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cdf:CD3400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38511"
FT                   /db_xref="GOA:C7N8N0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N0"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACV38511.1"
FT                   /translation="MTMEDEGEKKELVIITGMSGAGKSETMNFFEDREYFCIDNFPISL
FT                   FQYLNEIFLSNKKRNKVAVAIDIRNQEFIEQFLKQLEFLDKNEIDYEIIYLDARTNVLL
FT                   SRYELSRRKHPLNLYDTLLENIEAERKIIKDFMLKADLVIDTTKTSVKELQKILEKEYS
FT                   GKKAKLSVNLTSFGFKNGIPLDLHLMFDLRFLPNPYYVEDLKRKTGNHKDVQDYVMGLP
FT                   ESQEFYKMLLDMLEYLIPKYEKDGKSHLRIGIGCSGGQHRSATFVNMLCKDLSERLEYK
FT                   ITKFHREIGGKTEV"
FT   gene            665305..667089
FT                   /locus_tag="Lebu_0604"
FT   CDS_pept        665305..667089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0604"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="KEGG: fnu:FN1090 excinuclease ABC subunit C;
FT                   TIGRFAM: excinuclease ABC, C subunit; PFAM: excinuclease
FT                   ABC C subunit domain protein; Excinuclease ABC C subunit
FT                   domain protein; SMART: Excinuclease ABC C subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38512"
FT                   /db_xref="GOA:C7N8N1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N1"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ACV38512.1"
FT                   /translation="MEEEIKSPIKYKDIPTHPGVYLMKNERGKIIYVGKAKNLQNRVKS
FT                   YFMNINSHNQKTMELVKNIKDIEFFICKSEVEALILENNLIKKNKPKYNILLKDEKTYP
FT                   YIKFTKEKFPKVEIVRSTKKLNENAEYFGPYPMGIFFAMKTLLKIFPMRDCNRSMDKIT
FT                   KPCLKYYMKTCPAPCKYKDIEDEYSTNVKNFKNFLKGHSDKVIEMLESRMKKFSDEMEF
FT                   ERAINEREKLAVLKRMLETQIIEYSKEIDEDVFVFEEKRENVFLCVLNIREGKVINKND
FT                   IIISLERSQEENLFERLITSYYEKRNIPKHIICDERFMSSELLIKEWAKIEKHKEIKLH
FT                   FPKINSRRLQLLEMGYLNLREEVDKYYRKRRMVQEGLRNLKKELRLKSLPYRIECFDIS
FT                   NIQGKDAVAAMTVALDGETTPKEYRHFKITVKDTPDDFLMMREALTRRYSKIENDKMPN
FT                   LILIDGGKGQLGVAVDVLEKLGKIEHTDVIGIAKREEEIFKSYESEPYLFEKTDETLKI
FT                   LQRLRDEAHRFGITHHRKLRSKRNVKSALDDITGIGPKRKKELIKKFGLIKNIRNATLE
FT                   ELMEVVPENIAISIKENL"
FT   gene            667106..668122
FT                   /locus_tag="Lebu_0605"
FT   CDS_pept        667106..668122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GAF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38513"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV38513.1"
FT                   /translation="MKKLIILILLGCSMTSFALFDKIKKEIKWKEEEQPRFKPVKVMID
FT                   GEEKMRKVIPGRYEIKLFEITYPTDLFGKNRFYNEFNTFLKNIKAGKKYSLLLENRFYQ
FT                   EMQDIKVDQLSEEEKILELPASSLDDYYKQQIVAMSGGANLKEYIGTDQEYLNRQIFVL
FT                   YELLNKLDFNPSNVYSELDKEFLIEELRNLRKEVVENFEKSNVEFFIKESYENSGLNKF
FT                   KDDSVYKFDKDIVLSDKIEDQAVLPELQRNIYLTGFPDEIIEKLAKNQLKLKKTPLLLE
FT                   NNEYRGYTYNEDNVVVFIGGENPKYYYKDYKINVVKKHIAVLDLLKTSSNYYVSDFF"
FT   sig_peptide     667106..667162
FT                   /locus_tag="Lebu_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.994 at
FT                   residue 19"
FT   gene            668535..670052
FT                   /locus_tag="Lebu_0606"
FT   CDS_pept        668535..670052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0606"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nth:Nther_0421 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38514"
FT                   /db_xref="GOA:C7N8N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV38514.1"
FT                   /translation="MSGYILEMKNIRKEFLGGKIVANDDITLKVKKGEIHAIVGENGAG
FT                   KSTLMKILNGLYSPTSGEIFYKGEKIDIDSPTTAANLGIGMVYQHFMLIDTLTVAENMV
FT                   LGFEPKKNGVFFDLNTARKQVREVSEKYGLNIDPDAKVSDLSVGIHQRIEILKVLFKGA
FT                   ELLVFDEPSAVLTPQEVKELYEIMRNLIKEGKTIIFISHKLQEVLDLSDNITVIRRGSD
FT                   VGGLKTKEATKEKIANLMVGRVVLFEVKRPDVKLGNVVVKVENLTVKSGGIEKVKDVSF
FT                   EIREGEVLGIAGVQGNGQTELIEALAGLAKVDSGTYFIDNDELENKTPKLIKEKGLSHI
FT                   PEDRHKRATIDDFTMEENMALGLQDQYSKGVLLNYSEIEGKTNEYIKKYDIRPTDGKIK
FT                   FGGLSGGNQQKVVVARELERENKFIIAAQPTRGVDIGAIEMIHNTILNEKTKKKAIMVV
FT                   SAELSEVMALSDRIAVMYSGKIVGILDRKDATTEKLGILMAGGKIDD"
FT   gene            670045..671112
FT                   /locus_tag="Lebu_0607"
FT   CDS_pept        670045..671112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0607"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_1831 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38515"
FT                   /db_xref="GOA:C7N8N4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV38515.1"
FT                   /translation="MIKNKIRDFLPSIIAVLIALVIGGIIMITKGVNPFMAYIDMMRAA
FT                   FYQASPRSPFFSGLAKTLFIATPLIFSALAAMVAFKAGLFNIGMQGQMIAGGLAATFWA
FT                   ITFKNYVFGNIFIVIIVAVIAGFLWAGIAGLLRAKFGVNEVISTIMLNYIMIEIQNFML
FT                   NGILKDPTTQNTQSPRVFEGARLPLLFAKVTKQNLNFGFIIAVLLTIGLFFFFKYFKKG
FT                   YEIKAVGQSDTVSENAGINPKYIMFLAMGIAGACAGLGGAERVLGGASEYTYTELIMGD
FT                   YGFTGLAVALLGKNNPFGILVAAIFYAALEVGGQMLQQRYQIDKDIVFIVQALIIIFVA
FT                   SENLFKFMLNKKKAA"
FT   gene            671159..672028
FT                   /locus_tag="Lebu_0608"
FT   CDS_pept        671159..672028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0608"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   cno:NT01CX_1410 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lebu_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACV38516"
FT                   /db_xref="GOA:C7N8N5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7N8N5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV38516.1"
FT                   /translation="MNILQQIFNLLQQTIIIAPPILITAVGACISEKSGVVNIGLEGIM
FT                   LSSAFATAVANITTGNPYLGIIFGMVVGVLISLIHAVISINLRGNQIISGVAINLFAAA
FT                   ITSYSIKTIFKTAGSTPLAKSLANRPLMIIVIYGIGIAMYFFLYKTVLGLRIRSVGEHP
FT                   LAADTVGISVYKTRYIAVLISGALGGLGGAYLTAVLLPSFSNNMSAGRGYIALAAMIFG
FT                   KWNPIGAILASLLFAFGQAFADVSKTIGLPISQQFLTMIPYILTLLALVGFVGKSKAPK
FT                   ASGLPYEK"
FT   gene            672057..672812
FT                   /locus_tag="Lebu_0609"
FT   CDS_pept        672057..672812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lebu_0609"
FT                   /product="Methyltransferase type 11"
F