(data stored in ACNUC1104 zone)

EMBL: CP001686

ID   CP001686; SV 1; circular; genomic DNA; STD; PRO; 2785024 BP.
XX
AC   CP001686; ABUD01000000-ABUD01000044;
XX
PR   Project:PRJNA21067;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Kytococcus sedentarius DSM 20547, complete genome.
XX
KW   .
XX
OS   Kytococcus sedentarius DSM 20547
OC   Bacteria; Actinobacteria; Micrococcales; Dermacoccaceae; Kytococcus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2785024
RX   DOI; 10.4056/sigs.761.
RX   PUBMED; 21304632.
RA   Sims D., Brettin T., Detter J.C., Han C., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Nolan M., Chen F., Lucas S., Tice H., Cheng J.F.,
RA   Bruce D., Goodwin L., Pitluck S., Ovchinnikova G., Pati A., Ivanova N.,
RA   Mavrommatis K., Chen A., Palaniappan K., D'haeseleer P., Chain P.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Schneider S.,
RA   Goker M., Pukall R., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Kytococcus sedentarius type strain (541)";
RL   Stand Genomic Sci 1(1):12-20(2009).
XX
RN   [2]
RP   1-2785024
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Sims D., Brettin T., Detter J.C., Han C., Kuske C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Kytococcus sedentarius DSM 20547";
RL   Unpublished.
XX
RN   [3]
RP   1-2785024
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Sims D., Brettin T., Detter J.C., Han C., Kuske C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; af6f8b62508c5f91c262aaceb2d1d145.
DR   BioSample; SAMN02598443.
DR   CABRI; DSM 20547.
DR   EnsemblGenomes-Gn; EBG00001199432.
DR   EnsemblGenomes-Gn; EBG00001199433.
DR   EnsemblGenomes-Gn; EBG00001199434.
DR   EnsemblGenomes-Gn; EBG00001199435.
DR   EnsemblGenomes-Gn; EBG00001199436.
DR   EnsemblGenomes-Gn; EBG00001199437.
DR   EnsemblGenomes-Gn; EBG00001199438.
DR   EnsemblGenomes-Gn; EBG00001199439.
DR   EnsemblGenomes-Gn; EBG00001199440.
DR   EnsemblGenomes-Gn; EBG00001199441.
DR   EnsemblGenomes-Gn; EBG00001199442.
DR   EnsemblGenomes-Gn; EBG00001199443.
DR   EnsemblGenomes-Gn; EBG00001199444.
DR   EnsemblGenomes-Gn; EBG00001199445.
DR   EnsemblGenomes-Gn; EBG00001199446.
DR   EnsemblGenomes-Gn; EBG00001199447.
DR   EnsemblGenomes-Gn; EBG00001199448.
DR   EnsemblGenomes-Gn; EBG00001199449.
DR   EnsemblGenomes-Gn; EBG00001199450.
DR   EnsemblGenomes-Gn; EBG00001199451.
DR   EnsemblGenomes-Gn; EBG00001199452.
DR   EnsemblGenomes-Gn; EBG00001199453.
DR   EnsemblGenomes-Gn; EBG00001199454.
DR   EnsemblGenomes-Gn; EBG00001199455.
DR   EnsemblGenomes-Gn; EBG00001199456.
DR   EnsemblGenomes-Gn; EBG00001199457.
DR   EnsemblGenomes-Gn; EBG00001199458.
DR   EnsemblGenomes-Gn; EBG00001199459.
DR   EnsemblGenomes-Gn; EBG00001199460.
DR   EnsemblGenomes-Gn; EBG00001199461.
DR   EnsemblGenomes-Gn; EBG00001199462.
DR   EnsemblGenomes-Gn; EBG00001199463.
DR   EnsemblGenomes-Gn; EBG00001199464.
DR   EnsemblGenomes-Gn; EBG00001199465.
DR   EnsemblGenomes-Gn; EBG00001199466.
DR   EnsemblGenomes-Gn; EBG00001199467.
DR   EnsemblGenomes-Gn; EBG00001199468.
DR   EnsemblGenomes-Gn; EBG00001199469.
DR   EnsemblGenomes-Gn; EBG00001199470.
DR   EnsemblGenomes-Gn; EBG00001199471.
DR   EnsemblGenomes-Gn; EBG00001199472.
DR   EnsemblGenomes-Gn; EBG00001199473.
DR   EnsemblGenomes-Gn; EBG00001199474.
DR   EnsemblGenomes-Gn; EBG00001199475.
DR   EnsemblGenomes-Gn; EBG00001199476.
DR   EnsemblGenomes-Gn; EBG00001199477.
DR   EnsemblGenomes-Gn; EBG00001199478.
DR   EnsemblGenomes-Gn; EBG00001199479.
DR   EnsemblGenomes-Gn; EBG00001199480.
DR   EnsemblGenomes-Gn; EBG00001199481.
DR   EnsemblGenomes-Gn; EBG00001199482.
DR   EnsemblGenomes-Gn; EBG00001199483.
DR   EnsemblGenomes-Gn; EBG00001199484.
DR   EnsemblGenomes-Gn; EBG00001199485.
DR   EnsemblGenomes-Gn; EBG00001199486.
DR   EnsemblGenomes-Gn; EBG00001199487.
DR   EnsemblGenomes-Gn; EBG00001199488.
DR   EnsemblGenomes-Gn; EBG00001199489.
DR   EnsemblGenomes-Gn; EBG00001199490.
DR   EnsemblGenomes-Gn; EBG00001199491.
DR   EnsemblGenomes-Gn; EBG00001199492.
DR   EnsemblGenomes-Gn; Ksed_00090.
DR   EnsemblGenomes-Gn; Ksed_00100.
DR   EnsemblGenomes-Gn; Ksed_00250.
DR   EnsemblGenomes-Gn; Ksed_03470.
DR   EnsemblGenomes-Gn; Ksed_03880.
DR   EnsemblGenomes-Gn; Ksed_04240.
DR   EnsemblGenomes-Gn; Ksed_06160.
DR   EnsemblGenomes-Gn; Ksed_06170.
DR   EnsemblGenomes-Gn; Ksed_06180.
DR   EnsemblGenomes-Gn; Ksed_06840.
DR   EnsemblGenomes-Gn; Ksed_07080.
DR   EnsemblGenomes-Gn; Ksed_07380.
DR   EnsemblGenomes-Gn; Ksed_07390.
DR   EnsemblGenomes-Gn; Ksed_07400.
DR   EnsemblGenomes-Gn; Ksed_08800.
DR   EnsemblGenomes-Gn; Ksed_08830.
DR   EnsemblGenomes-Gn; Ksed_08860.
DR   EnsemblGenomes-Gn; Ksed_09060.
DR   EnsemblGenomes-Gn; Ksed_09070.
DR   EnsemblGenomes-Gn; Ksed_10010.
DR   EnsemblGenomes-Gn; Ksed_10730.
DR   EnsemblGenomes-Gn; Ksed_10740.
DR   EnsemblGenomes-Gn; Ksed_11600.
DR   EnsemblGenomes-Gn; Ksed_11930.
DR   EnsemblGenomes-Gn; Ksed_11950.
DR   EnsemblGenomes-Gn; Ksed_12080.
DR   EnsemblGenomes-Gn; Ksed_12130.
DR   EnsemblGenomes-Gn; Ksed_12340.
DR   EnsemblGenomes-Gn; Ksed_12350.
DR   EnsemblGenomes-Gn; Ksed_12360.
DR   EnsemblGenomes-Gn; Ksed_12940.
DR   EnsemblGenomes-Gn; Ksed_13650.
DR   EnsemblGenomes-Gn; Ksed_15160.
DR   EnsemblGenomes-Gn; Ksed_15450.
DR   EnsemblGenomes-Gn; Ksed_15490.
DR   EnsemblGenomes-Gn; Ksed_15500.
DR   EnsemblGenomes-Gn; Ksed_15510.
DR   EnsemblGenomes-Gn; Ksed_15520.
DR   EnsemblGenomes-Gn; Ksed_18410.
DR   EnsemblGenomes-Gn; Ksed_19050.
DR   EnsemblGenomes-Gn; Ksed_21050.
DR   EnsemblGenomes-Gn; Ksed_21210.
DR   EnsemblGenomes-Gn; Ksed_21220.
DR   EnsemblGenomes-Gn; Ksed_21340.
DR   EnsemblGenomes-Gn; Ksed_23850.
DR   EnsemblGenomes-Gn; Ksed_23950.
DR   EnsemblGenomes-Gn; Ksed_24830.
DR   EnsemblGenomes-Gn; Ksed_25920.
DR   EnsemblGenomes-Gn; Ksed_25960.
DR   EnsemblGenomes-Gn; Ksed_25970.
DR   EnsemblGenomes-Gn; Ksed_26020.
DR   EnsemblGenomes-Gn; Ksed_26100.
DR   EnsemblGenomes-Gn; Ksed_26110.
DR   EnsemblGenomes-Gn; Ksed_26140.
DR   EnsemblGenomes-Gn; Ksed_26280.
DR   EnsemblGenomes-Tr; EBT00001570437.
DR   EnsemblGenomes-Tr; EBT00001570438.
DR   EnsemblGenomes-Tr; EBT00001570439.
DR   EnsemblGenomes-Tr; EBT00001570440.
DR   EnsemblGenomes-Tr; EBT00001570441.
DR   EnsemblGenomes-Tr; EBT00001570442.
DR   EnsemblGenomes-Tr; EBT00001570443.
DR   EnsemblGenomes-Tr; EBT00001570444.
DR   EnsemblGenomes-Tr; EBT00001570445.
DR   EnsemblGenomes-Tr; EBT00001570446.
DR   EnsemblGenomes-Tr; EBT00001570447.
DR   EnsemblGenomes-Tr; EBT00001570448.
DR   EnsemblGenomes-Tr; EBT00001570449.
DR   EnsemblGenomes-Tr; EBT00001570450.
DR   EnsemblGenomes-Tr; EBT00001570451.
DR   EnsemblGenomes-Tr; EBT00001570452.
DR   EnsemblGenomes-Tr; EBT00001570453.
DR   EnsemblGenomes-Tr; EBT00001570454.
DR   EnsemblGenomes-Tr; EBT00001570455.
DR   EnsemblGenomes-Tr; EBT00001570456.
DR   EnsemblGenomes-Tr; EBT00001570457.
DR   EnsemblGenomes-Tr; EBT00001570458.
DR   EnsemblGenomes-Tr; EBT00001570459.
DR   EnsemblGenomes-Tr; EBT00001570460.
DR   EnsemblGenomes-Tr; EBT00001570461.
DR   EnsemblGenomes-Tr; EBT00001570462.
DR   EnsemblGenomes-Tr; EBT00001570463.
DR   EnsemblGenomes-Tr; EBT00001570464.
DR   EnsemblGenomes-Tr; EBT00001570465.
DR   EnsemblGenomes-Tr; EBT00001570466.
DR   EnsemblGenomes-Tr; EBT00001570467.
DR   EnsemblGenomes-Tr; EBT00001570468.
DR   EnsemblGenomes-Tr; EBT00001570469.
DR   EnsemblGenomes-Tr; EBT00001570470.
DR   EnsemblGenomes-Tr; EBT00001570471.
DR   EnsemblGenomes-Tr; EBT00001570472.
DR   EnsemblGenomes-Tr; EBT00001570473.
DR   EnsemblGenomes-Tr; EBT00001570474.
DR   EnsemblGenomes-Tr; EBT00001570475.
DR   EnsemblGenomes-Tr; EBT00001570476.
DR   EnsemblGenomes-Tr; EBT00001570477.
DR   EnsemblGenomes-Tr; EBT00001570478.
DR   EnsemblGenomes-Tr; EBT00001570479.
DR   EnsemblGenomes-Tr; EBT00001570480.
DR   EnsemblGenomes-Tr; EBT00001570481.
DR   EnsemblGenomes-Tr; EBT00001570482.
DR   EnsemblGenomes-Tr; EBT00001570483.
DR   EnsemblGenomes-Tr; EBT00001570484.
DR   EnsemblGenomes-Tr; EBT00001570485.
DR   EnsemblGenomes-Tr; EBT00001570486.
DR   EnsemblGenomes-Tr; EBT00001570487.
DR   EnsemblGenomes-Tr; EBT00001570488.
DR   EnsemblGenomes-Tr; EBT00001570489.
DR   EnsemblGenomes-Tr; EBT00001570490.
DR   EnsemblGenomes-Tr; EBT00001570491.
DR   EnsemblGenomes-Tr; EBT00001570492.
DR   EnsemblGenomes-Tr; EBT00001570493.
DR   EnsemblGenomes-Tr; EBT00001570494.
DR   EnsemblGenomes-Tr; EBT00001570495.
DR   EnsemblGenomes-Tr; EBT00001570496.
DR   EnsemblGenomes-Tr; EBT00001570497.
DR   EnsemblGenomes-Tr; Ksed_00090-1.
DR   EnsemblGenomes-Tr; Ksed_00100-1.
DR   EnsemblGenomes-Tr; Ksed_00250-1.
DR   EnsemblGenomes-Tr; Ksed_03470-1.
DR   EnsemblGenomes-Tr; Ksed_03880-1.
DR   EnsemblGenomes-Tr; Ksed_04240-1.
DR   EnsemblGenomes-Tr; Ksed_06160-1.
DR   EnsemblGenomes-Tr; Ksed_06170-1.
DR   EnsemblGenomes-Tr; Ksed_06180-1.
DR   EnsemblGenomes-Tr; Ksed_06840-1.
DR   EnsemblGenomes-Tr; Ksed_07080-1.
DR   EnsemblGenomes-Tr; Ksed_07380-1.
DR   EnsemblGenomes-Tr; Ksed_07390-1.
DR   EnsemblGenomes-Tr; Ksed_07400-1.
DR   EnsemblGenomes-Tr; Ksed_08800-1.
DR   EnsemblGenomes-Tr; Ksed_08830-1.
DR   EnsemblGenomes-Tr; Ksed_08860-1.
DR   EnsemblGenomes-Tr; Ksed_09060-1.
DR   EnsemblGenomes-Tr; Ksed_09070-1.
DR   EnsemblGenomes-Tr; Ksed_10010-1.
DR   EnsemblGenomes-Tr; Ksed_10730-1.
DR   EnsemblGenomes-Tr; Ksed_10740-1.
DR   EnsemblGenomes-Tr; Ksed_11600-1.
DR   EnsemblGenomes-Tr; Ksed_11930-1.
DR   EnsemblGenomes-Tr; Ksed_11950-1.
DR   EnsemblGenomes-Tr; Ksed_12080-1.
DR   EnsemblGenomes-Tr; Ksed_12130-1.
DR   EnsemblGenomes-Tr; Ksed_12340-1.
DR   EnsemblGenomes-Tr; Ksed_12350-1.
DR   EnsemblGenomes-Tr; Ksed_12360-1.
DR   EnsemblGenomes-Tr; Ksed_12940-1.
DR   EnsemblGenomes-Tr; Ksed_13650-1.
DR   EnsemblGenomes-Tr; Ksed_15160-1.
DR   EnsemblGenomes-Tr; Ksed_15450-1.
DR   EnsemblGenomes-Tr; Ksed_15490-1.
DR   EnsemblGenomes-Tr; Ksed_15500-1.
DR   EnsemblGenomes-Tr; Ksed_15510-1.
DR   EnsemblGenomes-Tr; Ksed_15520-1.
DR   EnsemblGenomes-Tr; Ksed_18410-1.
DR   EnsemblGenomes-Tr; Ksed_19050-1.
DR   EnsemblGenomes-Tr; Ksed_21050-1.
DR   EnsemblGenomes-Tr; Ksed_21210-1.
DR   EnsemblGenomes-Tr; Ksed_21220-1.
DR   EnsemblGenomes-Tr; Ksed_21340-1.
DR   EnsemblGenomes-Tr; Ksed_23850-1.
DR   EnsemblGenomes-Tr; Ksed_23950-1.
DR   EnsemblGenomes-Tr; Ksed_24830-1.
DR   EnsemblGenomes-Tr; Ksed_25920-1.
DR   EnsemblGenomes-Tr; Ksed_25960-1.
DR   EnsemblGenomes-Tr; Ksed_25970-1.
DR   EnsemblGenomes-Tr; Ksed_26020-1.
DR   EnsemblGenomes-Tr; Ksed_26100-1.
DR   EnsemblGenomes-Tr; Ksed_26110-1.
DR   EnsemblGenomes-Tr; Ksed_26140-1.
DR   EnsemblGenomes-Tr; Ksed_26280-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001686.
DR   SILVA-SSU; CP001686.
DR   StrainInfo; 713278; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082757
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Kytococcus sedentarius 541, DSM 20547
CC   Culture Collection ID :: DSM 20547, ATCC 14392, CCM 314
CC   GOLD Stamp ID         :: Gc01042
CC   Funding Program       :: DOE-GEBA 2007
CC   Number of Reads       :: 61582
CC   Assembly Method       :: Phrap
CC   Sequencing Depth      :: 17.3x
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: slide submerged in sea water probably in
CC                            San Diego
CC   Collection Date       :: about or before 1944
CC   Isolation Country     :: USA
CC   Oxygen Requirement    :: Obligate aerobe
CC   Cell Shape            :: Sphere-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28 - 36C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Opportunistic infection, Pitted
CC                            keratolysis, Pneumonia
CC   Habitat               :: Marine, Skin microflora
CC   Phenotypes            :: Keratin degradation, Non-Haemolytic,
CC                            Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2785024
FT                   /organism="Kytococcus sedentarius DSM 20547"
FT                   /strain="DSM 20547"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:478801"
FT                   /culture_collection="DSM:20547"
FT   gene            209..1729
FT                   /locus_tag="Ksed_00010"
FT   CDS_pept        209..1729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="PFAM: Bacterial dnaA protein helix-turn-helix
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05101"
FT                   /db_xref="GOA:C7NID0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID0"
FT                   /protein_id="ACV05101.1"
FT                   /translation="MSQTPDDHATAIWQEAMVHLQGAGLAPRDIGVLRLATLVGLLEGT
FT                   ALLAVKYDHVKDAVEGHLREDVSTALAEVLDRDIRLAVSVDPDAVSAAQEEAAPPAPSP
FT                   ADEDDPATGEGPLSTAVDGAVEKHEGSSPARAGESVAPATTASLTATNSSPGVERDYSA
FT                   LNHKYTFDTFVLGSSNRFAHAAATAVAEAPARAYNPLFIYGGSGLGKTHLLHAIGHYAR
FT                   TLDSSVRVKYVNSEEFTNQFINAVSAGQANAFQRQYRDVDVLLIDDIQFLQGKEQTMEE
FT                   FFHTFNTLHNSEKQIVITSDQPPKKLSGFAERMRSRFEWGLLTDVQPPDLETRIAILRR
FT                   KAAADKLDIPDDVLHLIASKISSNIRELEGALTRVTAFASLSGSPLDEYLARTVLKDVM
FT                   PGGDSGQITPTMILEETAGYFVISVEEIQGASRSRNLTRARQIAMYLCRELTDLSLPKI
FT                   GKEFGGRDHTTVMHAERKIKQLLGEDRRVYDEVSELTSIIRKKAARGR"
FT   gene            2317..3453
FT                   /locus_tag="Ksed_00020"
FT   CDS_pept        2317..3453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="PFAM: DNA polymerase III beta subunit, C-terminal
FT                   domain; DNA polymerase III beta subunit, central domain;
FT                   DNA polymerase III beta subunit, N-terminal domain;
FT                   TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05102"
FT                   /db_xref="GOA:C7NID1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID1"
FT                   /protein_id="ACV05102.1"
FT                   /translation="MEFQVQRDVLSEAVAWVVRGLTNRPPVPVLAGVRLVADPAGTLTL
FT                   SAFDYEVSGEVTVEADVVTGGEALVLGRLLSEISRSLPDKPVRIQQDGGKLQVTCGSSR
FT                   FALLEMPLADYPSLPTSPEASGTVDGALFTKAVAQVSVAADRSDALPILTGVHVEFDGE
FT                   RITMLATDRYRMARRELTWTPRDPSAHHVALVPSRTLSDTAKSLGAVGSVDIALGDEAG
FT                   GKGLIGFAAGQRHSTTRLLDGEYPKVSSIFPTTSDVDAVMETSALVEAIKRVSLVAERT
FT                   TPVRLRFTPGSVAIEAGTGDDAQASEAVECTLDGDEIDVAFNPGFLLDGLGALGTPFAR
FT                   MSFTQPGKPALLTGQAEADGEADDAFSYVIMPVRFPGA"
FT   gene            3514..4494
FT                   /locus_tag="Ksed_00030"
FT   CDS_pept        3514..4494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00030"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, C-terminal
FT                   domain; NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05103"
FT                   /db_xref="GOA:C7NID2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID2"
FT                   /protein_id="ACV05103.1"
FT                   /translation="MQLGLVGLGKMGGNMKTRLERAGHEVVGFDLDPQLRDVDSLQALV
FT                   EALEGPRVVWVMVPHGKPTRNTIEELAKHLQPGDLVIEGGNSPYQDDFVHDELLSAKGI
FT                   GYVDCGVSGGIWGLDNGYGLMCGGRPEHVEKAMPIFDALRPEGPREEGFVHAGEVGAGH
FT                   YSKMVHNGIEYGLMAAYAEGYELLMAKEIVKDVPGAFKAWSRGTVVRSWLLDLLVDALE
FT                   QNPGLKDVSGYTTDSGEGRWTVIEGVENAVPMPVISAALFSRFTSRQENSPAMQAVAAL
FT                   RGGFGGHEVMTFGDEPWDRPKQVHQAAEPADTQGEATPGAVDDEA"
FT   gene            4520..5692
FT                   /locus_tag="Ksed_00040"
FT   CDS_pept        4520..5692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05104"
FT                   /db_xref="GOA:C7NID3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID3"
FT                   /protein_id="ACV05104.1"
FT                   /translation="MRLRHLAVRDFRSYEQADLDLPAGVTVFVGRNGQGKTNLVEAAGY
FT                   LATLGSHRVSSDQPLVRVGAEHAIIRGAVDHDGRETVLELQINPGRANRAQLGRSPVPR
FT                   ARDVLGTLRTVLFAPEDLALVKGDPAGRRAFLDALLVARQPRWAGVQADYAQALKQRNA
FT                   LLRDVRASRSAPSSSTVAMLEAWDEHLAVGGASLLYARLRLVQDLRRFVEKAYRQVSEA
FT                   ASEAGLTYRWSLVGDEADAALSGLTGGGPVPERDDLARLFSASLGAMRQRELERGITLV
FT                   GPHRDDLDLTLGPVPAKGYASHGESWSLALSLRLAAFELLRTDLGTDPVLVLDDVFAEL
FT                   DTGRRERLAELVADAEQVLVTAAVETDVPQTLRERAHHVDVVLGSAEARS"
FT   gene            5689..6279
FT                   /locus_tag="Ksed_00050"
FT   CDS_pept        5689..6279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00050"
FT                   /product="predicted RNA-binding protein containing Zn
FT                   ribbon"
FT                   /note="PFAM: Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05105"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID4"
FT                   /protein_id="ACV05105.1"
FT                   /translation="MSAAAPGPGDRPGAGNPHQGDAHQQPVGGASSEEELDAADLSLAR
FT                   MRDMARSRGLRPGAPGRRSRKRPGGPAGTSGKGRRDPQTLGAEFSRMIDDRGWGDELKV
FT                   GRVMGDWVGIVGPDVAAHSLPESFEEGVLLVRAESSTWATQLTMLTATLQKRLDDELGF
FT                   GVVTSVRVVGPAAPSWKHGRRRVQGQGPRDTYG"
FT   gene            6516..8621
FT                   /locus_tag="Ksed_00060"
FT   CDS_pept        6516..8621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00060"
FT                   /product="DNA gyrase subunit B"
FT                   /note="PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05106"
FT                   /db_xref="GOA:C7NID5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID5"
FT                   /protein_id="ACV05106.1"
FT                   /translation="MADQPIQTDQQAPSYDASSLQVLEGLEAVRKRPGMYIGSTGERGL
FT                   HHLVWEIVDNAVDEHLAGHADRIEVTILPDNAIRVVDNGRGIPTDVHAKEGISGVELVL
FT                   TQLHAGGKFGGDSYAVSGGLHGVGSSVVNALSSRFEVEVRQKGHVFRQSFTVGVPDAPL
FT                   SKDEEIAEDVTGTTITYWPSAEIFDTTVIDFETLRARFQQTCFLNKGLTIQLTDERPRV
FT                   TDADDEGLDDVDTDIAEGLEEHEDGTPIEDGQPDADQPATAAATKPRTVTYRYDDGLLD
FT                   YVRHLNNSKKTQPVNDEIIAFETEDSERMLQCEVAMQWTSSYSESVHTYANSVNTHEGG
FT                   THEEGFRAALTRLVNEFARANKLLKEKDPALTGEDVREGLTAVISVKLGEPQFEGQTKT
FT                   KLGNSEVKGFVQRAMADQLGHWLEAHPGEGKAIVGKAVQAAQARLAARKAREATRRKGL
FT                   LESGGLAAKLKDCQSNDPTVSEIFIVEGDSAGGSAIAGRNPFNQAILPLRGKILNVEKA
FT                   RLDRILSNTEVQALISSFGTGIGEEFDITRARYHKIVLMADADVDGMHIRTLLLTLLFR
FT                   FMKPLIEHGYVYLAQPPLYRLKWTNAEHDFAFTDRERDALTEAGVAKGRRLPKENGVQR
FT                   YKGLGEMNYQELWETTMDPDNRVLRQVTMDDAAAADQVFSVLMGEDVESRRSFIQRNAH
FT                   DVRFLDI"
FT   gene            8710..11337
FT                   /locus_tag="Ksed_00070"
FT   CDS_pept        8710..11337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00070"
FT                   /product="DNA gyrase subunit A"
FT                   /note="PFAM: DNA gyrase C-terminal domain, beta-propeller;
FT                   DNA gyrase/topoisomerase IV, subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05107"
FT                   /db_xref="GOA:C7NID6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID6"
FT                   /protein_id="ACV05107.1"
FT                   /translation="MSEQPPQDPNEQDLPQDDVVLPPVVNNGPEIPQHGRIEPVDLSSE
FT                   MQRSYIEYAMSVIVSRALPDVRDGLKPVHRRIVYAMYDGGYRPDRSYNKCARVVGDVMA
FT                   NYHPHGDSAIYDAMVRLSQPWSMRYPLIDGQGNFGSAGDDGPAAPRYTECRMQPLAMEL
FT                   VRDITEDTVDFEPNYDGRTMQPTVLPARFPNLLVNGSAGIAVGMATQIPPHNLREVAEG
FT                   CQWLLDNPEATKEELQEKLLQVIKGPDFPTGALIMGRSGIEDAYRTGRGSITMRAVVEV
FT                   EEIQGRTCLVVTELPYQVNPDALARKIAELVKTGKLQGIADLRDETSGRTGQRLVIVLK
FT                   RDAVAKVVLNNLYKHTQLQQNFGANMLALVDGVPRTLPINAFVRHWVDHQVEVIVRRTR
FT                   YRLKRAEEQIHILRGLLKALDALDEVIALIRRSPTVEQARDGLMDLLDIDEVQARAILD
FT                   MQLRRLAALERQKIIDEHDRLQALIEDLEDILATPARQRTIISEELAAIVEQYGDERRT
FT                   EIVPSDAEVNMEDLIPDENVVVTITRGGYAKRIRVDAYRSQRRGGKGVRGTTLRADDVV
FT                   DHFFTTQTHGWLLFFTDAGRVYRARAWELPEGSRDSKGQHVANIMAFGPDEKIAQVLTI
FT                   KDYQAAPYLVLATKNGLVKKTRLTEYDSPRSGGLIAVNLREGDELVGAELVSDADDILM
FT                   VSRKGQSLRFTASDDQIRPMGRATSGVTGMRFRGDDELLAMRVVPSDAEDAEVFVVFQS
FT                   GMAKRTAVDQYRVQGRGGLGVKVAKASDKGGDLVGALVVGQQDEVMVVMSSGKVVRSRV
FT                   DEVRMTGRDTSGVRFADPGKKEHIVAVARTHAEEEEAAEQVADAEAEQAAEAQATAATG
FT                   EDEQ"
FT   gene            11334..11822
FT                   /locus_tag="Ksed_00080"
FT   CDS_pept        11334..11822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05108"
FT                   /db_xref="GOA:C7NID7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID7"
FT                   /protein_id="ACV05108.1"
FT                   /translation="MSSGDRRAPATRRSRSGSGSGGAARLDLRSLYGGGSGERRTLNRS
FT                   TVGSVDLWSAFKLSFLTGVGLGLAIVAGVTLLWFALSTVGVFDDVNKLVGELAGTDAEQ
FT                   GGGSTLTDLLGLGTVLTFTTVFAVINTLVMTLLGTLLALVYNLMAALVGGLRVDLIED"
FT   gene            11941..12017
FT                   /locus_tag="Ksed_00090"
FT   tRNA            11941..12017
FT                   /locus_tag="Ksed_00090"
FT                   /product="tRNA-Ile"
FT   gene            12031..12103
FT                   /locus_tag="Ksed_00100"
FT   tRNA            12031..12103
FT                   /locus_tag="Ksed_00100"
FT                   /product="tRNA-Ala"
FT   gene            12205..12468
FT                   /locus_tag="Ksed_00110"
FT   CDS_pept        12205..12468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05109"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID8"
FT                   /protein_id="ACV05109.1"
FT                   /translation="MPTIARAENVAYVDREDEVVVALLPSGPLRILQGPAVVVWDLVGE
FT                   GALERDELIAQVLASYGEYPPEAPAQLSEAIDLLLAEGFLTA"
FT   gene            12478..12606
FT                   /locus_tag="Ksed_00120"
FT   CDS_pept        12478..12606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05110"
FT                   /db_xref="UniProtKB/TrEMBL:C7NID9"
FT                   /protein_id="ACV05110.1"
FT                   /translation="MKKILLAGAVAGAALMIARTLDQSAKTSELWSAATADLPGQV"
FT   gene            complement(12690..13871)
FT                   /locus_tag="Ksed_00130"
FT   CDS_pept        complement(12690..13871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05111"
FT                   /db_xref="GOA:C7NIE0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE0"
FT                   /protein_id="ACV05111.1"
FT                   /translation="MIDNPFRKKTASERWAESARTRFHAAADASHDAGERAKKLGEHTA
FT                   EGVSASAKSAGSALGALIPTVAAAFASGRSKAAHGLDEGVDHGAESVTHGLDAAPEKVD
FT                   QARDWIVEELLPKLQGMVDDTVDAKNNAAAQGGALSVVAGETVRTPKRKGGVLMVLGLA
FT                   MLGGAAYFWYTDQKRRQGDPWQRVSSSDDPWAATSGRRAVSAAANPGAGMRSTAATEPA
FT                   PTAGEKVHLTPSEAAAAREENVDRPVSALASGTTAGAATTPAAGAATPDTAETTVQRTT
FT                   EKTVVESRPLHEKVDENPATDATVTRTERRFEDPANTGPIATGYADRADDIAGDNAPTQ
FT                   SIPTVGERLNPRDARPADTTGDPYTGPNPTIEDPARDSVKEASEQTDAKWLRN"
FT   gene            13972..14490
FT                   /locus_tag="Ksed_00140"
FT   CDS_pept        13972..14490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00140"
FT                   /product="peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05112"
FT                   /db_xref="GOA:C7NIE1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE1"
FT                   /protein_id="ACV05112.1"
FT                   /translation="MNITLHTNLGDIPVELFENHAPKTVENFVGLAQGTKEYKDDAGRT
FT                   NPTPFYDGLGFHRIIEGFMIQGGCPLGTGTGGPGYTFDDEISPDLAYDRPYLLAMANAG
FT                   TRMGKGTNGSQFFITVTPTPHLQGKHTIFGEVKDAAGQAVVDKIAAVPTGRMDAPVEKV
FT                   EITSVTVND"
FT   gene            14512..15432
FT                   /locus_tag="Ksed_00150"
FT   CDS_pept        14512..15432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00150"
FT                   /product="uncharacterized membrane protein"
FT                   /note="PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05113"
FT                   /db_xref="GOA:C7NIE2"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE2"
FT                   /protein_id="ACV05113.1"
FT                   /translation="MSTPAFGESDAHHPSSRGGGAPVCPRHPDRTSYLSCQRCGRPACG
FT                   ECQRDAPVGIQCVDCVRSASRAMPAQRSTLGGRRFGNLGDMPVTYGLIGICVGVWVLQL
FT                   LFPRLTLEGAFVPGLADSEPWRFLTSAFLHDPSGPMHLMFNMFALWTVGGYLEKLLGQL
FT                   RFAALYLVSGFGGGVGSLLLSAPPDLEARSVGDWFSPSVGASGAVFGLFLALLVVDHAR
FT                   GRTITPMLALIAVNLVIGFVYPNIEWQAHLGGAVTGAVIAWGMTRGSRTRSPALVWGVI
FT                   AGVTALLLVATVVRYLTVPDLLVSL"
FT   gene            complement(15501..15764)
FT                   /locus_tag="Ksed_00160"
FT   CDS_pept        complement(15501..15764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00160"
FT                   /product="Uncharacterized protein family (UPF0233)"
FT                   /note="PFAM: Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05114"
FT                   /db_xref="GOA:C7NIE3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE3"
FT                   /protein_id="ACV05114.1"
FT                   /translation="MSTLPPELRDAEEPTDPRREEIQGSPSGMNPRWLVPTMVGLMVLG
FT                   VLWVVVYYVTQGEYPVGAWGYYNVAAGMGFLLAGFLVATRWQ"
FT   gene            15871..16575
FT                   /locus_tag="Ksed_00170"
FT   CDS_pept        15871..16575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00170"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Bacterial protein of unknown function
FT                   (DUF881)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05115"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE4"
FT                   /protein_id="ACV05115.1"
FT                   /translation="MRPLWRTAVPVVTVAAGLLFGISASVADGDDIRPENRGRAEALRD
FT                   LEQAVAGKEEEVLALRAEVDSAVEQEVGSPGSDDPLVRAAGLSEVSGPGLEVVLDDSPL
FT                   RGDEVPEGFGANDLVIHQEQLQAVVNAMWAGGAEAVQLMDQRLVSTSAVRCVGNTLILQ
FT                   GRVYSPPFVVRAIGPADDMRAQLDASLEVQLMREYTSLLQLGYTEDPVDSMTVPAFRGE
FT                   LQLAATPAATDA"
FT   gene            complement(16616..19471)
FT                   /locus_tag="Ksed_00180"
FT   CDS_pept        complement(16616..19471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00180"
FT                   /product="protein kinase family protein with PASTA domain"
FT                   /note="PFAM: Protein kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05116"
FT                   /db_xref="GOA:C7NIE5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE5"
FT                   /protein_id="ACV05116.1"
FT                   /translation="MDARNLSDRYEVEEPLGHGGMADVVAATDTRLGRRVAIKVLREDL
FT                   ARDPAFVRRFESEALAAARLNHPGIVSVFDVGEEQPDARGGLPRPFIVMEKVTGSTLRT
FT                   VLDTEGKLPPTRAVTIAADVLNALAYSHEQGVVHNDIKPGNIMISADGSVRIMDFGIAQ
FT                   ALNDISITVSQPDHVLGTAKYMAPELATGERAEPPSDVYALGCVLFEMLAGRPPFQGDS
FT                   AALVNQHLHVAPPRVSASAPSVPPALEELIDRALAKHPADRPGSARELEISLRGLLNDL
FT                   KGPRPTTTVTGSTAPAGASAAWGAGAAAPAAEEKAFGGFRPLEVDDADSAPREEQAPAF
FT                   RPLEDPPGHPYRGSEQQSQAPAVPDAAPDGQAPGADAPDGDAGQVRRIDHRQDTPADAA
FT                   ETTRAHEAPSASRSEGAAAPDDDPYAPWQPGNDIPGFAGDEPAPTAPPIGSTTDVSGST
FT                   TGSQPADSDAIRMADTSRMHEGGRGAGDDRDATGPQPLASDDAQDPHDARTSRVAAAGA
FT                   GATAAAGAAATGASEGPDGPEGDDPDSPPTRAVNTGSGTTVSGTTRLGETGGNPTTSDA
FT                   TGPVTGRFSRRARREGVPWWAWPVAGLALVGVAAGVAAGIDNWSNERGSVSVPDVRGKS
FT                   QQEAEEILKDADLEVRIEGRVDEAPLGTVLEQTPGPDTAVERGSAVTLVVASTENSPAP
FT                   SGSSGDPSSSESSSSDQSPSDSSGGESSREESSGGNESSDAGPSTSQTPDPTTSGPGGV
FT                   PVPPPSTPELPPTDGGQPTTEPGPDPTTTTEPDPTTTEPDPTTTEPDPTTSEPDPTTSE
FT                   PDPTTSEPDPTTTEPDPTTSEPDPTTSEPDPTTSEPDPTTSEPDPTTSEPDPTTSEPDP
FT                   TTTEPDPTTSEPDPTTTEPDPTTSEPDPSTSEPTTSEPDPTERSADPSPSTEPTPTGDP
FT                   SSPGPTSPEPTSPEPTSPSRS"
FT   gene            complement(19482..21272)
FT                   /locus_tag="Ksed_00190"
FT   CDS_pept        complement(19482..21272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00190"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05117"
FT                   /db_xref="GOA:C7NIE6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE6"
FT                   /protein_id="ACV05117.1"
FT                   /translation="MRGRHTAGDVIAGRYRLTEHIATGGMGEVWQADDEVLQRPVAVKL
FT                   LTKGLKDTEGFDERFRSEARHSAQLHHHNIAAVHDFGENDDGAWLVMEYVPGLTVAQMI
FT                   RDRGALPPDEVADLMTQAARALGAAHSAGVVHRDVKPANIIVTPAGVAKLTDFGIARAV
FT                   DSAGLTRTGEVMGTAQYLAPEQLMGRGATPASDLYSLGVVAHEMLTGERPYERESVVAT
FT                   AMAHVNEAVPPLPSSTPASLSAVVMRLMAKDPADRPQTAREVVAMLTNPDAVAAAPPHV
FT                   VGPDPADQATRAMTTPVRRRSVATTQGHPVMTNLDRPTASGARRVPARRRGFPWAWFLA
FT                   AAVIVGLLTAVVMMLLNSREDEPEGPVQTVTTTTDGGTSEESQSDSDASGSASESESDS
FT                   ENSETATDPESSDDATTDPVVPPPTTSQDDPSTSEADPTTTDPEPTTSDPDPDPSTSDP
FT                   EPDPSTSEPDPTTSDPAPTTTDPEPTTSDPEPDPSTSEPDPTTSDPAPTTSDPEEPTTE
FT                   PGPDPSNSDPEPEPTTSEPDPTPTIVDPPDPTDPPDPTGPTITWPSSTATPDPGDTTPV
FT                   TDPTTTASSGPNPLPAQDLV"
FT   gene            complement(21269..22741)
FT                   /locus_tag="Ksed_00200"
FT   CDS_pept        complement(21269..22741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00200"
FT                   /product="cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05118"
FT                   /db_xref="GOA:C7NIE7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE7"
FT                   /protein_id="ACV05118.1"
FT                   /translation="MNPPIRRLAWLIALLFAALLVAGSWIQVVDAQDLRERPGNRRTLL
FT                   NEFGRERGQILVDGEAVATSVPSEGRVPWRRTYPQGEDYAHVTGWFSLIYGSGGGLEGA
FT                   QSSLLSGTDDSLFYRRLPDLLTGQDPAGATIETTIDPSAQRAASEALGDRRGAAIAIDP
FT                   RSGAILAMVSHPTFDPSALSQEDVSRVEAAWTELNADPERPLVNRTIGGNTYPPGSVFK
FT                   LITAAAALEDDLLEPDSTVPAPRTYTLPGTNTTLRNFGGKACTQDESDEQSLSDALRVS
FT                   CNTAFADLGAELGDERLRTAAEDFGFGEQIRVPMRVTTSTFPDDPTEAQTALAALGQHD
FT                   VRVTPLQVALISAAIANGGQAKEPHLVEQVLDQELDVISRAEAGDMGRAVSPETAEQLR
FT                   EMMVSVVESGTGRAAAIPGVRVAGKTGTAEFDDPDGRVHAWFTGFAPADDPQVAVAVVV
FT                   EDVGRSASGETGTGGSVAAPIARSMMEEVITR"
FT   gene            complement(22738..24129)
FT                   /locus_tag="Ksed_00210"
FT   CDS_pept        complement(22738..24129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00210"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05119"
FT                   /db_xref="GOA:C7NIE8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE8"
FT                   /protein_id="ACV05119.1"
FT                   /translation="MAPRNGRWMELLLLAFAIGITALAYLLVGLGTSRTVPANVLTLAG
FT                   GMAVIALVFHVVLWWRARYADPVILPVVTLLNGLGLVMLHRLDIAEDRGLASGVASRQL
FT                   MWTALAVVVAMGVLVLLTDHRWLRRVTWTCAALGFLLLLSPLVPGLGVSNYGSRIWIRV
FT                   GPMSFQPGEVAKILLTIFFAGYLVGARDALSLTGPRFLGLQFPRFRDLGPIMLVWVLSI
FT                   LILVFEKDLGSSLLFFGLFVAMLYVATERLSWIVLGLGMFAGGAFVAWRLFAHVQQRVT
FT                   MWLDPFSREALAVSDQVPLGLMGMANGGILGTGLGQGRPDLTYFAESDFIVPAFAEELG
FT                   LVGFMAMLVLYGILVQRGLRIALGARDGFGTLLAAGLAFAIALQVFVVVGGVTRVIPLT
FT                   GLTTPFLSAGGSSLLANWTIVALLLRLSHDARSPIPLGDPTPEPADGPAARAAALERST
FT                   QGVPA"
FT   gene            complement(24189..25748)
FT                   /locus_tag="Ksed_00220"
FT   CDS_pept        complement(24189..25748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00220"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05120"
FT                   /db_xref="GOA:C7NIE9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIE9"
FT                   /protein_id="ACV05120.1"
FT                   /translation="MFDLHFAARSDVGLGSKTRNEDSAYAGPNLLLLCDGMGGHAGGDT
FT                   ASAIAVHHLSDLDHDVHRADEAGERLLHEVAAANAKLRAFQAEHPETEGMGTTCIAMVR
FT                   CASSLAIAHIGDSRAYRMQGGVLSQITHDHSFLQLLIDEGHLTEEEAWGHPQRSLITRV
FT                   LSGRPEDEPDHGVMPLVQGDRYLLCSDGLSDYVRDETIAQILRETPTPDETAQALIDVA
FT                   RRAGTRDNVTVVVADVVKPGVAPQRAPQTVGAAADLRSGHEGDHGDGHATERPAFQEPQ
FT                   TQDAPTQTVPVAADGSVTLNGQHLMIGQRAFEPRHISRENLAGSTRFHLGGDGEQATEG
FT                   EVIEIRGYGHGDRPERPARPEKGSHPVGRVIAWVVGVLATLALLVGGLWWWGDSNYFVG
FT                   ERDGQVQIRRGFDVNLLGQELSALEEQTDLAVDDLPGFYADSVRDAIPADDMDDARQTV
FT                   TDLRERAERRRQEDSGPEPSGSSGSSGSSGTSSSSSPSSSSTSGSASPSPSPSPTSGGS
FT                   SS"
FT   gene            complement(25751..26242)
FT                   /locus_tag="Ksed_00230"
FT   CDS_pept        complement(25751..26242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00230"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05121"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF0"
FT                   /protein_id="ACV05121.1"
FT                   /translation="MSELTVAVLRLALLALLWLFILAVVKVLHSDLYGARVVTRRSHRA
FT                   THRTPMPDESSPSRPGRQNAPAEPRRLVVVHGPMRGASLSLTTSPVVIGRNPEASLSVD
FT                   DDSMSGAHARVSPDAHGWVIEDLGSTNGTWVDDERLRGVVPLVAGTRIRVGQTLIEARR
FT                   "
FT   gene            complement(26239..27447)
FT                   /locus_tag="Ksed_00240"
FT   CDS_pept        complement(26239..27447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00240"
FT                   /product="FHA domain-containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05122"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF1"
FT                   /protein_id="ACV05122.1"
FT                   /translation="MGLLDRFESGTERVFTAPFARLFKREQLQPVEIGAAIRKAMDSRA
FT                   AVVNRHRTIVPNVFTIELSDDDFDRLIAFDEAITDELIADAQEYVTQQRYTPGGPLQIE
FT                   LVADPDLQPGIYKLHHATVRNPATLDERGDIDAWGATHERFDDAIDRHTSGHRIPSDAQ
FT                   YLGEVDEEAIAAADASRSAGAQDHDAAEPQQDELSPREERRRAKEERRAAEEAERERRA
FT                   VEEAERERRAVEAAEQADRARREQAEEQALAHQAGTQEYNREAAIEQQREGIRQAERAQ
FT                   RERAATEQATAAEAAPARSTRSVERPWVEVDGTRHPLTAETTLVGRDVSCDITVSDPGI
FT                   SRRHVELRTETAGGRTQVSIRDLGSTNGTFVGGEQIRNARLADGESFTMGRTTLTVRLG
FT                   SAP"
FT   gene            27730..27816
FT                   /locus_tag="Ksed_00250"
FT   tRNA            27730..27816
FT                   /locus_tag="Ksed_00250"
FT                   /product="tRNA-Leu"
FT   gene            complement(27840..28568)
FT                   /locus_tag="Ksed_00260"
FT   CDS_pept        complement(27840..28568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05123"
FT                   /db_xref="GOA:C7NIF2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF2"
FT                   /protein_id="ACV05123.1"
FT                   /translation="MTPTAPTDLQRRCWAVLAGVALTGALASMGLATLGLYPETRDQPS
FT                   ALGGHPAGWAGVLPRAVDALAYFTHWSNLVVAVTAWRVARGGRPAAWERVLVLDALLMI
FT                   SITALVYAVVLAPTAQVTGWEHVTNPWVHVVTPVATVLLWLALGPRGWLTWWAVPAALL
FT                   LPLTWVVLTLARGAVVDQYPYGFVDVVQLGLGRVLVNVAAIVGLGVVVAALYRLVDGLL
FT                   EPGRSHDRAPDPGDPDRGFW"
FT   gene            complement(28602..30221)
FT                   /locus_tag="Ksed_00270"
FT   CDS_pept        complement(28602..30221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00270"
FT                   /product="phosphate/sulfate permease"
FT                   /note="PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05124"
FT                   /db_xref="GOA:C7NIF3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF3"
FT                   /protein_id="ACV05124.1"
FT                   /translation="MSDTTPAPSGSTAEQPTTATGSDRWWHLAFGLLLAATAVTFTLWA
FT                   MGQIESTTHHVVLVVTIVFGLFMAFNIGGNDVANSFGTSVGAGTLSMKQALMVAAVFEV
FT                   GGAVLAGGEVTDTVRSGIVDLDGLTLAPMDFAFIMMSALLGAALWLLIATQMGWPVSTT
FT                   HSIIGGIVGAAVTLGLVTGTGGWEMVQWGEIGQIAISWVLSPVLGGLVAFLLFGWIKHG
FT                   ILVYNEEADARLRQIKRERIDLRTRHKAAFERLDELQQLSYTNAMARDAVVIADEDFDR
FT                   DELESDYYRELYAIQDQTDDVAAHKALETWVPLLAAFGSVVITAMLLFKGLKNLHLNID
FT                   GVGNFLIMGMVGAAVWVAVFIFAKSLKRQTLSRSTFVLFSWMQVFTACAFAFSHGSNDI
FT                   ANAVGPFAAVFDVLRTEEIGDEAAVPGPLMLAAGVALVAGLWFIGRRVITTVGSGLTAM
FT                   HPANGFAAELSAAGVVMIATLLGLPVSSTHILIGAVLGVGLVNKAANWKLMRPIALAWV
FT                   ITLPAAAGIGALTLVVLRAIFG"
FT   gene            complement(30565..31593)
FT                   /locus_tag="Ksed_00280"
FT   CDS_pept        complement(30565..31593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00280"
FT                   /product="Pirin-related protein"
FT                   /note="PFAM: Pirin C-terminal cupin domain; Pirin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05125"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF4"
FT                   /protein_id="ACV05125.1"
FT                   /translation="MPAVTAENILELARVQPHPESRPRAVKSVSTAPQGHEGEGFPVRR
FT                   AFAGVDLRDLDPFIHMDQMGEVEYAPLEPRGTDWHPHRGFETVTYIIDGSFLHEDTHGG
FT                   GGAITDGDTQWMTAGSGLLHIEAPPEKLVMDGGLFHGLQLWVNLPGHLKMTDPRYQDIQ
FT                   SGDVQLLSSEDGGALVRVIAGEVDGHQGPGITHTPISIVHATVSPGAQLRLPWNPGYNA
FT                   LVYVLSGEGTIGAEGRPLRTGQLAVLRDGDHIEVRADQQQDARHAQGIDLYILGGQAIN
FT                   EPVMAYGPFVMNTRAQLVTAFEDFQAGRLGIIPNSPRVKAASQIVKDAIDRGEAAPGHH
FT                   LL"
FT   gene            32002..32532
FT                   /locus_tag="Ksed_00290"
FT   CDS_pept        32002..32532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05126"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF5"
FT                   /protein_id="ACV05126.1"
FT                   /translation="MPRTTPARRSPRRPALPTWHDLDQLMGNAQVVRHVMNLWPPFLAA
FT                   SIRIEEVSPDFRDVRVRLRRRPWSTNYVGTLYGASMYSMTDPFWMMMLQRTLGPEFAVW
FT                   DTRGEIDHLRPGREDVTARFHLDEATLNEVRAATAGNAKHLRWFEVDLVQDDGTVVARV
FT                   RKQVYVRRKPARS"
FT   gene            complement(32599..33540)
FT                   /locus_tag="Ksed_00300"
FT   CDS_pept        complement(32599..33540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05127"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF6"
FT                   /protein_id="ACV05127.1"
FT                   /translation="MTRRPAARTLLAVAAAATLGLTACGGDDSEGEESTSQSSSESSEE
FT                   SESSEDEESSEETESSEGEESPSEEPTSEEPSESAPVESPSTDASAPALDPSAPPADPS
FT                   APVVDPSAPSTPATDPSEGTGLDQALAAELEPMVLTAAAVPGGTGQGQTQFIPEAQGQP
FT                   LHMTLTGLEATGACKTAVDTLNSGERLPSGSQFTITQLASGAQVQVGVVKIDGAEQVAK
FT                   DVAAISSACNTIEGPGGSASVTSLPSNNGYVMGLQNDGQTAGGFSMGVDAVGPEHAAVV
FT                   LAVSQQGELNASEVGAVMDAQVQKATSAAPQG"
FT   gene            complement(33631..35568)
FT                   /locus_tag="Ksed_00310"
FT   CDS_pept        complement(33631..35568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00310"
FT                   /product="glutaminase"
FT                   /note="PFAM: Glutaminase; Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05128"
FT                   /db_xref="GOA:C7NIF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF7"
FT                   /protein_id="ACV05128.1"
FT                   /translation="MPPVNHANPANPLSDLLARVHDRFRTHDEGEVAGYVESTGGVDTR
FT                   DFGLAITTVDGHTYSHGEADRLFAIQSISKAFTYAVALTDAGFDAVDAVIDVEPSGEAF
FT                   NEISLQEDTGRPSNALINAGAIASTSLVSGSSSNPYAGTRGTQPDDGAHQSPEGSRRER
FT                   LVRAFSAMAGRDLTVNERVLDFEREDGDRNLALAHLMRSFDLISEGPEEIADDYFATCA
FT                   IEVTTEDLSMMAALLATGGIHPVSGERLLSEDVVERVLGVMSTCGMYDDAGEWMVRVGL
FT                   PAKSGVGGGIVAVVPGQAGVAVYSPPLDRHGNSERGVLACEALSQELDLHLMHGARVTH
FT                   SAVRVTYPVTAAPSGVRRRPAAEAVLADHGHRGRVIEVQGDLTFGAAESVMRELVGLDE
FT                   VDGVVVDVRRVTEVTDFARAGLTELATGFDHQGTVMVLVDDSGRVADADRVRVVSRRKD
FT                   AIELVEELLLERHGGDELDRSEVEVQDAGVMATLDDADTEALLARMEARQYAAGEVVIT
FT                   EGARFAGIHLITSGTVETTAREPGAESRDEEDPTDPRADDDVEFRRLSVLGPGHSFGEF
FT                   GLLADGRHATTVTAREELHTWVLTPQVLTRLETEDPSLALRLWQAISRDAYTRIRSQMD
FT                   EIAARGADRR"
FT   gene            35601..36134
FT                   /locus_tag="Ksed_00320"
FT   CDS_pept        35601..36134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05129"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF8"
FT                   /protein_id="ACV05129.1"
FT                   /translation="MVRMDAVQHADAVTRRVESLAAGHVVALSRVLPGRPRTVWPVLTE
FT                   VLTERVRQLVAEQVEEPASWRGRWEEGRRTGWVAIDLGLDGGQTVLTVQHAVPDDEAWQ
FT                   ELGPAGVGLRWDAVLRELGERLEADGGTAAAGQDEDFLAAVTELWVVAHVQAGAPAARA
FT                   GAAADRAARGAGPA"
FT   gene            complement(36138..37127)
FT                   /locus_tag="Ksed_00330"
FT   CDS_pept        complement(36138..37127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00330"
FT                   /product="short-chain dehydrogenase of unknown substrate
FT                   specificity"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05130"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIF9"
FT                   /protein_id="ACV05130.1"
FT                   /translation="MDITPAAPPRQPLALVMGASRGLGLLCAAELLQHGHRVVLSSRDE
FT                   ASLAAARTQLLAEYPGARVDVAPCDISDRRAVQALVQRVETELAPIEVLLTVAGIIQVG
FT                   PVQAMTLEHFDQAVSTMLMGPVNLTLQVLPHMRERGRGRIGTVTSVGGKVAPPHLLPYS
FT                   TAKFGAVGFSEGLTAELAGTGITATTIVPGLMRTGSHDAAQFTGDVAREFAWFGPSASL
FT                   PLLAMDAERAAERMVHGVLEGHTHVMLSPVTQVGSRVHGLAPSFTTRLMGLANRVLPTA
FT                   PAVDPLGPGTTVEGRVARQGLTGRARRVVDALSTLGDRAGEQINERGA"
FT   gene            37247..38458
FT                   /locus_tag="Ksed_00340"
FT   CDS_pept        37247..38458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00340"
FT                   /product="theronine dehydrogenase-like Zn-dependent
FT                   dehydrogenase"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05131"
FT                   /db_xref="GOA:C7NIG0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG0"
FT                   /protein_id="ACV05131.1"
FT                   /translation="MRALTWQGNSDVRVEDVPDPTIQQPTDAIVRVTSTAICGSDLHLY
FT                   SVLGAFLHPGDVLGHEFMGIVEEVGPEAAGHLSVGDRVVVPFNISCGHCWMCSRGLFAQ
FT                   CETTQNTKQGKGASLFGYTDLYGAVPGGQAEYVRVPQAQFGPVKVPHEGADERYLYLSD
FT                   ILPTAWQGVKYANVPDGGTLAVMGLGPVGQLAVRSALKLGEASRVIGVDLVPERLETAK
FT                   AWGAEVLDLRDVDGGGRDPQKVGEAIREMTGGRGADSVLEAVGMEAHGNPVAHKAISAV
FT                   AHLPGPLGRPAIEKAGIDRLAALHSSIEAVRRGGTVSVSGVYGGMVDPMPMMTMFDKGI
FT                   AMRMGQCHVKQWTQELFDVANRSEDLLGLEQLATHRVSLEEAPAMYEVFQKKQDNCLKV
FT                   VLKP"
FT   gene            complement(38460..39791)
FT                   /locus_tag="Ksed_00350"
FT   CDS_pept        complement(38460..39791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00350"
FT                   /product="prolyl aminopeptidase 2"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05132"
FT                   /db_xref="GOA:C7NIG1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG1"
FT                   /protein_id="ACV05132.1"
FT                   /translation="MQQTTEYQPGLTIRTLRLEAPVDHGLARPPAIGPDAPADVALPAD
FT                   TLELFARVVTGTDGADKPYLVFLQGGPGGEAPRPSLTTSSPSWLRRALQDYQVVMLDQR
FT                   GTGLSTPVGSTLGPRRTAPGLTGVLAGTTPAQQAAYLQHFRADSIVADCELVRQALGAE
FT                   QWTVLGQSFGGFTSLHYLATHPESLAGALITGGLPPVDHTIEEVYGTTWELMIGKSEEH
FT                   HRRFPGDRARLAELTERAADGEIVLPNGDVVSPERFRTVGHGLGMSWGSERLHHLLERD
FT                   HTSSAFAADLEGMLPFGGRNPLYSVLHESSMADGVATRWAADRTIPGAVAADPALLGGE
FT                   HLHRSLFTEDSLLAPFAEAADLLAEVEWAELYPAEALRRADVPVAAAVYSNDAYVPRDF
FT                   SLEAASLLPDARLYETSAHEHNGLGAGDDVLDHLIGLLQGTRWR"
FT   gene            39827..40258
FT                   /locus_tag="Ksed_00360"
FT   CDS_pept        39827..40258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00360"
FT                   /product="Pyrimidine dimer DNA glycosylase /DNA-(apurinic
FT                   or apyrimidinic site) lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05133"
FT                   /db_xref="GOA:C7NIG2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG2"
FT                   /protein_id="ACV05133.1"
FT                   /translation="MRLWSVHPAQLDRAALVAGWREGLLAQKVLRGLTKGYTQHPQLER
FT                   FRAMDDPVQAVVTWLHGLADEADERGYSFDRTRVVVGPDPALRMPLTDGQLHLEWEHLA
FT                   TKVRVRNPEWWAQVGDQKPRPHPLFVVEPGPVAAWERAV"
FT   gene            complement(40290..40880)
FT                   /locus_tag="Ksed_00370"
FT   CDS_pept        complement(40290..40880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05134"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG3"
FT                   /protein_id="ACV05134.1"
FT                   /translation="MDICAIIQRQHDEQRTQFAQLEEWDRSDTEGLGALWKRLAILLET
FT                   HAEAEEKYFYPHLLTLGTGGADAEDAAEEVDDAIDDHNSIREGIRRAEAAEVGSDEWWT
FT                   AVVDTNVANSTHMGEEERQDLADFRQQASMQLRHDIAVEFLRYGALKAAEGITPRDKDP
FT                   QEYVEENSGGTPKDSDRAGDAPEQSLQASETEG"
FT   gene            complement(40922..41779)
FT                   /locus_tag="Ksed_00380"
FT   CDS_pept        complement(40922..41779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00380"
FT                   /product="biotin-dependent carboxylase-like protein"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; TIGRFAM:
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05135"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG4"
FT                   /protein_id="ACV05135.1"
FT                   /translation="MSAPNRPGLLVHRAGPLTTVQDLGRPGMGGTGVSTSGAADRAAHT
FT                   LANRLVGNGPGAATLEVTLGGLEVEAERDLVVALTGAVLPGAPMHGTVRLRAGERIACG
FT                   SPATGLRTYLAVRGGIATEPVVGSRSTDLLSGLGPPVVQDGDRLPIGDDHAPRVDYGVD
FT                   TAPSPAPPSGPAHLPVVPGPRADWFAANEWDRLTSTDWTASSRSNRIGLRLEGPGIERL
FT                   DAGELASEGMVRGAVQVPPSGEPIVFLADHPVTGGYPVIAYVTDEAVDLAAQVQPGQVV
FT                   RFRG"
FT   gene            complement(41776..42387)
FT                   /locus_tag="Ksed_00390"
FT   CDS_pept        complement(41776..42387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00390"
FT                   /product="allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; TIGRFAM:
FT                   conserved hypothetical protein TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05136"
FT                   /db_xref="GOA:C7NIG5"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG5"
FT                   /protein_id="ACV05136.1"
FT                   /translation="MRLLPSGTRAVLVELDDLTEARAWHAALEADPPAGTLDLVPAART
FT                   VMVVSEPGTDLAAVRSHLERVQVTGAPPASDEVVRIPVVYDGEDLADVAELLGVDTEEV
FT                   MRRHGAEEWAVAFAGYAPGFGYCAGTRFDWDVPRRSEPRTAVPAGSVALAGEFTGVYPR
FT                   KGPGGWQLIGHTAEQMFDPHREPAALLRPGVRIVFEAVDA"
FT   gene            complement(42387..43145)
FT                   /locus_tag="Ksed_00400"
FT   CDS_pept        complement(42387..43145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00400"
FT                   /product="uncharacterized lactam utilization protein B-like
FT                   protein"
FT                   /note="PFAM: LamB/YcsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05137"
FT                   /db_xref="GOA:C7NIG6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG6"
FT                   /protein_id="ACV05137.1"
FT                   /translation="MSTIDLNADLGEGLGMWRMGDDDALLGVVTSANVATGFHAGDPLI
FT                   MRTTCEKAASEGVTVGAHVAYRDLHGFGRRAMDIAPDELTADVLYQVSALEGIARAAGT
FT                   EVGYCKPHGGLYNTIAKDPAQARATAEALAAFRPGLAVLGLPGTPWQEAAEAAGLRFVA
FT                   EAFADRAYTPEGQLVSRREPGAVLHDPVAITERCVAMATGHPIEDVEGNPLRLTPSSIC
FT                   VHGDTPGAVEIARAVRQGLEDAGATLRSFA"
FT   gene            complement(43156..44436)
FT                   /locus_tag="Ksed_00410"
FT   CDS_pept        complement(43156..44436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00410"
FT                   /product="Mn2+/Fe2_transporter, NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05138"
FT                   /db_xref="GOA:C7NIG7"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG7"
FT                   /protein_id="ACV05138.1"
FT                   /translation="MSTSAQTDALPPGEPGPRDGGPTGTGASPGHRASRAALLGAMFLM
FT                   ATSSIGPGFITQTTQFTVQLGAAFAFAILVSIVLDIALQLNVWRVIGVSGRRAQELAND
FT                   VAPGLGWVLAGLLLVGGVVFNIGNVAGAGIGTEALAGIDPRWGAALSAVLAIGIFLSRW
FT                   AGWAMDRVVVVLGALMLALTLYVAIVSDPPLASAARNTIAPEIIEPLAITTLVGGTIGG
FT                   YIIYAGAHRLIDAGHTGPDQVAAISRTSVLAIIVTGVMRTLLFLAILGVVVSGADLTGT
FT                   SQAASAFQAAAGDVGLRLFGAVFWAAAISSVVGCSYTTVSFLTSSTRTPARTRNLLTGG
FT                   FIGLSLVLFLVLGKAPTTLLVFAGAFNGILLPVGIGVMLYVGWFRRDLLHGYDYPKWLL
FT                   VIGSIAWLLTLYLAVTSVRPLIDLMTS"
FT   gene            complement(44512..45981)
FT                   /locus_tag="Ksed_00420"
FT   CDS_pept        complement(44512..45981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00420"
FT                   /product="gamma-aminobutyrate permease-like transporter"
FT                   /note="PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05139"
FT                   /db_xref="GOA:C7NIG8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG8"
FT                   /protein_id="ACV05139.1"
FT                   /translation="MSTAPSTPAADASAAESPDSPLARGLSTRHIRFIALGTAIGTGLF
FT                   LGSASAIQLAGPAVLLAYLAAGAAIYVVMRAMAEMVLRTPDASSFVDFTQRYLGRTWGF
FT                   VIGWIFTAEMLLVGIADVTALRIYLGSWWPAVPGWAWMVGTIALVLGLNLVAVRLFGET
FT                   EFWLTLLKVGAIVAMVVLGVGLLVTGAGLPTGQPSVAHLWEHGGFAPHGAWGILLSLTV
FT                   VVFAFGGIETVGLTAAESQNPHRSIPDAINTVPWRILLFYVGSVGVMLTLAPWTGITGE
FT                   QSPFVQIIDAVGLPAAAHVLNAVVIIAAFSALNAITFAIGRTLFGLAAAGHAPAVFGRV
FT                   SGRGIPGAAIVTVGVALVIGLVLNLVVPDRVFTFVASLASFATVFVWLLILAAHHGLRR
FT                   RIARGALRPGAFATPGWPWVTALAAAFLVLVLVMMAFLPEGRAALAVGVVTTALLAGLG
FT                   HLSAHRPDGSSEGPPEGGRSRKGHDHPEPVS"
FT   gene            46075..46758
FT                   /locus_tag="Ksed_00430"
FT   CDS_pept        46075..46758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00430"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: FCD domain; Bacterial regulatory proteins,
FT                   gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05140"
FT                   /db_xref="GOA:C7NIG9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIG9"
FT                   /protein_id="ACV05140.1"
FT                   /translation="MHNVTVTTELGGQRCARTVRGLITAGRLGPGEQLVEQSLVEVCGV
FT                   SRNTLREGYRILADEGLVVHVPHRGVFVSSPGVAEVRDVYTARRVVECGALRERAGAGL
FT                   AVGGGPAAGGDPAVVVLEQLVGRAREAAADGRWSEVGDLNMAVHQQWVDLAGSRWLSAA
FT                   AKGLLAHARLAFRTLADPGGLHSAFVEENARVVGHVAAGEFGAAADLLEGYLHRAEGLV
FT                   VDAMR"
FT   gene            46892..48805
FT                   /locus_tag="Ksed_00440"
FT   CDS_pept        46892..48805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00440"
FT                   /product="putative hydrolase, CocE/NonD family"
FT                   /note="PFAM: X-Pro dipeptidyl-peptidase C-terminal
FT                   non-catalytic domain; X-Pro dipeptidyl-peptidase (S15
FT                   family); TIGRFAM: putative hydrolase, CocE/NonD family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05141"
FT                   /db_xref="GOA:C7NIH0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH0"
FT                   /protein_id="ACV05141.1"
FT                   /translation="MLVVPTATAAPSDAPTTASRAATATAAEKEGITHEQNPQVPEGAV
FT                   WTQEYFPSSLPSNNGDEVELHADVLRPAHLPADARTPVILSVGPYFSHIGQTGDDGHPV
FT                   AGPSQRFTDLIEGADLMAQGYTVVMVDLRGFGGSTGCLDWVGPGEQADVASAVEWAAGQ
FT                   PWSTGKVGMYGKSYDASTGLVGNNLEPEGLEAVVAQEPVWDMHNYLYSNGVPRPNNVFT
FT                   PRAYNSIATLPAHAGDDERYRANADYEKAHPECTAQNSADGLIADPESEYWKARDLATQ
FT                   AEGSDVPLFVTQGFIETNTKPEDMRKYLDNHSGEQRGWLGQWNHVRGNDRTEDGRLEMG
FT                   REGWFTEVISFYDEHLKDTEPVQDFPAYVIEDSNGAWRAQDAWPLVNSTRTVDLEDGSF
FT                   VDDRAGEPGAARGAVADGADGVTLAAGAAPRIEAADGAAKGRGPVGDMERGASLQPQKG
FT                   PVAPEVRQRKGKGGPGTTEDAYGYVTWSKPVKRDVRVTGTPRVAFEAEGQGGVAVQLFD
FT                   VAPDGTAVRFDEQVVAVDGGQHEIALKDTEWTLEAGHQLAVRIGTIGADEYWSHEPSMD
FT                   TVEVSDAELTLELQNTRWDEPTHGAVSPFLATWERAYTEKWDAKAPGTFQVKASQGKPK
FT                   HS"
FT   gene            complement(48857..49096)
FT                   /locus_tag="Ksed_00450"
FT   CDS_pept        complement(48857..49096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05142"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH1"
FT                   /protein_id="ACV05142.1"
FT                   /translation="MSVLCGTIASMSSTTVRTHPRARFVALGDSFSSGAGLATADDLGR
FT                   APTAFPELVARTLEGLHRDHLAARGGCRVQPVRP"
FT   gene            complement(49221..50918)
FT                   /locus_tag="Ksed_00460"
FT   CDS_pept        complement(49221..50918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00460"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05143"
FT                   /db_xref="GOA:C7NIH2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH2"
FT                   /protein_id="ACV05143.1"
FT                   /translation="MRRESFGTGQVSPSGGRGAAGRSADALERAERDLGHAVTAVEAVR
FT                   AAEVALLDAVAGVYEHTAAHLEQRREEGEPGVWEVADAPAIVADEVTAATGELPTQVRS
FT                   VVDLAASDPQRMACGRAALVEGRASLSRVLSWHTGTRHLQVADAVAIGEVVLTRAADGS
FT                   PRSAASFRELLRRRVRKVEAADRQAARARMAEALAGRGSWTRPGEEGTGALTVVGEATR
FT                   VAAAWGRLDAAARRAKAAGDQRTLAQLRSDLHLDLLLVGHLPGTCPGTASTSASAGSDH
FT                   ATPGSRTDAGPAGSGFCTQPILPTQTTQNPTGAEAPAPPVCTACGTVSSDWWPLPQIGD
FT                   PVLPPARCTVVVGLDVLLENATDADRDPPDSGSGTSDPPPDGSAGTGPPAHTPSDTPSD
FT                   ALAEQAPARGGGDDLRGGGGGLRGAALGWMPGFGYLGPEHVRAVATREGSVWQRLVADP
FT                   VTGHAVAVSPHTYRPTASVARFVRARDGVARDPGSGTPADQCELDHVVPFEAGGATTPD
FT                   NLQCLSRRGHARKTRRHWEAVMAPDGSVEWTSLLGQRQTTHPHDYTDQ"
FT   gene            complement(51114..51482)
FT                   /locus_tag="Ksed_00470"
FT   CDS_pept        complement(51114..51482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00470"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05144"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH3"
FT                   /protein_id="ACV05144.1"
FT                   /translation="MEETFDRARSGDVTRLGELLAMGVPVNLTNGRGDTLLMLATYHGH
FT                   TAAVELLLGLRADTARVNDAGQTPVAAAVFRQRGDLVRALVGAGADPGHGPKNAWVIAE
FT                   YFGLEEMTALLRELSEGT"
FT   gene            complement(51539..53608)
FT                   /locus_tag="Ksed_00480"
FT   CDS_pept        complement(51539..53608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00480"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase-related immune-responsive; Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05145"
FT                   /db_xref="GOA:C7NIH4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH4"
FT                   /protein_id="ACV05145.1"
FT                   /translation="METNRGQFQSGEHLTNDHGARIPDTDHTLKAGRRGPALIQDQHFR
FT                   EKITHFDHERIPERAVHARGVGAHGTFRSNGAAAGITSAGFLQAGAETPVFTRFSTVLG
FT                   SRGSADTPRDTRGFAVKFYTEQGNYDLVGNNIPVFFIQDAIKFPDVVHAAKPEPDTEIP
FT                   QAQSAHDTFWDFVSTHTEAQHHTIWNMSDRGIPQSLRTMEGFGVHTFRLINAEGETTLV
FT                   KFHWKPRAGVHSTLWPEAQKIMGADPDYQRKDLYTAIDSGTPPEWDLGVQVFPDTDSEM
FT                   FEGIDLLDPTKLVPEELAPVQVIGTMTLDRNVDNFFAETEQVAFCPSHLVPGIDHTNDP
FT                   LLQGRLFSYLDTQISRLGGPNFTQLPINRAQQSEVNTHHRDGMHQMTVHEGKVAYAPQG
FT                   LVDPAEVPWHPGQKNSPGADKSVDDVPGVLIEVPVAVDGGKERENPGTSFDDHFTQTRM
FT                   FYRSLTAVEQAHVADAYSFELGMCTKPHVVDRQLGHLATIDSGLAATVAGNLGRPVPEA
FT                   DSSVTVEEMDPSPALAQVGGTWPVDNRVVGLFVCGECDLDAVTAAKKAVEDAGMVPQLV
FT                   APAGGPLGGREDLMVDVTAINAASIMFDAILVADHPEDLPRNLAAVVGEAWHHGKAVGG
FT                   WGDGAGFVAHAVPSVDAGVVQADAPDQAVSTVVELLSKHRVWDRLLQAPEKDLP"
FT   gene            complement(53665..54459)
FT                   /locus_tag="Ksed_00490"
FT   CDS_pept        complement(53665..54459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05146"
FT                   /db_xref="GOA:C7NIH5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH5"
FT                   /protein_id="ACV05146.1"
FT                   /translation="MSTSPRPSLRVARALAASCHPLPTVMVTGLGTALAVAAAREVRRG
FT                   AGATLPASGPAVGVARGARLTAWSVAVGSGQLVIGWVNDALDAERDARVGRTDKPVAAG
FT                   AVSVPTVWGAAGCAALMSALAGRWTGWGLAASQLGLVVVPGVAHSLGVKRTVLSPVPWA
FT                   VAFGALPVLAHRAGGGGGLPARPAVAGAALGAAAHLVNAARDVEDDALTGQEGLPARLG
FT                   VAASHGVAAGLVGVAAASVRGPMRWFVGAAAGAVALVGVRAG"
FT   gene            54493..55614
FT                   /locus_tag="Ksed_00500"
FT   CDS_pept        54493..55614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00500"
FT                   /product="predicted naringenin-chalcone synthase"
FT                   /note="PFAM: Chalcone and stilbene synthases, C-terminal
FT                   domain; Chalcone and stilbene synthases, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05147"
FT                   /db_xref="GOA:C7NIH6"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR013601"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH6"
FT                   /protein_id="ACV05147.1"
FT                   /translation="MPAPSRLLAVHVVPGGHSAPQSEVTDAVAGLLGGSAGEERVLRRI
FT                   HANAGVDTRSLVLPLEAYGALDGFGTANDAWLEHAPRLAVEAVNGALAQAGVDAAEVDV
FT                   VVSTTVTGIAVPSLEARIAVEVGFREDVVRVPLFGLGCVAGAAGIARVHDLLAGRPDGV
FT                   AVLLAVELCSLTVQQGDASRANMVASGLFGDGAAAVVLAGPERRAAAPVPAPSSPALSS
FT                   RAPHLTVVASRSRLYPDTHRAMGWDVGDGGLGIVLGAEVPDLVTQNVGADVRAFLADHG
FT                   LAPQDIAFHVAHPGGPKVLEAMQGALGVPREALGLTWDSLAEVGNLSSVSVLHVLGKTL
FT                   AERPPDPGQYGLLLAMGPGFCAELVLLRCEEAA"
FT   gene            55611..56138
FT                   /locus_tag="Ksed_00510"
FT   CDS_pept        55611..56138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00510"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05148"
FT                   /db_xref="GOA:C7NIH7"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH7"
FT                   /protein_id="ACV05148.1"
FT                   /translation="MSRLRGRRVHPAFAAVLGAVAVERVVELVVARRHGAWARERGGVE
FT                   HGAGHYPVMVALHSGLLAGALLEHRLVAGRFHPGPALVVGASQALRWWCIRSLGPYWNT
FT                   RVVVVPGHELVASGPYRWLPHPNYLAVVAEGAALPLAGGARWTAGVFTLANAVLLRHRI
FT                   AVEEAALASVTP"
FT   gene            56135..57226
FT                   /locus_tag="Ksed_00520"
FT   CDS_pept        56135..57226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00520"
FT                   /product="flavin-dependent dehydrogenase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05149"
FT                   /db_xref="GOA:C7NIH8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH8"
FT                   /protein_id="ACV05149.1"
FT                   /translation="MSPAGAAGAAGADLLVVGGGPAGLATALVAHRVGMSVHVLDRRPG
FT                   VVDKACGEGLMPGGLERLQALGVDPPGHVLTGIDYVTPAGRRAQASFASPGRGVRRTVL
FT                   HAAMRAAAQDAGLTIAHRRLDVTRELDVRADHVLLDGARYRWVVGADGLHSGVRELVAA
FT                   PARRPAGAVPARVLPRRYGLRAHLRTAPWTSQVQVRFGDGVEAYLTPVADDLLGVALLS
FT                   ARRATFADHLSRLGEFGRHLAAHPASDWGPVAGAGPLWQAVPRRVAGPVLLVGDAAGYV
FT                   DALTGEGVSLALAQAPALVDCLVAGDAPAWERRWARMTAAHRIATATLVGAVSRRPTRS
FT                   ALLGASTTWPGLFQRVVRSLADA"
FT   gene            complement(57313..57837)
FT                   /locus_tag="Ksed_00530"
FT   CDS_pept        complement(57313..57837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05150"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIH9"
FT                   /protein_id="ACV05150.1"
FT                   /translation="MDHTVLTDAEQDLWTTYLNDHATGATGALERLEMMAEEYTDLPHH
FT                   DDLQTLTGQITQERERLLELISQLGAERSGLKTALAAAGEKVGRLKPNQHLGSRSPLSP
FT                   LLEVELLRSGVVGKLSLWETLTLHADRLGLDRAEFEELTAAAARQAETLGTIHATWAAS
FT                   AFPAEAADQSD"
FT   gene            58044..58379
FT                   /locus_tag="Ksed_00540"
FT   CDS_pept        58044..58379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05151"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII0"
FT                   /protein_id="ACV05151.1"
FT                   /translation="MLTGIAGYFPAAATGAHDWSRTDGPATRVGLAHAGLNAVGLALHL
FT                   GSLAARRAGNRPLGLALSAAGLGAVGVGGYLGGHLAYVNAVGVRGTSERHPARELRPRP
FT                   TTVRGHV"
FT   gene            58469..59626
FT                   /locus_tag="Ksed_00550"
FT   CDS_pept        58469..59626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00550"
FT                   /product="predicted transporter component"
FT                   /note="PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05152"
FT                   /db_xref="GOA:C7NII1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII1"
FT                   /protein_id="ACV05152.1"
FT                   /translation="MILTGLVTGALLGFVLQRGRFCITGAFRDVWLSGSTRWLTAFGVV
FT                   IALHAIGYTALSALGVVNAPVDPLPLGAAVVGGLIFGVGIIAAGGCATGTYYRAGEGLV
FT                   GSWFALIFYALSAGAMKYGPLAGFTTWSRDQTVGATTIDASLGLPAWVVVGVLSVGVGL
FT                   AVRHHLRADAARPRTAGLPARRSGVAHLLTEKRWHPFATAAVVAGIALAAWPLSTAAGR
FT                   VGSLGITTPSAKLGNYLTTGDLTMVDWSVMLVLGILAGSLVAALASGEFRVRVPDSTTT
FT                   LRAIGGGVLMGVGASLAGGCTVGHGMVATAQLSWEGWIATGAMLLGAGLGVRWFIRTRD
FT                   GREAVAGSSPRPTLTPVDTAEGAGADAEPAPQRTRPAPVLTKVGD"
FT   gene            59684..59914
FT                   /locus_tag="Ksed_00560"
FT   CDS_pept        59684..59914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00560"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /note="PFAM: SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05153"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII2"
FT                   /protein_id="ACV05153.1"
FT                   /translation="MSTYTLDTAGDVCPFPLVDARAAMEQLAPGDELRIDFDCTQATES
FT                   LPQWAAEDGHEVTHFDRTGDASWSITVRKAA"
FT   gene            complement(60008..61147)
FT                   /locus_tag="Ksed_00570"
FT   CDS_pept        complement(60008..61147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00570"
FT                   /product="carbohydrate ABC transporter ATP-binding protein"
FT                   /note="PFAM: TOBE domain; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05154"
FT                   /db_xref="GOA:C7NII3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII3"
FT                   /protein_id="ACV05154.1"
FT                   /translation="MATVTYDAVSCVYPGQTRPAVDKLDLEIADGEFLVLVGPSGCGKS
FT                   TTLRMLAGLEQVSEGSIRIGETDVTGVAPRDRDIAMVFQNYALYPHMSVRDNMGFALKI
FT                   AGVPTAERNQRVEEAAELLDLTPYLDRKPKALSGGQRQRVAMGRAIVRSPKVFLMDEPL
FT                   SNLDAKLRVQTRTQIASLTRELGVTTVYVTHDQVEAMTMGDRVAVLKDGLLMQVDTPRA
FT                   LYDRPRNVFVAGFIGSPSMNLVHAPVEGGAVRFGASTFQLTSEQQAALTGSGVVVGIRP
FT                   EDMTLGQQGEGAQVRINLVEELGADAYVYGRLADESGTLETVVTEKADDDEDASSDTIV
FT                   MRADGRTPPRAGETVWMVPKVEHVHLFDAATGDRLPDAG"
FT   gene            61272..61682
FT                   /locus_tag="Ksed_00580"
FT   CDS_pept        61272..61682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05155"
FT                   /db_xref="GOA:C7NII4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII4"
FT                   /protein_id="ACV05155.1"
FT                   /translation="MSQGPQFNPSSQPGPGATSWGAGSGPVPPAPGGYPGDGYRRLREQ
FT                   HPEAVAVFVLGLVSVLMLWPLGFLAWIMGNKAMRDVRDRPGVYENENLIVAGRILGIVA
FT                   AVLTILFAVFFVGMMVLGLTVPLLVATGIGAA"
FT   gene            complement(61757..63028)
FT                   /locus_tag="Ksed_00590"
FT   CDS_pept        complement(61757..63028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00590"
FT                   /product="Mn2+/Fe2_transporter, NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05156"
FT                   /db_xref="GOA:C7NII5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII5"
FT                   /protein_id="ACV05156.1"
FT                   /translation="MATATHPPVQEQSSWKSRLSALGPGLLMASAAIGGSHLVSSTQAG
FT                   ALYQWQLVGLVLFALLMKYPFFRFGAQYTAETGESLVQGYARKGRVTLWVFFVFCAVSS
FT                   VISAAGVGILCAVILKFALPTSWGLSVPWVAALMMASVWLILLAGRFPVLDKLTKLIIT
FT                   ILTVVTVVTVIVAASKGAQGAADAVAPSPWTLVALPFLVALIGWMPAPIEISALQSLWI
FT                   AEKQRFRPANARDVIFDFNVGYVISAILAVFFIALGALVQFGTGTQIQSAGGAYIPQLI
FT                   TMYTNTMGEWARPLMALLAFVVMYGTTIAVVDGYGRACAESMHLIRRGEGGAGRQAVMV
FT                   WSTGIALVALGIIVWFSAQMGELLRFAMVAAFIMAPIFAWLNFQLVRRQDHLSNTLRIL
FT                   AWVGLAFLGGFTLLFLAAELGLIG"
FT   gene            complement(63102..64601)
FT                   /locus_tag="Ksed_00600"
FT   CDS_pept        complement(63102..64601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00600"
FT                   /product="MFS transporter, sugar porter family"
FT                   /note="PFAM: Sugar (and other) transporter; TIGRFAM: MFS
FT                   transporter, sugar porter (SP) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05157"
FT                   /db_xref="GOA:C7NII6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII6"
FT                   /protein_id="ACV05157.1"
FT                   /translation="MSTAAHAADGARDGNPTGNEPAEKDALTGKVVMLSMVAALGGFLF
FT                   GFDSSVINGGVNAIQEEFGLSDVLIGFVVSCALLGAMVGAWFAGTFADKVGRTRAMVVA
FT                   SVLFTASAIGSALCFGPWDLIFWRFVGGAGVGMASVLAPAYIAEISPAAVRGRLGSLQQ
FT                   LAIVIGIFIALLVDAYLADAAGGAAEVLWMDREAWRWMFASELVPAVLYGALALSIPES
FT                   PRYLVNTGDLKKAGEVLRDVVGIRGKGAAQRKIEEIRRSLYRERKQSLADLKGAAAGLK
FT                   PIVWAGILLSVFQQFVGINVIFYYGSTLWQAVGFEESQSLMINVITSITNIVVTIVAIL
FT                   LVDKIGRRRLLLWGSAGMALSLGTMAVAFSQAVTEGSGPDQSVSLPEPWGVIALVAANA
FT                   FVVSFGATWGPMVWVLLGEMFPNSIRGMALGVAAAAQWLANFVITTTFPWLASTSLVLA
FT                   YGLYAAFAALSFLFVFKVIEETKGKELEEMGEETPVTQPAT"
FT   gene            complement(64672..68484)
FT                   /locus_tag="Ksed_00610"
FT   CDS_pept        complement(64672..68484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00610"
FT                   /product="predicted nuclease (RecB family)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05158"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII7"
FT                   /protein_id="ACV05158.1"
FT                   /translation="MFLLDDGSLATSAQDLRVASECEFALLHRLDVTLGRSPREVLEDP
FT                   MAERLAELGNVHEERELARLQQLHPGGVVVGERPRGFSRQALEEGMAWTVQRCAEPAVQ
FT                   VVHQAPVLLTGAGADGQPLAPLSGLADFVVRTPQGWRVGDTKLAAHSTVASMLQVAAYA
FT                   HALAEQGVAVAPEVDLVLGTGAVESHPLGPTVAVMRDRWARLSRLLREHGVGGRDGEAV
FT                   EWGAPGIGACGRCEVCTPRAAAADDLLGVARMSLARRKLLHGRGITTMAELAAATTGPR
FT                   GMRESDFATLRDQAALQVRARELTAEARTQDPHAPEVVLSEVVSAEALDALPEPSPGDV
FT                   FFDFEGDPLWRPHAGAPAGLEYLFGVEVLDTAGDDPGAYGPPDAAGARYRAWWAHDRAG
FT                   EKQALADFLGWLAARRRAYPGLHVYHYAAYEVTALKRLTAAHGTGTEELDDLLRQHVFV
FT                   DLYATVRAGIRVSQPTYSIKKLEPLYMPARGADGVTGGADSIVEYQRYCSARDAGDTAR
FT                   ASELLERIRAYNELDCESTWRLRDWLLERYRQHRQEQGQPDTPQPDTGTDAPSGVDGTA
FT                   APTGTDDTAARGDGTLPGTDAPALTPDRWVAAQRVEDAFGALDLPPRGERTAAEQALTM
FT                   LGSAPQYYRREHKPHWWAHFERLALPVAEWPLTGDVLAVDRAEWTSDWYQPTPRSNPRR
FT                   TLTARVDTGGRPLAAGTSLVPVFGSPLPDGLECEPGYPHAQWPSAAEVLDSHSDTATGL
FT                   EVCTLELARPKGSANRPGIPETDCLPVGFGPTAPPGTKNLDAALLDLAAAALSASATSA
FT                   ATPGEPAAQPVLPASAGLDLLARRPPRLDGEAPASIDDAPPAPTLLPQVGEPGIDTPLD
FT                   AVTAAVGLLQNSYLAVQGPPGTGKTYLGSRVVRSLVQAGWRIGVVAQSHAAVENFLAGC
FT                   VRAGVPDVRVGKAPAAGRPADGATCWTSLRSGSTPAWITEQLDAGHGFVVGGTAWTFSH
FT                   PDLLPECLDLLVVDEAGQFSLAPLLACSRVARNLLLLGDPQQLPQVSQGIHPEPLDASA
FT                   LGWLIGSERVLPQRYGYFLDTTWRMHPALTERVSTLAYDGRLGSHDEVTTGRSVEGVEP
FT                   GLHVRVVEHEDNSVASPEEADAVVALVADLVGRRFTDTGAEPGRRERPLSAADVLVVAP
FT                   YNAQVNLLRNRLSQAGFPDTPVGTVDAFQGQEAPVVVLSMTASARDRVSRGMAFLFDVH
FT                   RLNVAISRGQVAAYVVRSRALTDIAPASPRDLLALGAFLELTANP"
FT   gene            complement(68558..70387)
FT                   /locus_tag="Ksed_00620"
FT   CDS_pept        complement(68558..70387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00620"
FT                   /product="malic enzyme"
FT                   /note="PFAM: Malic enzyme, NAD binding domain; Malic
FT                   enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05159"
FT                   /db_xref="GOA:C7NII8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII8"
FT                   /protein_id="ACV05159.1"
FT                   /translation="MPRQFQFRNEDGHETVQIAVRGRQVLARPMLNRGSAFTTEQRDAL
FT                   GLRGLIPPAVNSIDDQVRRCYGQFQMQPTNLAKYVYLNTLQDLNEILFHRLVAEHLEEM
FT                   MPIIYTPTVGEAIQQFSSTFDRQRGIYLSIEDGADAESIATALAAYGNGPDDVDIVVVT
FT                   DSEGILGIGDQGVGGIRIAIGKSAVYTTAAGIHPLRVLPVVLDVGTDNLALLHDPNYLG
FT                   LRRERVRGEEYDEFIASFVEAVQERFPTALLHWEDFGATNAHQILERYRDQVCTFNDDI
FT                   QGTAAIVVASALAACKTKHEQLSEQRVVIHGAGTAGIGIADLMRDIMISEGLDPDEATQ
FT                   RFWGLGSRGLIHTGGKMRPFQERYARDAAELAEWEADEAGNYSLDEVVRRVQPTILIGT
FT                   SAQAGAFHEQLVRTMAEGCERPIILPLSNPTSKAEAVPEDLMEWTDGKALIATGSPFKP
FT                   VVRDEVTHTIAQANNALVFPGMGLGTIAVRATRLTDGMITAAAQAVAEMTAVGVEGAAI
FT                   LPSMRELRSVSAAVAERVAAAAVEEGVATLELENPRAEIEKLMWAPEYPDVEVVDAIET
FT                   LSPRATDPARKSVRHTGDDSPLSRWRPRLPGRR"
FT   gene            70536..70874
FT                   /locus_tag="Ksed_00630"
FT   CDS_pept        70536..70874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00630"
FT                   /product="SH3 domain-containing protein"
FT                   /note="PFAM: SH3 domain; Variant SH3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05160"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C7NII9"
FT                   /protein_id="ACV05160.1"
FT                   /translation="MRYVLTADHEIPDRAPLAIKPGDVVQVGDWDTEWPAFVFVTASQG
FT                   TGWVPGRHLDIDGCVGTCRVAYDTTELPAVAGERVDVIEDDAESGWSWCRNSGGREGWI
FT                   PHRVLTVA"
FT   gene            complement(70879..71289)
FT                   /locus_tag="Ksed_00640"
FT   CDS_pept        complement(70879..71289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00640"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase DDE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ0"
FT                   /protein_id="ACV05161.1"
FT                   /translation="MIVTGGQRNDGAMLTEVLAQIHVPRLGRGRPRTRPDAVLADRAYA
FT                   TGVIRSELRRRGIKAVIPDKRDQAAARKRRGSRGGRPPGLDADAYKGRNVVERFFALAK
FT                   QWRGIATRFDKLAITYRAGVTLCAILTWLRVR"
FT   gene            71456..71599
FT                   /locus_tag="Ksed_00650"
FT   CDS_pept        71456..71599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05162"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ1"
FT                   /protein_id="ACV05162.1"
FT                   /translation="MLMRTSDRRVDRHRPVDLPGGIGLGEDLHQHAMRNDQNLWMALGG
FT                   VT"
FT   gene            71691..72971
FT                   /locus_tag="Ksed_00660"
FT   CDS_pept        71691..72971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00660"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05163"
FT                   /db_xref="GOA:C7NIJ2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ2"
FT                   /protein_id="ACV05163.1"
FT                   /translation="MLKVVHDAETSNDDSTDGTGTAGGSLLDEIVRDGARQMLAAALQA
FT                   EVGAYIEAHAHEVDEDGHRLVVRNGYHQPREVTTSSGAVPVTAPRINDKRVDEATGERA
FT                   RFASAILPAWARKSPQVTEVLPLLYLHGLSSNDFAPALEQFLGSSAGLSAATITRLTKD
FT                   WQHEARSFNERSLTDADYVYVWVDGIHLKVRLEQDRVCLLVMIGVRADGHKELIALQDG
FT                   HRESTESWADLLRDCKRRGMRDPVLAVGDGALGFWAAVRQVFPDTREQRCLFHKISNVL
FT                   NALPKSAQPGAKKALAEIWQAEDKEHARSGARAFASEYGKKWPKAAAKITDDLDVLLEF
FT                   YDYPAEHWIHLRTTNPIESTFATVRLRQRVTKGPGSRAAGVAMAFKLIESAQTRWRAVN
FT                   APHLVALVRAGAVFEKGKLIERTQGAA"
FT   gene            72968..73372
FT                   /locus_tag="Ksed_00670"
FT   CDS_pept        72968..73372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05164"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ3"
FT                   /protein_id="ACV05164.1"
FT                   /translation="MTTPPIGSLHHVELWVPDIVRATTHWGWLLGELGYQPFQDWPGGR
FT                   SWRLADTYIVIEESPDLTGREHDRQRPGLNHLAFHAGDRAKVDEFADTAHANGWTLLFA
FT                   DKHPHAGGADSYAAYLANYDGYEVELIAHD"
FT   gene            complement(73394..73657)
FT                   /pseudo
FT                   /locus_tag="Ksed_00680"
FT   gene            73718..74986
FT                   /locus_tag="Ksed_00690"
FT   CDS_pept        73718..74986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00690"
FT                   /product="flavodoxin reductase family protein"
FT                   /note="PFAM: Globin; Oxidoreductase FAD-binding domain;
FT                   Oxidoreductase NAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05165"
FT                   /db_xref="GOA:C7NIJ4"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ4"
FT                   /protein_id="ACV05165.1"
FT                   /translation="MKTPTLSPQSAEIVAATAGVVAEHAVQITSEFYPNMFAAHPELMR
FT                   VFNKANQAVGEQPVALASSVVAYAVQLIDPEAPDFSPVMERIAHKHVSLGIQGTDYITV
FT                   GHYLLEAVGTVLGDAVTPEVASAWDEVYWLFATQLIAEEARLYALAGVDPEEPYRKYEI
FT                   TERTEETDEVFSITLKPVEGEVPEHHTGQYVALAVDLPDGERQPRQYTISSPRVADHIR
FT                   LTIRRVDGVGGTPNGQVSTFLYENAKPGMVLDVSTPSGDVVLDESDAPLVLVSAGIGIT
FT                   PMAAILADVAADAPQREVVLLHADRAGGSHALAEEMAAAAEKLANGSSRVWYEQMDEQG
FT                   TARGASEGRMDLSGIELPTDARVFMCGPLPFMRAVRRELMDKGVPACNISYEVFGPDLW
FT                   AQDPESGAEKEVVARIEEAQQGA"
FT   gene            75123..75733
FT                   /pseudo
FT                   /locus_tag="Ksed_00700"
FT   gene            complement(75743..76267)
FT                   /locus_tag="Ksed_00710"
FT   CDS_pept        complement(75743..76267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05166"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ5"
FT                   /protein_id="ACV05166.1"
FT                   /translation="MAPRSGFATTLMALAEASADRPPASPPVIAIHHDGEHLELVRPGE
FT                   PAVRLRCTPDREAAQEEIRAQLGWTWAGTDLAALGDVAPWSHGLGWEVYLHDIGRYWFL
FT                   VEDLREERGEAVRAEALWQDGDRFCVRLRSSHGTTTESRPLNGLDFTGALGLEMAFDHL
FT                   RQVRRPGAEHA"
FT   gene            complement(77048..77671)
FT                   /locus_tag="Ksed_00720"
FT   CDS_pept        complement(77048..77671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00720"
FT                   /product="Protein of unknown function (DUF1648)"
FT                   /note="PFAM: Protein of unknown function (DUF1648)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05167"
FT                   /db_xref="GOA:C7NIJ6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ6"
FT                   /protein_id="ACV05167.1"
FT                   /translation="METTENDRPQSTPPAQTWQELEAQRRAVAQEARALPPEPDTLWVR
FT                   LVFWGVVALWLASLAWAWFALPERVPTHWSGDNQADTWSSRAGAIVPAALIPAVALLPM
FT                   PLLSRLATIWPDGLNVPHKEWWLQTAPRVRRFERLLREDLMLITASVLAIFPPLMFLMH
FT                   QAAQRDGVIPGWGMPLVLAIIIVPMVIVLARMAVGRRYKGAADL"
FT   gene            complement(77868..79457)
FT                   /locus_tag="Ksed_00730"
FT   CDS_pept        complement(77868..79457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00730"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05168"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ7"
FT                   /protein_id="ACV05168.1"
FT                   /translation="MQPDDPTPSPDPAEHPGGSQVPLDGDVPLETGDHPGLDPADLEAT
FT                   LRVLGQLHELPRGHPDIETVKRATGRMYKAVRKARRAEARRAERQPLLDADQRLMERTA
FT                   TGSPQRIDDETAGILLETPTGLAGAGHVIGQLNIPRGCYICHEKFTAVDSFYHWLCPRC
FT                   AGDSHARRDQHTDLRGKRALLTGGRAKIGMYIALMLLRDGAELTITTRFPGDAARRFAA
FT                   QPDHADWIDRLSIVGIDLRDPTQVIALADEVAAGGPLDILINNACQTVRRTPGSYSHLT
FT                   EGEKAPLVGDELRPAMLAFDRISEAHPAALVGSLSEHAVAHAEGGGGLTASDMTRLALR
FT                   AGSASLEAHQRGTALDAGGLLPDVLQVNSWTQKVQEVDPMELLEVQLCNSVAPFLLVSR
FT                   LRPSLAEAVRRGARRSYVVNVSAMEGQFSRRYKGSGHPHTNMAKAALNMLTRTSSEEML
FT                   QTDGILMTAVDTGWITDERPHHEKLRIAAEGWHAPLDLVDGAARVYDPIVRGEAGEDLY
FT                   GVFLKNFEPHPW"
FT   gene            79522..80244
FT                   /locus_tag="Ksed_00740"
FT   CDS_pept        79522..80244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00740"
FT                   /product="peptidase E"
FT                   /note="PFAM: Peptidase family S51"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05169"
FT                   /db_xref="GOA:C7NIJ8"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ8"
FT                   /protein_id="ACV05169.1"
FT                   /translation="MTLGGGGFSETGGKLTPLDHVLLGLAGRRLDAGARGRGERPAVCF
FT                   VPTASGDAAGYCEKFERAYGGVAETSVLTLFNQSPWGYRDPAMLLEQDLVFVGGGSPAN
FT                   LLALWRLHGLPEVLTEAGRRGTVLAGISAGMNCWFEGSSTDSYGPLAALPDGLGLLRGS
FT                   ACPHYDGEPGRPEQFRSAIGSGELPEGHAVDDHVALVWRDGELVEAVSETDGGRAFRVA
FT                   ADGAGGAVEAPLPVRRLG"
FT   gene            complement(80309..80659)
FT                   /locus_tag="Ksed_00750"
FT   CDS_pept        complement(80309..80659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05170"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIU5"
FT                   /protein_id="ACV05170.1"
FT                   /translation="MISTQIITNNGNTPVTVQDVSLPSSSGMAVHEWFLVGWNDSYPAA
FT                   WSSPDIPPKPERTTPGVEPGETKRVAVVLKVTSDQTEEAHLTIDYREESGRKGSLTPAR
FT                   RLHAVPHGQECP"
FT   gene            complement(81135..82472)
FT                   /locus_tag="Ksed_00760"
FT   CDS_pept        complement(81135..82472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00760"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; Pyridoxal-dependent decarboxylase,
FT                   C-terminal sheet domain; TIGRFAM: diaminopimelate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05171"
FT                   /db_xref="GOA:C7NIU6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIU6"
FT                   /protein_id="ACV05171.1"
FT                   /translation="MTETTPTSPDAGSLAARIHPAKPLPTSAERMVELAAELPTPFHLY
FT                   DEAAIRAHAREFNAAFAWAPGFLNHFAVKATPTPAIVRVLSEEGFGADCSSLPELELCD
FT                   RLGIRGERIMFTSNDTPAEEFARAVELGAVANLDDITHLDTLEAAAGRLPELLSFRYNP
FT                   GAERTGNAIIGDPVQAKYGVTSEQLLDAYREARDRGVQRFALHTMVASNELDGAYIVET
FT                   ARMVFELAVRLKDELGITLEFVNLGGGIGIPYGVDDAPMNLQAVSDGIRALHEQVLTPS
FT                   GLEGLGLRFECGRVMTGPYGYLVSRVRQVTQKYKTYVGLDASMHNLMRPAMYGSYHHIT
FT                   VLPGPDAASLPDAGDLAPGATSTYDVTGSLCENNDKFAIDRELPVVHPGDVVVLHDAGA
FT                   HGHSMGFNYNGKLRSAEYLLDQNGQAHQIRRAETMDDLFATVDWHA"
FT   gene            complement(82523..83797)
FT                   /locus_tag="Ksed_00770"
FT   CDS_pept        complement(82523..83797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00770"
FT                   /product="LL-diaminopimelate aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05172"
FT                   /db_xref="GOA:C7NIU7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIU7"
FT                   /protein_id="ACV05172.1"
FT                   /translation="MARINPTYRTLSAGYLFPEIARRVREFEQSHPVASVHRLGIGNTT
FT                   QPLTPTVVAGLHQRVVALSTAAGYSGYGDEQGESALREAIVAQYARRGVELDPSEVFVS
FT                   DGAKADAANLQGLFAPDSVVAVQNPAYPVYVDSTVVHGRTGEPDQATGAYAGIVLLEGS
FT                   PENDWLAEPPADGTTADVVYLCSPNNPTGAVATHEQLAAWVAWAREHDAVILFDAAYAD
FT                   YITDDSLPRSIYEVPGATECAIELTSLSKTAGFTGVRLGWSIVPRALRVADSEPGELNR
FT                   MWNRRQSTFFNGASNIAQSGAVAALSDAGRAESAELVAGYMANAATIRDALVSMGLEVT
FT                   GGDNAPYLWVRCPQGLGSWEFFDRLLEQAQVVVTPGVGFGSAGEGYVRFSAFGQAEDIE
FT                   AAVASLRNHADALLAPAPSAAPVAG"
FT   gene            complement(83869..84795)
FT                   /locus_tag="Ksed_00780"
FT   CDS_pept        complement(83869..84795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00780"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: Dihydrodipicolinate synthetase family;
FT                   TIGRFAM: dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05173"
FT                   /db_xref="GOA:C7NIU8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIU8"
FT                   /protein_id="ACV05173.1"
FT                   /translation="MTRPTPTLDLRGVHTALVTPFAEDGSVDTTALGALVDAQVEAGIS
FT                   GLVPCGTTGESPTLSHHEHDGVIAFTVRRVAGRVPVIAGTGSNSTEEAVQLSRHAEMAG
FT                   ADAILTVNPYYNKPTQKGLYLHFKAVADAVSLPVVLYNIAGRSAVNLETATLVRLAQDC
FT                   PNIVAVKEASGSLDQMKDVLARAPEGFTVLAGDDNLAVDLIGLGGHGVISVASNLLPGA
FT                   MGRMVRTALEGDLGTARTLEAQLSAFFAACFSETNPIPIKTALAEYGWCRESFRLPLCT
FT                   LEDEGHREQLLRALEAVDCPRGALLPA"
FT   gene            complement(84792..85601)
FT                   /locus_tag="Ksed_00790"
FT   CDS_pept        complement(84792..85601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00790"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: Dihydrodipicolinate reductase, C-terminus;
FT                   Dihydrodipicolinate reductase, N-terminus; TIGRFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05174"
FT                   /db_xref="GOA:C7NIU9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIU9"
FT                   /protein_id="ACV05174.1"
FT                   /translation="MDSTPRPDRPPLAVGLVGYGRMGRTLHRLAAAAGAEVTCIVSPHA
FT                   PEATHRRLDAVTPPEAPSVWIDFSHPDAAWPHLEAYARGTVPAVIGTTGWADRLPEATA
FT                   LFERATVPAVWAGNFSLGVTLFLRIVQQAAALVGQAGGYDAGIHEVHHRAKADSPSGTA
FT                   LHVAEALRSGWPDAPADRAISSTRVGHVPGTHTVWFDGPEDTLELTHTARSRDGFATGA
FT                   LRAATWLGEQPPAPGLWRFDELVAHRLGEAPIPVSHRIDHHPTEEDA"
FT   gene            complement(85798..86148)
FT                   /locus_tag="Ksed_00800"
FT   CDS_pept        complement(85798..86148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05175"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV0"
FT                   /protein_id="ACV05175.1"
FT                   /translation="MTKKTATRSPLTRLMSLATVPLAVVALSACGSDDDSTGGDDTTTS
FT                   VTTSADDQSTDDADDQSDDDADDRSDDADDQSDDADDDSDDADDQSDDDQSDDADDQSD
FT                   DADDDDDDASTS"
FT   gene            86235..87272
FT                   /locus_tag="Ksed_00810"
FT   CDS_pept        86235..87272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00810"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /note="PFAM: Prolyl oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05176"
FT                   /db_xref="GOA:C7NIV1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV1"
FT                   /protein_id="ACV05176.1"
FT                   /translation="MHTHAVIRARALPALLALAGVALAGCAGESPPAASVPGVTPPPSP
FT                   VTAADGAVAEWTEWLPYGAEERQRMRVLPGEPGGGVAVLVHGGSWRAGSAGTYVDPGST
FT                   MHALTRGLHDDGWWVVAVEYRFADRSPWPTTARDVHSATRAGVRWATERGAGETLAMLG
FT                   DSAGGHLASLEGATHPTQVDAVVSYYGLHDFTTSQAQREARNCPTMNVGAPNVFGVQPT
FT                   SDEQLAVARHWSPAHRVGPESPPMMVLHGTEDCVVPYEQAGELVGALTLHGVPAEVITL
FT                   PGEGHGSPAFVDPETTLPRVLDFLAEHSDPVVAPPTQDRTPTPTSPPSSAPAEPTSPTA
FT                   GEWRP"
FT   gene            87269..88075
FT                   /locus_tag="Ksed_00820"
FT   CDS_pept        87269..88075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00820"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="PFAM: Type I 3-dehydroquinase; TIGRFAM:
FT                   3-dehydroquinate dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05177"
FT                   /db_xref="GOA:C7NIV2"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV2"
FT                   /protein_id="ACV05177.1"
FT                   /translation="MTSETASTPAPGQALLPLRSRAFGAGRPAVAVPLVGATPEELLQE
FT                   AVQLRGQPVDLVEWRLDHLAPLARGAQPDAARIGPVLARLTDTLGEVPLLVTYRTVGQG
FT                   GCGEAAPEQYLALVGAVAGLPGVDLVDVEFDHPERDAALQALRSAGVPSLLSHHHWDGQ
FT                   PTAEGMAVLVQRMQATGADAVKLATTPADEGEAVELLAVLDRVAGVGAPVAMLGMGDAG
FT                   RLTRLVGPACGSFLTFARRGAASAPGQLDLALVAATVDALRAPERS"
FT   gene            88099..89463
FT                   /locus_tag="Ksed_00830"
FT   CDS_pept        88099..89463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00830"
FT                   /product="esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05178"
FT                   /db_xref="GOA:C7NIV3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV3"
FT                   /protein_id="ACV05178.1"
FT                   /translation="MPRSPHRTVTTALAVCASLVLAACGGGEDGSGEAQGTETTTSVGR
FT                   EPSTDQGSALPEDPSAAPTTGESGDDADEPGESEGPGSGEDSNDAGTTAPGGTLSGDGE
FT                   PSGPGPTEPTGPTAPAPVPDPTQTAPTQPAPTTPGDPSPSATSTPPGDPSSEPTVPPSS
FT                   PGEPTVPPSSPSEPTAPPSSPSEPSEPPSSPAPDAWSDWVSYGPAGEQVYSLLPGQPGK
FT                   GLVVMVHGGGWVGGKADAFRDESSRKNTLVRHLHEQGWWVATVEYRKADESPWPATAQD
FT                   VHAGVTRAVADARGQGAGQRTALFGDSAGGQLAALEAVTHPGTVDAVVGYYGIYDPLTA
FT                   KAARAAKNCPPKTAAEDHILMHDATDPAVRDRIEKTASPVALATAAAPPMMFLHGTKDC
FT                   VAPSEQSVAMAAALQAKGVEASTIIVPGADHSQPVFWTAPEHLGNLTRFLTTQGF"
FT   gene            89571..90842
FT                   /locus_tag="Ksed_00840"
FT   CDS_pept        89571..90842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05179"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV4"
FT                   /protein_id="ACV05179.1"
FT                   /translation="MMRRVVRGLPPIKWRDQKIDSWREQARENKERAREAERALKELQE
FT                   KTARASSAAAPAAPVAEPTPAPEPAKPAPKSGDGARVVQDDHGVMPRADLTPTQVKVLK
FT                   DAGHVPTVGAAESDPRAYPSFVTELFAARRIRQRLSDQGLKDHPRREIPKKLQNFALAA
FT                   THGVQPPTIHAIWRTAEEIDLSQLPETFVIKSNGGAGSRGVYPLRRVAGETDTFEITDE
FT                   TRRRITGAEVIRNLTTDAKLTGPWFAEELLVPDVGESALPSDIKIYAFYGRIGYGFARR
FT                   APLHRGSQGWQQKLEFRYFDGERKDIEMRGAPSRRDIPLTPHLPEMLEHARVLSKAVPL
FT                   PFVRVDLYGTTKGIVMGEITLLPGGNQHYIPVQDARLGKMWEEAEMRLQIDLARNGRPY
FT                   AILPGEHPIPEILEPYAPEIMRGR"
FT   gene            complement(90925..91548)
FT                   /locus_tag="Ksed_00850"
FT   CDS_pept        complement(90925..91548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05180"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV5"
FT                   /protein_id="ACV05180.1"
FT                   /translation="MNSSPLTGPSARLTRLLQLSLVPVAALALSACGGEEETPAESESS
FT                   VSSTTQESSAPADESSAPANESSAPANESSAPGEESSASEDAASEDPGEEPTSDPSLTG
FT                   GGEGGALNITSFHDMIGIDKKVDSLSAPEACGYLQGAMANPASFDDPAAGAQGVRDLAK
FT                   VAPTEVRGAMQSLAATMSSVSGPEDPALGAQLGQVEEACMSAAG"
FT   gene            91706..93694
FT                   /locus_tag="Ksed_00860"
FT   CDS_pept        91706..93694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00860"
FT                   /product="choline/carnitine/betaine transport"
FT                   /note="PFAM: BCCT family transporter; TIGRFAM:
FT                   choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05181"
FT                   /db_xref="GOA:C7NIV6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV6"
FT                   /protein_id="ACV05181.1"
FT                   /translation="MPSSRPEDARPQHPRPRDAVVGAHRDSLSHRTSTRRFLDEVNYPH
FT                   SIHPALVPGVSVEDQKVRFGLDKIVFGVAGAAIVAFIAWGLADAAQVTRVTTAMLTWVM
FT                   TNLGWLFNGLAIVLLLFLLGIAVSPYGRIPLGLDGEEAEFSTASWTAMLFGAGIGIGII
FT                   FFGPYEPMSYFLSPRPGSAEAGSADAVPKAMAQAALHWGVNAWAFYALVGLAVAYASYR
FT                   RGRVPLMSSIFAPLFRKDPHHTAAGRTIDILAIIATLFGTAASLGIGALQIASGVEIVT
FT                   GWGTGGNAAAITIIVVLTVGTIASAVSGLAKGIRWLSNVNLVLALLLATFFFVVGPTVF
FT                   LLNIVPSVFVTYFDQMPSMLSASMADGPEMQSFLSSWTTFYWAWWVSWAPFVGIFTAKI
FT                   SRGRTVRQFILGVLFIPGTIIILAFTMLGGTAIWHQRDSQAIAPDGTLETLPAPQDIFF
FT                   TVLDQLPGAAIVAPVVILMLAIFFITSSDSASLVNSQLSQGGNPEPKRLVTVFWALCMA
FT                   GIAAVMLLIGGQSALNGLQNLVTVSALPFAVVMIGMCVALLRDFSTDPMMIRRAFQQRA
FT                   VDNAVREGVTEYGDDFKLAVEPAHGEAERWSVGKDFESTAEEYTAWYQRTDEEGEPVEF
FT                   DYATNEYVEEEVDDTDGRPTADGRPTA"
FT   gene            complement(93691..94023)
FT                   /pseudo
FT                   /locus_tag="Ksed_00870"
FT   gene            complement(94172..95548)
FT                   /locus_tag="Ksed_00880"
FT   CDS_pept        complement(94172..95548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00880"
FT                   /product="sugar phosphate permease"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05182"
FT                   /db_xref="GOA:C7NIV7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV7"
FT                   /protein_id="ACV05182.1"
FT                   /translation="MQRLALATIGLAQFAVAMDFSIVYVAMPTIGADLGMDPATLQWLI
FT                   TAYSLPFAGFLLFGGKVVDRVGALRVFVAGIAVFGAASVLAGVANADWLVILGRALQGL
FT                   AGAFLSPAILALLSVNFPTGPVRARAYSIWGAVGASGLAAGVVFGGLFTEVSWRLIFLV
FT                   NIPIVLICIWGTRKMTDTIKVDAARSRIPTVSTILGTAAILLVVLTLTLFGETGADPLQ
FT                   LGIVGAVALLTLIVFLTNEHHSQTPLIDRPLRKIKNLRRGALAAALYMSSVGTEFFIVT
FT                   LFLQDQRGFSPLTAGIAFLPLAALVTVGNIWAGRLLKTWTAPRVLLLGFSISAAGLLML
FT                   AAMLGVESFWVGLLPGFLVSGLGHGMVFTSVFVLGNTGVPGELSGAAGAVLTSAQYVSN
FT                   GVGIAILTIFVTHIAGTSGFAWAFGFNTAVAIAGILLAISTLRKARHDAQVTDSSHLTQ
FT                   "
FT   gene            95720..96109
FT                   /locus_tag="Ksed_00890"
FT   CDS_pept        95720..96109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00890"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05183"
FT                   /db_xref="GOA:C7NIV8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV8"
FT                   /protein_id="ACV05183.1"
FT                   /translation="MSAVDVDVKIPAGEMLSVGRLAEASGVSTRSIRYYEEQGLLESQR
FT                   THSGHRRFDPETVERVVLIQRLFSAGLSSREIEPVLPCMVDESARTSLLVDVLRDYRER
FT                   LAQEIRKQRETVRILDEVIDEYDTV"
FT   gene            complement(96224..97285)
FT                   /locus_tag="Ksed_00900"
FT   CDS_pept        complement(96224..97285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00900"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05184"
FT                   /db_xref="GOA:C7NIV9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIV9"
FT                   /protein_id="ACV05184.1"
FT                   /translation="MMIAPPLGSARRIAFTAGGAFAAFYIFYTTAPIAFAGASLGAGVR
FT                   VGIVMAVVVAVQPFVGLLGRWMATRRLQVTSAAISMGLGSAIMPFAGHWPGMLLLAVGF
FT                   GVFVVASTAWIKETAPSGLLGRALGLYGFGSAIGGALGAPLGLILIEQAGTPGTAVVGS
FT                   LVALASILPVLRLRTAVSSDVSPGESTASETAPRASRLWSNSRLIGLGAHLLAVTIYAA
FT                   ALSGLASDQNGRGTWLPVLAAFAIQASLAIGRMTGGWVVTRWSPLVVGTSALVLLLGAT
FT                   GIALLDPLPVLTLAATIGVGLASGACQTVALTWLMQRTDTTTGINRASAAWNICFDIGL
FT                   GLGALAVGATLNQ"
FT   gene            complement(97291..97689)
FT                   /locus_tag="Ksed_00910"
FT   CDS_pept        complement(97291..97689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00910"
FT                   /product="cation/cationic drug transporter"
FT                   /note="PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05185"
FT                   /db_xref="GOA:C7NIW0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW0"
FT                   /protein_id="ACV05185.1"
FT                   /translation="MTTTITPASPVQTEKKGGAWIALLIAGGFEVGYALSVNGSAGFTN
FT                   PLWSAIAVVFFLFTLFFLSVALKKIDVGIGYAVWAGIGAIGAAVLGPVFFDETLTLIKG
FT                   FWLAVIIAGVVWLKLADSPKLEAKTQAA"
FT   gene            complement(97754..99014)
FT                   /pseudo
FT                   /locus_tag="Ksed_00920"
FT   gene            complement(99134..99502)
FT                   /locus_tag="Ksed_00930"
FT   CDS_pept        complement(99134..99502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00930"
FT                   /product="cation/cationic drug transporter"
FT                   /note="PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05186"
FT                   /db_xref="GOA:C7NIW1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW1"
FT                   /protein_id="ACV05186.1"
FT                   /translation="MSWLYLAIAVVFEVAVGIAAGKANGFKHLWWTIATLASGAIATFF
FT                   LSLALLTFDVGVGYALWTSLAGVGIVIVGALFLSQKLTWKKFLGILVVIGGVVGLNRLF
FT                   IDEGVGHVARSGGASVWG"
FT   gene            complement(99499..100026)
FT                   /locus_tag="Ksed_00940"
FT   CDS_pept        complement(99499..100026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00940"
FT                   /product="cytosine/adenosine deaminase"
FT                   /note="PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05187"
FT                   /db_xref="GOA:C7NIW2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW2"
FT                   /protein_id="ACV05187.1"
FT                   /translation="MSADATALTAVMAQAVDACTEHVDAGGLPFVGVVVNADGEMLSEF
FT                   GVNQVAETGDPMAHAEVVAMRDAMTRHGLDSLTGYTLLATGEPCGLCYRYAVDHGIDTI
FT                   YVAVDREEVANLGFDYRSSYPAFGITDTQRTEHLRPLPVEHGIDPFAHYLHLHLPGHAT
FT                   ARPGTVSKGTSL"
FT   gene            complement(100023..100646)
FT                   /locus_tag="Ksed_00950"
FT   CDS_pept        complement(100023..100646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00950"
FT                   /product="predicted dithiol-disulfide isomerase involved in
FT                   polyketide biosynthesis"
FT                   /note="PFAM: DSBA-like thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05188"
FT                   /db_xref="GOA:C7NIW3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW3"
FT                   /protein_id="ACV05188.1"
FT                   /translation="MTTKIDVFVDYVCPFCFLVEPAIEELKRDRDVEVTIRPFELRPDP
FT                   VPTLRPEDEYLPRVWKQSVYPMSDRVGLPITLPSISPQPRTDKAFMVLQLAQERGLAEA
FT                   YTEAMFSAFFQQDRNIGLDEVIIDVAASVGLDKAEVEEALRSEERRDRQLADQDYAVNT
FT                   VGIDSVPGIVIEGQVLRGVPSASRLKKVVGDLADRKAASGQGQA"
FT   gene            complement(100729..101175)
FT                   /locus_tag="Ksed_00960"
FT   CDS_pept        complement(100729..101175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00960"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05189"
FT                   /db_xref="GOA:C7NIW4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW4"
FT                   /protein_id="ACV05189.1"
FT                   /translation="MTGNASGAWSRVAAFASAVDASLDKWLGDNYRLGLTEYRALTLLS
FT                   QESSKELRITVLAQRVGLTSTSTTRLVSRLESKGHARRDVCQDDGRGVYAVIDEPGEAL
FT                   LREVREPFEARVHDLLSNPAKHFPHLDAGLVAAALGKVSALVTP"
FT   gene            101465..101695
FT                   /pseudo
FT                   /locus_tag="Ksed_00970"
FT   gene            101731..101847
FT                   /locus_tag="Ksed_00980"
FT   CDS_pept        101731..101847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05190"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW5"
FT                   /protein_id="ACV05190.1"
FT                   /translation="MWERAQVRLEMDLASGARPYGIVAGDHPVPELLRPFLP"
FT   gene            complement(101849..102454)
FT                   /locus_tag="Ksed_00990"
FT   CDS_pept        complement(101849..102454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_00990"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05191"
FT                   /db_xref="GOA:C7NIW6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW6"
FT                   /protein_id="ACV05191.1"
FT                   /translation="MTRILVVDDQALVRGALAALLDLEDDLQVVGQVDSGPAAVDFVRD
FT                   TSVDVVLLDIEMPGGGGIDALPDLLTAPTPPRVLVVTTFGRPGYLRRALDAGASGFVVK
FT                   DCPPTELLEAVRRTAAGLRTVDADLAAESALAGPNPLSPRETDVLRLAADGQGVAEIAG
FT                   ALFLSPGTVRNHLSSAIGKTGARTSAGAATTARDNGWL"
FT   gene            complement(102451..103569)
FT                   /locus_tag="Ksed_01000"
FT   CDS_pept        complement(102451..103569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01000"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05192"
FT                   /db_xref="GOA:C7NIW7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW7"
FT                   /protein_id="ACV05192.1"
FT                   /translation="MSAPAPERSPAASSGPATHPAAPGPRRDDPYYRWSLVIAIVFMVF
FT                   LAFPLLGAAQADAAPLARGVTVAAIIAFAALYLWGYSERRPWWVLAGMLALMVATVPVL
FT                   GVGACGLLPYVATHAALELPRPAHYAATAAAALTPLVVALVEPPAALFALIAAPVGGGM
FT                   LAVRQMIHRGVELGEVETALAITAERERVARDVHDVLGHSLTAIVLKADLAERLVGRDD
FT                   DRARDEISQVAALARQALSEARSTVVGLRSADLADEVERARDLASSSEVTLTVHGDPQD
FT                   VPPRHRPVAAWILREAVTNVSRHARASRVDVTLAPDRLVVCDDGQGLTGEPSGSGSDGI
FT                   RERAAAAGGTVVWEDNAPGTRLMVTLPTGAAA"
FT   gene            complement(103566..104333)
FT                   /locus_tag="Ksed_01010"
FT   CDS_pept        complement(103566..104333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01010"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05193"
FT                   /db_xref="GOA:C7NIW8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW8"
FT                   /protein_id="ACV05193.1"
FT                   /translation="MSTPTGMLFSPTYLRIDTVRILRNVSNVIFTIGLPVFMYLIFSAG
FT                   NAIDAEMPGGDGNSMLAVRMAVYGACTACASIGALTAWERQQGWTRQLLLTPLSPLGFA
FT                   LQKLVTALVVALVPVVLVLAIAAATGAEAPLGNWLLCGLIGWLGASLFALYGLLLALVI
FT                   RSDASIGIASGGIVILAFLGNVFMPLDGWLLTLARFTPMFGVVNAAERPITEGWISSGV
FT                   NIPVWQAWANMGAWFLVLAVACTLVMRRTGRRE"
FT   gene            complement(104349..105368)
FT                   /locus_tag="Ksed_01020"
FT   CDS_pept        complement(104349..105368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01020"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05194"
FT                   /db_xref="GOA:C7NIW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIW9"
FT                   /protein_id="ACV05194.1"
FT                   /translation="MERTSDSLPPAADAAPVLDLRGVHKSFGRGTRRVDAVRGVDLTVH
FT                   RGDVVALLGHNGAGKSVTLDMALGLQAPSSGEVRVCGDPPSRAVSAGRVGAMLQSGALL
FT                   DDLRVAETVRAVASLHPGGRRRVGSVMDRAGLTPLATRRVSRCSGGEKQRLRFALALLP
FT                   DPDLMVLDEPTAGMDVSARQEFWEVVSAEAQAGRTIVFATHYLAEAEEYAPRTVLMAGG
FT                   RVIADDTTEAVRSRVPGRVLTCTTPDAGRLAQQLAGEPDVVDVRTPTPDRLEMRVTDSD
FT                   RFARLALTEWRATGLQIVPLGLDEAFAELTREATDPHGGTDPDQPTSPARPEPAATAA"
FT   gene            complement(105505..106482)
FT                   /locus_tag="Ksed_01030"
FT   CDS_pept        complement(105505..106482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01030"
FT                   /product="Zn-dependent oxidoreductase, NADPH:quinone
FT                   reductase"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05195"
FT                   /db_xref="GOA:C7NIX0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX0"
FT                   /protein_id="ACV05195.1"
FT                   /translation="MRSIVFEKHGGTEVLQVRESDDPTPGAGEVVVEVARAGVNFIDTY
FT                   YREGLYPAELPLTAGNEGVGAVSAVGEGVTDVAVGDRVAWCLVNGQGYTTHAVVPAEKT
FT                   VPVPQGVTDEQAVAGMVQGMTAHFLAREVWPLQAGDRVLVHAVAGGVGLLLTQVLAADG
FT                   VEVIGTCSTEAKAEAGRAAGASHIIRYDHEDVTERIREITGGAGVRVVFDGVGASTFDA
FT                   SLDSLSPRGLLCLFGAASGPVPPVDPQRLNAGGGLYLTRPGMATYVSTREELLHHSSAV
FT                   FAMVADGSLELTIGETYPMTEAARAQADLTGRRTSGKLLLDPSA"
FT   gene            complement(106586..107983)
FT                   /locus_tag="Ksed_01040"
FT   CDS_pept        complement(106586..107983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01040"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05196"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX1"
FT                   /protein_id="ACV05196.1"
FT                   /translation="MTTSGTPTGTTPGQALVTGATGYIGSRLVPALLEAGWTVRVLARS
FT                   PEKLEGRSWAVDVDVHAGDANSLDDLASALEGVEVAYYLLHSMDGEGDFVERERAMAQT
FT                   FAAACDAAGVGRIVYLGGMHPHNEPLSTHLYSRKAVGDVFLAADTPAAVLQAAVIVGAG
FT                   SASFEMLRHLTDRLPVMLAPRWLDNRIQPIAVADVLHYLVGAASLPAGVNRAFDVGSDE
FT                   VLRFRDMLVRYGQVAGLRRRRIALAPVMTPWLASHWVGLVTPVPAGVAKPLVGSLVHEV
FT                   VVKDGRALEEFTGAPAGGHTPFDDAVARALVRADAVDPAAEGEEPADALPGDPEWVGRQ
FT                   QRTETWRSIVDAPADDLWAEVESIGSSGSLGPRGALGPWALESTDREGTTRSVRLRSTR
FT                   ALPGTARLTLAVTPAPHDAGQSLLTQEVTFVPHGLAGETSWWGSYPAHRALFTRVHQGI
FT                   VERARVR"
FT   gene            complement(108023..108757)
FT                   /locus_tag="Ksed_01050"
FT   CDS_pept        complement(108023..108757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01050"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05197"
FT                   /db_xref="GOA:C7NIX2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX2"
FT                   /protein_id="ACV05197.1"
FT                   /translation="MRTPFAPLLQELSRFGSAQFVRQVPRDHRADPRQLRRRQVVVALT
FT                   LLVGTVFLAWSLRSEPGSASFYGAATALAITWTAGSFASGPLHLGWAHTRSGDRYVRPV
FT                   LQPVLVALGVIALFMVGALVAARIPVLSASVDAVLDHARLGILPLVVALALVNGVAEEL
FT                   FFRGAMYSATPWRPVLVTTVVYTLTTIATGSLGLVLAAAVLGWVVGLQRRVTGGILAPV
FT                   LIHCTWSLGMLLVLPAVMDRAA"
FT   gene            108987..110609
FT                   /locus_tag="Ksed_01060"
FT   CDS_pept        108987..110609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01060"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /note="PFAM: PhoD-like phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05198"
FT                   /db_xref="GOA:C7NIX3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX3"
FT                   /protein_id="ACV05198.1"
FT                   /translation="MTPTKSLPHTTSGALPVDSSWPEQPTASRTAPGASPSRRLVLATG
FT                   AATLGALALATGHATAGDAYPFTLGVASGDPTPDGVVLWTRLATDPVAPDGLGGLGQTT
FT                   STVEWELATDESFRRIVRRGTVTTDASVGHSIHIELAGLPSSARFTYRFRANGHLSPVG
FT                   HTRTAPAPGSDERATFAVASCAQWEHGFFTAYRHIAAEQPDLVVHLGDYIYEHGPGGYP
FT                   VSSGRARTMVGGEIHSLADYRRRHALYKSDADLQAAHAAAPWVVVFDDHEVDNDWAELY
FT                   HEVWGKVPAFAERRAAGFRAYWENMPLRRSSVPGADGIQLYRRLTWGRMATLHVLDTRQ
FT                   YRSNQTGLIGPVRSTYDSRRTMLGSTQEAWLDEGLRTSGARWDLLGQQVMVAQYDMMAG
FT                   PGFLTNQDAWDGYVAAKDRLLTSLERSDARNPVVLTGDVHESFANDLWRTTDSGRVTLG
FT                   SEFVTTSVTSGGDGKDSQFTGDADNPHIRYHETTRGYLRLDLTADSMAGTFRAVDTVSS
FT                   RGGAVRTDARFALEDGRRGLQAV"
FT   gene            110729..112279
FT                   /locus_tag="Ksed_01070"
FT   CDS_pept        110729..112279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01070"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05199"
FT                   /db_xref="GOA:C7NIX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX4"
FT                   /protein_id="ACV05199.1"
FT                   /translation="MNIATFLTDTAEKHAQGVALIQDDTRLTYAELRDATAAVAGYLRD
FT                   KGLGEGDRICLMLPNVIPFVPFYYAALSLGAVVVPMNPLLRDREITHYLKDSGATHIVA
FT                   LGGEAGAALGGDVGGVAERHRVTAHLIDPAQGLTPFLGQPVTEVADKAPGDTAVILYTS
FT                   GTTGSPKGAELAHENLRTNVLATQETLVHLEPGEVVMGCLPLFHVFGMTCALNTSVVAG
FT                   ATLTLLPRFEAGKALEMIERDAVNVFEGVPTMYGGLIAAAKAREAEGKPPVDTSTLRRC
FT                   VSGGSSLPMETLRAFEQTFGADILEGYGLSETSPVACFNHPGRTRAGSIGHPIRGVEMA
FT                   ILDPVTGQPVEPGEVGEVVIRGENIMKGYWDNPEATERAIRDGWFHSGDLGRVDPDGFF
FT                   FIVDRVKDLIIRGGTNVYPREVEEVLYEHPKVLEAAVVGSAHPELGEEVTAYVVAQPGE
FT                   LDEAALSDAESPAARALADELRAHAKDQLAAYKYPRHIHFLAELPKGPTGKILKRELG"
FT   gene            112374..114326
FT                   /locus_tag="Ksed_01080"
FT   CDS_pept        112374..114326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01080"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="PFAM: AMP-binding enzyme; TIGRFAM: acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05200"
FT                   /db_xref="GOA:C7NIX5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX5"
FT                   /protein_id="ACV05200.1"
FT                   /translation="MTPENDAAAVRTYPPAAEFAAQANATAELAERAGADREAFWAEQS
FT                   RELLPWATDFSEVLDWSEAPFARWFADGEINASYACLDQHVEAGRGDEVAIHWVGEPEG
FT                   DRRDLTWSDLLEETCRAANVLEDLGVQAGDRVAIYLPMIPETVVAMLACARIGATHSVI
FT                   FGGFAPNAIRARVQDAEAKVVITADGGYRKGKASALKANVDEALSHEDTTVSTVLVVRR
FT                   TGQDVGWQDGRDQWWHEAMETASSDHEAQPMPAEHPLFILYTSGTTGTPKGIFHTTGGY
FT                   LTQTAYTAKMVLDLEPGRDVYWCTADVGWVTGHSYLVYGPMALGVTQVMYEGTPDTPHK
FT                   GRWWEIVQEYGVTVLYTAPTAIRAAMKWGDDIPAQYDLSSLRLLGSVGEPINPEAWAWY
FT                   REHIGGGRTPIVDTWWQTETGAMMIAPLPGVTELVPGSAQTPVPGITVDVVGESGQSVG
FT                   NGESGYLVIRDPWPAMLRGVWGDPQRFRDTYWSRFEGMYFAGDGAKRDEDGNVWVLGRV
FT                   DDVMNVSGHRLSTSEIESALVSHDAVAEAAVVGATDASTGQAVVAYVILRGDAAEARGE
FT                   GDDDAELVAELRAHVGKEIGPIARPRDITVVPELPKTRSGKIMRRLLRDLAEGKEVGDV
FT                   STLADPSVMDSIRRP"
FT   gene            114343..114999
FT                   /locus_tag="Ksed_01090"
FT   CDS_pept        114343..114999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05201"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX6"
FT                   /protein_id="ACV05201.1"
FT                   /translation="MSSSALRLRAVPVAVAALLVLGACTTGSEEAGEDPVVVSREPSPE
FT                   GSPSSGPDASDEPSGSSPEGTPEPSGSGPDRDLTPLEQHQRVAFLMPSQNVACLIEEQG
FT                   VSCDIRNTRYQHTVVPAADCVEPTVELYRDRPEWTCSRSSRFVDAQTANDGAWVELVPR
FT                   GEVVEINTIDHTVLPYGEELQAFDFRCESRRNGVRCMRLSDGRGFRMAVRDFDLF"
FT   gene            complement(115038..115802)
FT                   /locus_tag="Ksed_01100"
FT   CDS_pept        complement(115038..115802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05202"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX7"
FT                   /protein_id="ACV05202.1"
FT                   /translation="MNETRREIALAATIVGGLVVGTVAAGQAAGGPTPITFLTDHQGSL
FT                   SYAGLADGEVAAPGLAWVALPACVNDEPGHSVEIRDVRLVNAQGVQVESVFVDATLRED
FT                   DDAAGRLGSGAGAGWPAPDAEYSSWGPGVTASCAEHRGGSLDRANRVHVVLSTTDLGAS
FT                   RIPAFDGVEVDWSAGRQEGTSRLSAALVFCPTQEQEAACQESLDAGEARREALHEAWAS
FT                   GEPAEPTDHLQWDGEPVDVRNLPDVRQAAEGH"
FT   gene            complement(115941..118076)
FT                   /locus_tag="Ksed_01110"
FT   CDS_pept        complement(115941..118076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01110"
FT                   /product="predicted RND superfamily drug exporter"
FT                   /note="PFAM: MMPL family; TIGRFAM: Transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05203"
FT                   /db_xref="GOA:C7NIX8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX8"
FT                   /protein_id="ACV05203.1"
FT                   /translation="MVLLAGAAMALLPGSSDAGGPTSLPEGADSAEVSRITSEFPGGDV
FT                   VPAVVVVESQDGELGREALGTLGQKGEELLAALPDDAVGQDATVEGPIPSEDGQAALLV
FT                   VPLDAAAMEANGPDIVEDLRGATDGLVPGTQSYVTGAAGFSADVAGSFEGADFRLLAAT
FT                   AIVVAVLLLITYRSPVLWLVPLLVIALADRVAASVSGTVNEAADLAFDGSTSGITSVLV
FT                   FGAGTNYALLLVSRYRDELRDTPDHRVALARAWRAALPAILASNITVVLTVALLLLAVQ
FT                   PSNRALGLSTGVGLLVALVFALTLLPALLALFGRGLFWPFVPRPGDRDKTETGIWHRIA
FT                   TAVVRRPAVVLAASVALLGAMALGLVGVKVGLSQTDQFRVEAESVTGLEALEEHFPSGA
FT                   ATPLSVLVPVPEGSGVQAGEGGRSGPPGGGEGPAADLAEPAAQVVTALEGVDGVTGVQP
FT                   QSSATVDGTTWQQLQVTSDAAPASAAARQVVEDVRSAASGATEGALVGGSEAQTVDQRS
FT                   GVLRDMTVVIPLMLVMILVVLVIVLRSLVAPVLLVLISVVGSVAALGAGALLSEHVFGF
FT                   PALDISVPLYSFLFLVALGIDYTIFLVVRAREELLSGRERSTARAMVRAVAATGGVITS
FT                   AGIVLAAVFVVLGVLPLITLTQVGIVVGLGILVDTFLVRTVVVPAVFDLVGDTVWWPAR
FT                   PQDRAVQAPAPQDARRD"
FT   gene            118263..120083
FT                   /locus_tag="Ksed_01120"
FT   CDS_pept        118263..120083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01120"
FT                   /product="AMP-forming long-chain acyl-CoA synthetase"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05204"
FT                   /db_xref="GOA:C7NIX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIX9"
FT                   /protein_id="ACV05204.1"
FT                   /translation="MSPSMMTSWWKDNPPQHLPGLLHGTAAEFPDRVLISRRQGQSWVD
FT                   LTSQQFLDHVNSVARGLVAAGVEPEDRVVLMAKTRYEWALLDLAILSTGAIVVPVYETS
FT                   SANQLAWIMENSRVTWALTESDALAATARAAADQAGAQLKGVWAMDAKTTEGIDQLIAG
FT                   GAEVDQAEIDRRCEGLGRETLATLIYTSGTTGRPKACMLPHRAFIDEVTAAYQGLPELF
FT                   EDDSSTLLFLPLAHVFGRMVHFAVIGAGARTGHTDIARVAKDLPVFKPTFVLAVPRVFE
FT                   KIYESAHLKATKGGKEKIFAAATQTAIDYSKALDAGRVPLVLRAKHKLFTKLVYGKVQA
FT                   AFGGELTWAISGGAALGERLGHYFRGMGVNIMEGWGLTETSAAATVNRPSMQKIGTVGV
FT                   PLPGFEARLSDEGEIQVRGGHVFAGYENNPEETAKVLAEDGWFSTGDLGEIDDDGFLRI
FT                   IGRAKDILVTAAGKNVAPGPLEDILRSHRLVSEAMVVGDGRPTVMALITLDEEQLPEWL
FT                   KHHHREVVPASELTEDEQVRAAIQKVVDKANASVSKAEAIKKFTILSRDFTLEDEEITN
FT                   SLKVRRHIVTEHFKDEINAMYGTRDSQLRD"
FT   gene            120076..121143
FT                   /locus_tag="Ksed_01130"
FT   CDS_pept        120076..121143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01130"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized conserved protein (DUF2183)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05205"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY0"
FT                   /protein_id="ACV05205.1"
FT                   /translation="MTEVPLATAKPHYAARWENRLRGRVADVLRSRGWLPRPAGFTGYG
FT                   TTEFARVYARIQLRRPGGDVALPTTVQDVQQFLTRRGWRAFLSAPDAGVPVKVTLGDAS
FT                   IMARADRGGYVEQVITGHGLPPGTHRVTFECPGGAEAQADVHIAEPGARIGLVSDIDDT
FT                   VISTHLPRPLIAAWNTFVLTEQARDVVPGMADAYRAVLAEHPGAPVFYLSTGAWNTQPF
FT                   LHRFLQRHQFPAGALLLTDWGPTNTGWFRSGRDHKSRHLVRLAEEFPGVRWVLVGDDGQ
FT                   HDPGIYDEFAESHRQHVAAIAIRQLTVIEQALSRGLPVALAELVRKHSGTVPVVTGGDG
FT                   FALMPALLRALGRRG"
FT   gene            121153..122097
FT                   /locus_tag="Ksed_01140"
FT   CDS_pept        121153..122097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01140"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase H2TH
FT                   domain; Formamidopyrimidine-DNA glycosylase N-terminal
FT                   domain; TIGRFAM: formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05206"
FT                   /db_xref="GOA:C7NIY1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY1"
FT                   /protein_id="ACV05206.1"
FT                   /translation="MPELPEVEGLAAALRERLEGRVVAEVALASFSALKTVDVLPQSLH
FT                   GRPVDDVRRYGKLLDLVVDGTHVVVHLMRAGWVTWHDEVPRTRLRPGGKSPVAVRITLD
FT                   DGSGMDLYEAGTRKGMAVYLADDPGTLEALTTLGPDAVSLRPPLESPPLVGVDTTTGEV
FT                   GVTASTTPEERVAFWVEALEGRRTQIKRVLRDQSVVSGIGNGWSDEILHTARLSPFVLA
FT                   ATLEAEEVGRLAEAVHEVLVGAAERAVGRAPADLKDGKRGGMRVHGRTGEECPVCGDVV
FT                   REVTYADSSLQYCATCQTGGQVLADRSTSKFVK"
FT   gene            122124..122447
FT                   /locus_tag="Ksed_01150"
FT   CDS_pept        122124..122447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01150"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05207"
FT                   /db_xref="GOA:C7NIY2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY2"
FT                   /protein_id="ACV05207.1"
FT                   /translation="MDNITPQDLPDDAVVLDVREPEEWAAGHAPNAVHIPLADVPARVD
FT                   ELPDPSTDGPLPVTCRSGGRSSRAVQWLQAQGYEVVNVDGGMKAWSAAGKQVVSDAGEP
FT                   QVI"
FT   gene            122526..123809
FT                   /locus_tag="Ksed_01160"
FT   CDS_pept        122526..123809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05208"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY3"
FT                   /protein_id="ACV05208.1"
FT                   /translation="MDPITNPYAPGAGQRPPELAGRDEYLRQFDVVLERIRRGRPDRSV
FT                   LLTGLRGVGKTVLLNALRGQAVRANWGTGKLEARPDQSLRRPLASALHTAVRELGHPQQ
FT                   EDVDHVLGVVKAFAQRDAPANAKLRDRWSPGIDVPAVSGRADSGDIEIDLVELLTDVGG
FT                   LAADVGKGVGIFIDEMQDLGPDDVSAVCAAFHEIGQQALPVLVVGAGLPHLPAVLSASK
FT                   SYSERLFRYHRIDRLERAEAYRALQAPAADEGAEWQDDALAAMYAATGGYPYFIQAYGK
FT                   EVWDLAPQSPITAEDVRVAAPSAEAELAVGFFGSRYERATPGEREYLRAMAEAAITVAE
FT                   EEVAAEAGGAGSGEEAVAPAESKDPLTRAEEVEAVPTSVVAEVLGRKPQSLSPARDALM
FT                   KKGLVYAPERGKIAFTVPHFGRYLRNSA"
FT   gene            complement(124243..125499)
FT                   /locus_tag="Ksed_01170"
FT   CDS_pept        complement(124243..125499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01170"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05209"
FT                   /db_xref="GOA:C7NIY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY4"
FT                   /protein_id="ACV05209.1"
FT                   /translation="MRTGLLLMTAITFITWIGTRMTAIALPLVALEETGEAWATGLVGG
FT                   MAGLPLLTVGWWGRGILQRLTSGGPLAAVMGVNAVGLAVVPVVALHGQVTSATLCTSGL
FT                   ISGAAGALLGPAQRSLASDLADAHLAQGGRSGPAQWLAWQDLAHRVSMVFAPPLGAWGV
FT                   SALGASSLLWCETVVIAAAALAFTLVPGAPATPGEDSANASPSGPPQRATSARTVLRAH
FT                   PQIAAGVLMAGIGGLCWFGFSLGLAVLGVDHGRPGALIAAGMSGYGAASVIASMLVPLV
FT                   IDRIPRMPTMLTAWAILGSVFIALPLVAPSLTSIVALAAVGGAAMPWGIAALNGVITDQ
FT                   TRGNERRAAFTAQTVFHSGGTSAGLLAGGALIGWLGAGTTLVLTGALQVLVAVGGALWA
FT                   LRTHPRRPSTPSASSGARV"
FT   gene            125602..126456
FT                   /locus_tag="Ksed_01180"
FT   CDS_pept        125602..126456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01180"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix protein,
FT                   lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05210"
FT                   /db_xref="GOA:C7NIY5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY5"
FT                   /protein_id="ACV05210.1"
FT                   /translation="MLVESVSRHGSVGAAARELLTTQPSASRRLAALERRLGVTLFERD
FT                   TTGARATPAGRELARQAARLLSELEAVPARIAAAVEAPSVSLGTIQALAPMVFTAAQIE
FT                   LEGIRVQAEVDHGPVLISEVAQGVLDAAIVTIADQSVLPRGVRVTELGVSPLVLVLPAG
FT                   AGPLPRGRRGLKAREVVYSSIDLGAERLHAALSEAGARPCPGLTLEATLRVARHRGIPA
FT                   VVPEFAARWWGAATDQVLPSPVAGTIRLSLVARSPGPPSLLAAHPALAARVLGVPERPA
FT                   DDE"
FT   gene            complement(126704..127198)
FT                   /locus_tag="Ksed_01190"
FT   CDS_pept        complement(126704..127198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01190"
FT                   /product="DNA-binding protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05211"
FT                   /db_xref="GOA:C7NIY6"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY6"
FT                   /protein_id="ACV05211.1"
FT                   /translation="METTLLKTGRVAEILGVSRQHVVDLCDRGDLPSIRIGAHRRVRQS
FT                   DLEELLAARALTREEHKLLWLHQAMLGHLLTRPDEVLQTARDNIHRWLPQHREDGMTAA
FT                   YLRDWERLLDSGVDAVRTILCSTTPRACELRQNSPFAGVLSPAERIAALQAFRASHPEA
FT                   A"
FT   gene            127250..127489
FT                   /pseudo
FT                   /locus_tag="Ksed_01200"
FT   gene            127476..127907
FT                   /locus_tag="Ksed_01210"
FT   CDS_pept        127476..127907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01210"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05212"
FT                   /db_xref="GOA:C7NIY7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY7"
FT                   /protein_id="ACV05212.1"
FT                   /translation="MMVDEVRYTRGQVPEREALRGLYGAVGWSAYTDDLEGLVRGVEGS
FT                   AAVVTAWRGEELVGLARVISDGHTIAYLQDVLVRPGVRRQGVASELVRRVFEPFAHVRQ
FT                   QVLLTDAEEGQRAFYASLGFRETREFPNGGLRAFVRLTH"
FT   gene            complement(128095..128655)
FT                   /locus_tag="Ksed_01220"
FT   CDS_pept        complement(128095..128655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01220"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05213"
FT                   /db_xref="GOA:C7NIY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY8"
FT                   /protein_id="ACV05213.1"
FT                   /translation="MTPTSAATLRTVTHHELTAEHLAGLRELFNAEYLDSHGEWDPAQP
FT                   YGYAGHDVHVITLRGQQILGHVGWEQRTIEVGGAPVTVAGTGGVLVNPSVRGTGLGRRL
FT                   MAHAADAMRREADISFGYLGCREDVVLFYRACGWERIRATERYTGRDGRETFQEPGPPL
FT                   LVLPLRAGTTWPSGPVDLRGRCW"
FT   gene            complement(128666..129643)
FT                   /locus_tag="Ksed_01230"
FT   CDS_pept        complement(128666..129643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01230"
FT                   /product="proline iminopeptidase"
FT                   /note="PFAM: alpha/beta hydrolase fold; TIGRFAM: proline
FT                   iminopeptidase, Neisseria-type subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05214"
FT                   /db_xref="GOA:C7NIY9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIY9"
FT                   /protein_id="ACV05214.1"
FT                   /translation="MTASEEPVHAGMLDVGRGQLIYWEEWGTAQGVPAVYVHGGPGGTL
FT                   GTSAYRRRFDLSRTRVIGFEQRGCGRSTPHASDPSTSLQDNDTAHLVADMEVLREHLGI
FT                   ERWIVNGVSWGSTLALAYAVTHPDRVLGVVLFAVTTTSRSEVDWITEGVGTVFPAAWDR
FT                   FAAHAEQAGIGYQRGQGRIIDAYAHLMESDDPRVRNAASREWALWEDTHISIGAGGFRR
FT                   DPRWDDEAFRIAFFRLTAHYWSHDGFVQPPILDQGERLAGIPATLIHGRRDISSPAITP
FT                   WRLHRAWPGSQLILDEGDGHGGATMVEHWRAANEALVAQHSRPL"
FT   gene            complement(129878..130939)
FT                   /locus_tag="Ksed_01240"
FT   CDS_pept        complement(129878..130939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01240"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05215"
FT                   /db_xref="GOA:C7NIZ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ0"
FT                   /protein_id="ACV05215.1"
FT                   /translation="MASDLGVTAGTAGLLVTAFGLAFCIGSPLIAALTDRLDKKHVLVG
FT                   GLLLFAVANALMARVDAFALAVLLRIVAGLAAAAVSPTAMAIAGTRAPAGSEGRYLAVA
FT                   TAGLTVALFTGVPLGSWAGHTWGWRSTFLLIALVSVVVTALSALMTPRVPGNDPTPLRA
FT                   RLRPVRNWQVLSLVLAMFLCGAGGLTFYNFLGATVEGHLGSSTSAVTWTLLMVGIVGIA
FT                   AVFGGGALVDARGPRAGRLLIVGGHAIALLAIGLYLVVGGGFGVPFLLLVAAWSLFAWA
FT                   LGPAMQASIIGVDPSSAVLSAALGISGLYGGAGVGAALGGVLIYHLGAVALPLAGSTLV
FT                   AGAWLLSARRETA"
FT   gene            131100..131447
FT                   /locus_tag="Ksed_01250"
FT   CDS_pept        131100..131447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01250"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05216"
FT                   /db_xref="GOA:C7NIZ1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ1"
FT                   /protein_id="ACV05216.1"
FT                   /translation="MARATHPDIESVQLTDVLHALADPIRLGLVQLLSDDEERAWGQLD
FT                   APVAPSTLSHHLKVLRSAGITQTRMEGTRCFVRLRRDDLEERCPGLLDATVAVASSPGS
FT                   GLTPIGIKQES"
FT   gene            131515..132318
FT                   /locus_tag="Ksed_01260"
FT   CDS_pept        131515..132318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01260"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05217"
FT                   /db_xref="GOA:C7NIZ2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ2"
FT                   /protein_id="ACV05217.1"
FT                   /translation="MAAFVAAGCLVAAVVVGGHPVVGPMVAVVALVVVAHGARRQGGTV
FT                   TGAGSVAALALCLVAAVWTLRGAGAALEGMGVPGAAGIALWPVPLVLAVGLYVVLSRWR
FT                   ALHLVTDWFRAGTVNRTGAWLTVAIVPVSALALVIWSWAAAEDGAGQNAYRQLAENQGV
FT                   PVLVLGALAFSAVNAAAEESAYNGVAQRALGLDLRGPVAVVLSAAMFGASHWYGFPNGW
FT                   WGVCLAGVYGLVLSVLRQVSRGLLLPWVAHVLADLTIVAVLMTLW"
FT   gene            complement(132407..132904)
FT                   /locus_tag="Ksed_01270"
FT   CDS_pept        complement(132407..132904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01270"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /note="PFAM: MerR family regulatory protein; MerR, DNA
FT                   binding; TIGRFAM: redox-sensitive transcriptional activator
FT                   SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05218"
FT                   /db_xref="GOA:C7NIZ3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ3"
FT                   /protein_id="ACV05218.1"
FT                   /translation="MHESHDITIGQLARRAGVSPPTLRYYESLGLIASRRTAGNQRRYP
FT                   RRTLRRVAFIRAGQRMGLPLARIAEALAELPDDHPPTTRDWQRVSAAWHQDLQARIDQL
FT                   VALRDAATDCIGCGCLSVDRCTLVNPEDTLGTQGPGARNLLHHRTESAGEDAGCEDDTR
FT                   QR"
FT   gene            133137..134729
FT                   /locus_tag="Ksed_01280"
FT   CDS_pept        133137..134729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01280"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05219"
FT                   /db_xref="GOA:C7NIZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ4"
FT                   /protein_id="ACV05219.1"
FT                   /translation="MSGGDRSTGRVCKVFSGPVRWRLVAAVCALAVASVVHMVLPWFLG
FT                   RIVDEGLLAGDRGALIGWSVGLFGVSLLNPLFYVMGYRQMGLAEAEVERRLAEELASAL
FT                   TVSRRPGRVSRAPGDVVTLLSTDGRDVAALCSTVGHGVMNVVAFTLGTVMVWRIDPVLG
FT                   GVLLVGVVAATGIAGPLLGRLTGHQQGYRSELAELGRQANDLVSGLRVLRGIGGEGQFL
FT                   ARYTAQSKSLRGAAHRMTVSGTWVQALQQAVPLAYLAVITWVGARLAVAGSISVGDLSA
FT                   AFGYATGLLMYSGSLLGNAQQLVAARVGASRLAHALAPRTPDGPEAPAGHDRSSAVDVV
FT                   LADLPVSQGMLTVVVTDHPAGVSGIFHHIARSPYEASRLLAGHGDVAPLRVLVVDDGDH
FT                   LFAGSLRDVVNTPDDTAAQRALSVACAEDVVVRGGAGLDGWVAEGGRNLSGGQRQRLAL
FT                   ARAVAADPDVLLAVDPTVALDAVTEAEVARRLARCRRGRTTVVVSPSTVWRRHADRVVE
FT                   WGPLPATKRGEAR"
FT   gene            134726..136471
FT                   /locus_tag="Ksed_01290"
FT   CDS_pept        134726..136471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01290"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05220"
FT                   /db_xref="GOA:C7NIZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ5"
FT                   /protein_id="ACV05220.1"
FT                   /translation="MNVLRDSLLPVASPRTVRRAGAAVLGRERCTVLLICVLYLSAAAA
FT                   GVALPVGLGKVVDGVREGWTTQQVDTTCAALLGCVALQLLLTRAGRWTAHRFGDRASAA
FT                   IREQAMARVLRLPMRTIERAGTGDLATRVTGDVDVVATMFRTTGPEMAAAALEVGVVVG
FT                   AAFLVDPLLALLLAVVLPPLVVAGRTYTRRARPVLMSERAALGDLSTSLTATAVGRRTV
FT                   EAHGLGANRAAQGRDLAGRRRAMQHQVLNLRCWFLPTLDLAYTLPVFAILCGGGLMALA
FT                   GGVSTGSVVACTMLAYRLSGPLDRIMYSLTELEESMAALSRVEGLGLLRPDPRTRRPRG
FT                   SGVELQDVVFSYDDHQQVLRGLSLAVAPGEHLAVVGPSGAGKSTVAWLVAGIERPRSGH
FT                   VLVGGAPTAEIDAEVMRRTVMLLSQEQHVFAATVRDNLTLARRGADDATLLDALHRVGG
FT                   AWVADLPDGLDTLVGEGNHVLSTSQSQQIALARVLLADPAVVILDEATAGSGPRRSGHE
FT                   EVSVASVLAGRTRITITHQLAAALTADRVAVIEEGRISEVGPPAELLAREGSLSRLWQM
FT                   AGGIV"
FT   gene            136514..136828
FT                   /locus_tag="Ksed_01300"
FT   CDS_pept        136514..136828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01300"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05221"
FT                   /db_xref="GOA:C7NIZ6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ6"
FT                   /protein_id="ACV05221.1"
FT                   /translation="MWERESLIAPGRDKFGYRVYHDADVQAAIVVQTLRGAGLGIPRVR
FT                   EVMAGAKRGSGVQDLMRALNQRENELRVQKRRAARGVSSVHRYLEMSQPSPAGSGCGCD
FT                   "
FT   gene            136845..137861
FT                   /locus_tag="Ksed_01310"
FT   CDS_pept        136845..137861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01310"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05222"
FT                   /db_xref="GOA:C7NIZ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ7"
FT                   /protein_id="ACV05222.1"
FT                   /translation="MPCRGGHAGSLTLMTPDEPPALLRQVALPRDLGDGLVLEPLGPEH
FT                   AADFARLVEANREHLGRWMTWVWSPFGEEAAAAEVARLSAWEEGARTVAFAVVRDGCMV
FT                   GFAQLFGIGCFHLGAEVSYWVGRAEAGRGVATAVVRELCRLGFDDLGLHRIELRCAVEN
FT                   VASQRVAEKAGFQCEGVLRDAWRVRDVWQSLVVYSRLAGDATRVRGGVGQVGGNPTMTA
FT                   QDLNDVLELERELQSPSARGDAHRLAELLSPEFVEIGASGRRWDRAAILGLLSQEPSDS
FT                   DRPLIEMSNLEARTLSPGLVQVFWDSDQGGRRARRTSLWRSAPAGWQQVYHQGTLLP"
FT   gene            complement(138090..139055)
FT                   /locus_tag="Ksed_01320"
FT   CDS_pept        complement(138090..139055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05223"
FT                   /db_xref="GOA:C7NIZ8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ8"
FT                   /protein_id="ACV05223.1"
FT                   /translation="MDRKSIVIRLDSSDVASARFTTSPAHELVRIVRALVAPARFPAHR
FT                   ALLRDVRAAAPTTSLATLTQVITARGYVPDFLTPMTEDPAVVAELIRATPAEEITAQLG
FT                   ELVQDGRADPTTVSRLADDPDGTAAALAEAVDALWQEAIEPLWPAMRQVLLADIHARAA
FT                   SVASAGFGAMINGLHPTLMWTGQAIVRTSSRYADDTGPGRALILVPTIFGWPNVQTSTD
FT                   PARPPTVLYPARNATSDWASPPTQALDRLVGRTRARALAHLDFPAATSDVAHALGIALS
FT                   TAHHHLDVLASAGLVDRHREGTTVWHLRTPLGDRLVRAPR"
FT   gene            139117..139515
FT                   /locus_tag="Ksed_01330"
FT   CDS_pept        139117..139515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05224"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIZ9"
FT                   /protein_id="ACV05224.1"
FT                   /translation="MPYASEPVASPFGYGIHHVQLAIPPGAEDEARSFYVDLLGLLEVA
FT                   KPPVLAARGGLWVRADRLEIHLGIEQDFRAAAKAHPGILVTDLDALDGHLTGQGVATTW
FT                   DANFPGMRRFYVHDPFGNRIEFLQPAVE"
FT   gene            complement(139529..139786)
FT                   /locus_tag="Ksed_01340"
FT   CDS_pept        complement(139529..139786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01340"
FT                   /product="toxin-antitoxin system, toxin component, Txe/YoeB
FT                   family"
FT                   /note="PFAM: Plasmid encoded toxin Txe; TIGRFAM:
FT                   toxin-antitoxin system, toxin component, Txe/YoeB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05225"
FT                   /db_xref="GOA:C7NJ00"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ00"
FT                   /protein_id="ACV05225.1"
FT                   /translation="MRLVWDENAWEDYLWWQAQDRKVLKRINTLLKDVARNGNEGTGKP
FT                   EALKHSLAGYWSRRITDEHRLVHKVTEDEIRIAACRYHYG"
FT   gene            complement(139788..140045)
FT                   /locus_tag="Ksed_01350"
FT   CDS_pept        complement(139788..140045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01350"
FT                   /product="prevent-host-death family protein"
FT                   /note="PFAM: Phd_YefM; TIGRFAM: prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05226"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ01"
FT                   /protein_id="ACV05226.1"
FT                   /translation="MKTLSYTESRRRYAEVLDHVVDDREEVVITRAGHEPVVIVSLEEY
FT                   ESLRETAYLMRSPANARRLLDAMDRLEAGGGTEHELIETD"
FT   gene            140155..140691
FT                   /locus_tag="Ksed_01360"
FT   CDS_pept        140155..140691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01360"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05227"
FT                   /db_xref="GOA:C7NJ02"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ02"
FT                   /protein_id="ACV05227.1"
FT                   /translation="MLPDPLGAAWPRRDAELTLRPVTLGDVDAMVTYRSHPEVVRYLMH
FT                   DVLERDAVAARVEERTGPVEPGATKVVRGAVIELEGRVVGDVMMAVKRRESGDDELWIG
FT                   YALHPDLWGRGLATRVVRLLVSLADEMGLVACAHTRPGNVGSERVLAKGGFECVGEDEA
FT                   DGMLRRVWRRPGWEG"
FT   gene            140695..141084
FT                   /locus_tag="Ksed_01370"
FT   CDS_pept        140695..141084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01370"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05228"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ03"
FT                   /protein_id="ACV05228.1"
FT                   /translation="MRFGYEVFHDDVRVPARFYVSVLGFTLDGPEGLTESTDYCTVTRD
FT                   GLTVGCSRMVGAPTTPRKPPVGSEIVLRVEDVHREHDRVRAAGWPVEDPLQERPWGLTD
FT                   FRVFDPTGQYLRITSSHGAASPSVA"
FT   gene            141262..142398
FT                   /locus_tag="Ksed_01380"
FT   CDS_pept        141262..142398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01380"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase-like
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05229"
FT                   /db_xref="GOA:C7NJ04"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ04"
FT                   /protein_id="ACV05229.1"
FT                   /translation="MDVIVIGGGIAGLATAVGLARAGRAVTVLERRERIEELGAGVILW
FT                   PNALRALGELGLREQVHGVAELEAVGGFRRPDGTWLNRLDGRRFSAAHGEVAAIHRGDL
FT                   IDLLHEAAVEAGAEIRCGQAVAAVEPDPGGGAIVVMEDGRRVSAELVIGADGLRSAVRE
FT                   AAFPAAGAPRSTGLTAWRWVVDAAASGLPAPLVPSVTIGAGTELGVVPLPGGRAYCYFS
FT                   SVRRPDGATPGPELGREWHDPVPALVAAGEAGGMLCHELWDLPPMPSFVHPELPVALVG
FT                   DAAHAMTPHLGQGAAQGLEDAAALARLVKTTGDARELLGAYDRERGDRARAVQRASRQA
FT                   MGALTITHPALVAVRDTLIRLLPGVVVERAMARWVRTG"
FT   gene            142474..142959
FT                   /locus_tag="Ksed_01390"
FT   CDS_pept        142474..142959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05230"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ05"
FT                   /protein_id="ACV05230.1"
FT                   /translation="MEDEISAGWAGVDQADPTATIEYFRAWRDRDPGSGVLTFELASAY
FT                   DWAGREQEAIPLYEQAIRSGLAADRDRQARIQLGSSLRNVGHPAEAAEVLRGAVADYPD
FT                   SGAAVCFLALALAELGEGREATGRLITLVTERQVDDDVADYRRPLSAYAQELWAEGG"
FT   gene            complement(142997..143974)
FT                   /locus_tag="Ksed_01400"
FT   CDS_pept        complement(142997..143974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01400"
FT                   /product="uncharacterized conserved protein (DUF2332)"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2332)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05231"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ06"
FT                   /protein_id="ACV05231.1"
FT                   /translation="MRSVEGDLPTRDFYRNFAAHEAGDSPVFTAWAAGVAEDDEVLALL
FT                   TELPEPKRQPNLVFAAARAHGAEASRPDYAPLRKVLTTRWPAVRSTIESRSTQTNEAAR
FT                   CATLLPALSRVEGPVALLEVGAAAGLCLLPDRYSYRFTGDAELTLDPVDGPSSVVLECE
FT                   LRGLPAPERLPEVVWRGGLDLNPLDVRDREATDWLETLVWPEHEERRERLRAAVGVARS
FT                   EEIHLVRGDLLAGLPALVAQARRAAPGATVVVQHSAVLAYVPPRVRAEFADLVRAEADL
FT                   WLANEGASILPGMPRSPRASSFVLAQDGTPAYFTHHHGRWAQAL"
FT   gene            complement(143979..144680)
FT                   /locus_tag="Ksed_01410"
FT   CDS_pept        complement(143979..144680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01410"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05232"
FT                   /db_xref="GOA:C7NJ07"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ07"
FT                   /protein_id="ACV05232.1"
FT                   /translation="MSTPHPPDDTRRRAGHWLDRLNARHPWNHNEAFHPWILTRLPARR
FT                   GRALDLGCGRGELAALLAERFEHVHGTDIDPAMREAATRRCAGLPNVSIDDARLGQLAE
FT                   GEGVDLVTMVAVLHHLDLDEALRQVAAILRPGGRFLCVGLARPAGPGDLAWEAASVVTN
FT                   PVIGYVRHPWVSQGPPPWGKVPMADPAESVGAIRRAARTALPGARIRRRLGFRYTLEWT
FT                   NPGVPGRAAVA"
FT   gene            complement(144787..145476)
FT                   /locus_tag="Ksed_01420"
FT   CDS_pept        complement(144787..145476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05233"
FT                   /db_xref="GOA:C7NJ08"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ08"
FT                   /protein_id="ACV05233.1"
FT                   /translation="MTEDSGATAITHGRPRGRRLSGCLWAVIGAVVALALLLAAVALFG
FT                   GSLLSRWSLFETETVDRTGPSVLKQLEDIEEFHAATGYFETVVDLEKDTEHLPGWISGE
FT                   RILYVGKGEVDAVVDFSGLGEQSVTVSEDGSTVEVSLPEPVLDEPSLDVEESYVVEHDR
FT                   GLADRFKGSELEAEAQKKAVEQMREAASGGDTGMVQRAEHNTTAMLESLLGAAGFETVE
FT                   VTYDAKG"
FT   gene            complement(145514..145627)
FT                   /pseudo
FT                   /locus_tag="Ksed_01430"
FT   gene            145664..145927
FT                   /locus_tag="Ksed_01440"
FT   CDS_pept        145664..145927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05234"
FT                   /db_xref="GOA:C7NJ09"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ09"
FT                   /protein_id="ACV05234.1"
FT                   /translation="MALVWSFLDARSGRSVFWVLLVWAVVGLVLGALGALQAQGLDDPL
FT                   DRGILLDDLKGLPLMGGLLTLVPALVGAMVGWVIRGLGGSGR"
FT   gene            145997..146668
FT                   /locus_tag="Ksed_01450"
FT   CDS_pept        145997..146668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01450"
FT                   /product="predicted O-methyltransferase"
FT                   /note="PFAM: O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05235"
FT                   /db_xref="GOA:C7NJ10"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ10"
FT                   /protein_id="ACV05235.1"
FT                   /translation="MYESEKLWRDVDEYFVRELCPEDDALTAARTSSRDAGLPDHEVAA
FT                   NQGQLLALICQMIDARRVLEFGTLAGYSTIWLARAVGAEGRVTTLEVDETAARVSRENF
FT                   ERAGVADRIDLLPGPATESSAGLVRDGVEPYDLVFIDADKANNLAYLEAALVLTRPGSV
FT                   IVGDNVVRNGAVVDPASEDPRVRGSRSLIEAIGRDDRLDATALQTVGSKGWDGFVLARV
FT                   R"
FT   gene            146695..146982
FT                   /pseudo
FT                   /locus_tag="Ksed_01460"
FT   gene            147102..148025
FT                   /locus_tag="Ksed_01470"
FT   CDS_pept        147102..148025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01470"
FT                   /product="asparaginase"
FT                   /note="PFAM: Asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05236"
FT                   /db_xref="GOA:C7NJ11"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ11"
FT                   /protein_id="ACV05236.1"
FT                   /translation="MTHPEVQLTHLPAGDGPALALHGGAGVDPASLTDERTVACHEVLE
FT                   QAVRAGRSVLDAGGPALDAVCASVQVLEDSEYFNSGRGAALTTEGVAELDAAVMTGDSR
FT                   AGGVTCATGPRNPVLAARAVMEHTDHVLLSDPSVDLLTEWGLKLVGPEYYLTAERQQML
FT                   AETGSFTEYRHGTVGAVARDAHGHVAAATSTGGIAAQLPGRVGDTPVVGAGTWADDATV
FT                   AVSCTGTGELFLRGVVAHDVHARLRWGGQALDQAVREVLDEYLAERGGDGGLVAVTPSG
FT                   EVVLAFNSPGMHRGYDIGQGPVTGIG"
FT   gene            148129..148863
FT                   /locus_tag="Ksed_01480"
FT   CDS_pept        148129..148863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01480"
FT                   /product="PAP2 superfamily protein"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05237"
FT                   /db_xref="GOA:C7NJ12"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ12"
FT                   /protein_id="ACV05237.1"
FT                   /translation="MSFLRRALGLPVLAAAFVVLTALALGPLQPLDRALQGSWSDERTP
FT                   YATDLFMVLDNVAGQAVALPVLALTALWLAVRGRTWSPVRLVVLVEAAFFGGVGLLKVL
FT                   LARGSTGMGDPRFFVGQLEGTSWEGIAYPSGHAAEAVLLYGAVVHLLCTHLQPGRATRI
FT                   VLHLGWVGVMLLATGVSFWLGFHWTTDLVAGLLVGGMLLHLVLVAHRWWDDRAPRVLLP
FT                   AQLDGRDEELTAGSDRTPAARA"
FT   gene            complement(148823..150205)
FT                   /locus_tag="Ksed_01490"
FT   CDS_pept        complement(148823..150205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01490"
FT                   /product="penicillin-binding protein, beta-lactamase class
FT                   C"
FT                   /note="PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05238"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ13"
FT                   /protein_id="ACV05238.1"
FT                   /translation="MSHDAPQTQDGLRRSTTRELHRIALEGQSTGRVPALFAGVQRGGE
FT                   LVWSEGIGTTGGGEGRDRAATADDQYLVASNTKTFTAVMIMQARDEGRLSLDDHLGDHL
FT                   PGGTPSPAHAATIRSALAHVSGMQREPHGDVWETLAFPDAERLVQEYAQAERVGPSHTR
FT                   WHYSNLMYCLLGEVVAHLDGRSWAESLQARLLDPLELRRTTVGFSGAQVQGYFVPPFSD
FT                   VPLVEPVPEFRGTAPCGGLASTPSDMARWSGFVADPDEAVLAPDTLEEMTQPQTVIDPR
FT                   GWSATMGLGFFLMRRDKRIWVGHTGGMPGHITGVFTHRESGTGGLVFMNNSNSPDPAAL
FT                   AIDLGEALESAEPAAGEPWTPGESVPEELTGVLGHWYTEGSHVVFSVRQGALEARMAGA
FT                   PKEAPPAVFERVEADLYRTVSGRERGEMLRITRREDGTVLKMNWATYLVTREPLAFGQN
FT                   PQ"
FT   gene            150338..150799
FT                   /locus_tag="Ksed_01500"
FT   CDS_pept        150338..150799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01500"
FT                   /product="thioredoxin"
FT                   /note="PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05239"
FT                   /db_xref="GOA:C7NJ14"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ14"
FT                   /protein_id="ACV05239.1"
FT                   /translation="MATVELTAENFEQTIKDNPMVVVDFWATWCGPCTQFAPVYDAASE
FT                   KHQDIVFGKVDIDAQPQLAGALGIQSVPTTMAFREQIGVFAQPGAMPATALDEVLEAVK
FT                   GLDMDEVRAQVEAEQAAAQQQAPQAQQSTTPADAGTRSAGGADPANPFT"
FT   gene            150970..152556
FT                   /locus_tag="Ksed_01510"
FT   CDS_pept        150970..152556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01510"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="PFAM: Mur ligase family, catalytic domain; Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramyl-tripeptide
FT                   synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05240"
FT                   /db_xref="GOA:C7NJ15"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ15"
FT                   /protein_id="ACV05240.1"
FT                   /translation="MTHVSPAGGASVPRAAYAGRVLTRADVATALRLPEAAVPEAFAGS
FT                   PGIAAVTHDSRAVEPGAAFVAVSGFKSDGLRFAASALAGGASLVVAEREWPTAADREAD
FT                   PQIGEIEGAGPLPVVVVPNAREALGLLAAAVNGNPSRSMRVHGITGTNGKTTTSYVLYN
FT                   LLAGILGKDKVGLSTTVEVIIDGVGRPAMRTTPEAPLVQENLRRMVGAGASDAVLETSS
FT                   HGLELHRVTGVEYASAIFTNLTRDHLDIHGDMETYFQVKRQLFERTEGPRLANVDDDYG
FT                   RRLAREFPGSLTFGYSPEADYQIVDPTDLTLEGMQFTLRTPGHGELRLEPPLVGDYNAL
FT                   NVAGAVAVALESGHDPLAVVDAVKGLGQVPGRFQRIAEAADHGFMAVVDYAHTEVGLEM
FT                   VLTVARKIADMAGGRLICVYGAAGERDAAKRPLMGEVVSRIADVGIITTDDPYGEDPVT
FT                   IADEVMAGADPADTHIVVDRREALLEAVAMARENDLLIACGKGDEPFQHLPEGDVDHHD
FT                   PTSIREGLSLR"
FT   gene            complement(152641..153720)
FT                   /locus_tag="Ksed_01520"
FT   CDS_pept        complement(152641..153720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01520"
FT                   /product="enoyl-CoA hydratase/carnithine racemase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05241"
FT                   /db_xref="GOA:C7NJ16"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ16"
FT                   /protein_id="ACV05241.1"
FT                   /translation="MATDLTPTPETDDVLVGVRDGIARIHLNRPKALNALTHDMCAAML
FT                   GQLREWDAAEGEQRPRAVVVSGEGEKGLCAGGDIKVLREAATSGEVGPARDFWRTEYEL
FT                   NQLIADYPIPYVPLMHGAVMGGGIGISAHGSHRLVAADAKVAMPETGIGLFPDVGALYL
FT                   LARAPFELGTHVALTGDRFSGADAVVLGLADAVAPAEFLDPEAVVDRLAGGESADDLVA
FT                   AAREAGGEPEAPLLSQAAWTAECYEGEAAGAILERLRGHDAEGAQKAAELLESRSPLSV
FT                   NVTLAGLRAAAGDTLAGVLEQDLERATGMILSGDFAEGVRAVLIDRTNDAAWRHPSIAE
FT                   VPADDVKAVLAGERLDQED"
FT   gene            153998..154180
FT                   /locus_tag="Ksed_01530"
FT   CDS_pept        153998..154180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05242"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ17"
FT                   /protein_id="ACV05242.1"
FT                   /translation="MFFRLTGPGLEDDGGLKPDQHLDVIGDDAWIVTEGEEQSRQVACP
FT                   ALGAALEDPFEGHTE"
FT   misc_binding    154277..154404
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element)"
FT   gene            154607..155992
FT                   /locus_tag="Ksed_01550"
FT   CDS_pept        154607..155992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01550"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="PFAM: RibD C-terminal domain; Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region; TIGRFAM:
FT                   riboflavin biosynthesis protein RibD; riboflavin-specific
FT                   deaminase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05243"
FT                   /db_xref="GOA:C7NJ18"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ18"
FT                   /protein_id="ACV05243.1"
FT                   /translation="MGAELDGPPVVPHESPQLVAAMRRALDLAARGPAVDPNPRVGCVL
FT                   LDRDGRTLGEGFHQGAGTPHAEVAALLDAGCGPAAGPRPSGPVTHAGPRPSGPVTHAGP
FT                   RPSGPVTHAGPRPSGPVTRAGTPRLPAGATAVVTLEPCNHTGRTGPCAEALLDAEIARV
FT                   VIAQSDPTPLASGGAERLRTAGVEVVTGVLESEATALNRWFTASARLGRPVVTLKLAST
FT                   LDGRVAAADGTSQWITGGPARLDVHRQRATAGAIVVGTGTALADDPKLTVRLPAAELAA
FT                   PAVESDPAPEAGPAPSATPSTDAAPAPDATTAPTPRQPLRVVVGTRELPASARVFDDAA
FT                   ETISLRTHDPAEVLRVLSDRGIHHVWLEGGPTLAAAFLRAGLVDRLVHYLAPALLGAGP
FT                   SLIGDLGIGSIDGIDRWHLEDVTHLGDDLRLTLVPAAGLTPGIPATPATPGIPATPATP
FT                   EGA"
FT   gene            155994..156608
FT                   /locus_tag="Ksed_01560"
FT   CDS_pept        155994..156608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01560"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="PFAM: Lumazine binding domain; TIGRFAM: riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05244"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ19"
FT                   /protein_id="ACV05244.1"
FT                   /translation="MFTGIIEELGRIEVIDPAGDDVRLTVHGPLVTSDASRGDSIAVNG
FT                   VCLTVTDLGEAGDSASPARFTADVMPETLTHSSLGALTPGSPVNLERAVRVDARLGGHI
FT                   VQGHVDGVGTIADRTPGDRWEVVRVSIPVALARYVVDKGSITLDGVSLTVSGVGTDWLE
FT                   VSLIPETLARTTLGTAAVGSPVNVEVDVLAKYVEKLVGGTR"
FT   gene            156605..157960
FT                   /locus_tag="Ksed_01570"
FT   CDS_pept        156605..157960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01570"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: GTP cyclohydrolase II;
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; TIGRFAM:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05245"
FT                   /db_xref="GOA:C7NJ20"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ20"
FT                   /protein_id="ACV05245.1"
FT                   /translation="MTGQPTSSAAHPGPAGQPPSPADLTHPVADPAHLTPELAAALEAL
FT                   QAGRPVLVLDDEDRENEGDVILAAQTLTPEWLAWTIRHTSGYVCAPLTAERADALALPL
FT                   MVRDNADPFRTAYTVTVDAAAGVTTGISAADRAHTLRTLADADSVATDLIRPGHIVPLR
FT                   ARAGGVLERAGHTEAAVDLCRLAGLEPVGAIAELVHGDGSMMRAPAVRELAAEHGLPVL
FT                   TIEALARWRSVHDRLDAVAVAQLPTAHGPFVVHAVADRVTGVEHLALVAPGASGGPAVP
FT                   GAPGDPAAPGAPAPVPVRLHSECLTGDALGSQRCDCGAQLDAALADAQARSGIVLYLRG
FT                   HEGRGVGLAAKIAAYARQDAGADTVDAQHELGLPVDSRDFAVAAAMLAHLGVDRIELTT
FT                   NNPAKVSALQSLGVEVAATRPSIVGVTPHNLGYLRTKRDRMGHTLPGDLGVT"
FT   gene            158061..158591
FT                   /locus_tag="Ksed_01580"
FT   CDS_pept        158061..158591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01580"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05246"
FT                   /db_xref="GOA:C7NJ21"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ21"
FT                   /protein_id="ACV05246.1"
FT                   /translation="MSASGSPTDLIAQRLQRELAADRADGALPLRVAVVAASWHDEVMD
FT                   GLLAGAERALSQLGITPRVIRVPGSFELPVAAGRVARHVDAVVALGVVIRGGTPHFEYV
FT                   CQAATSGLTDVSVRTGTPVGFGVLTCDDEQQALDRAGLEGSREDKGAEAALAAVDTAAT
FT                   LRRAKGTWRSDAR"
FT   gene            158588..159322
FT                   /locus_tag="Ksed_01590"
FT   CDS_pept        158588..159322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01590"
FT                   /product="nicotinamide mononucleotide transporter"
FT                   /note="PFAM: Nicotinamide mononucleotide transporter;
FT                   TIGRFAM: nicotinamide mononucleotide transporter PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05247"
FT                   /db_xref="GOA:C7NJ22"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ22"
FT                   /protein_id="ACV05247.1"
FT                   /translation="MSLLEQLFAAELHIEPWTILWREVVGNVFGFASALGGMRRRVWAW
FT                   PAGIIGNALLFTVFAGVWFANPQDTTLAGQAARQVFFIITSVYGWWMWSQQRRAQREAG
FT                   QTEPFTPRWATTAQRVQLGLFGLVGLVLCQWVFRQIGAGWPAPDWYYWADAWIFVGSIL
FT                   ATYAMARQWVEFWLLWIAVDLVGVPLLFHSGFIPSAVLYLVYGAFVAWGFVVWMRLARH
FT                   EKAPGEEALHGAETQAEPASLR"
FT   gene            159362..160288
FT                   /locus_tag="Ksed_01600"
FT   CDS_pept        159362..160288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05248"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ23"
FT                   /protein_id="ACV05248.1"
FT                   /translation="MGKASRRKNRDAKGPKLLAAPFEARPFKGLPNEPEWVAMREIIPA
FT                   ATASIRVKVPTGDLPEGAPAPAWTGLEPGSEHDVTLATVLPLAWPGLHRGEGDVLTALQ
FT                   TGSSTGDASRDIAQAILTSLANEPGQPTVSLPQAMAHTPRLQDILVSTEMTAELHETFG
FT                   FWISGDGDALDEAGQLSMERANEAIVPTERLDAVDSAFWCRMGDRAYVRWLLPHDEDAA
FT                   TTALARLKAAGEHTLGGESTLLGAFRGAGLLVPVFEVDPEIAAQEWNAPLGELAARLDA
FT                   RLGDDAPLTHDERRAREGFSSRQVTIR"
FT   gene            complement(160417..162033)
FT                   /locus_tag="Ksed_01610"
FT   CDS_pept        complement(160417..162033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05249"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ24"
FT                   /protein_id="ACV05249.1"
FT                   /translation="MLASGTEASGDHPTAVARELFAQAHATVDALLQSVADLGARADSL
FT                   STDDLEWLLQEVHVLVNRHDRIRIRALDVVRRTREAGGSHHDNDAQFTAGRTHTDPRGA
FT                   ARDTHLAKALGNQPPTPPPNGPKGAPPAGPEGAGELGDGTHGDHGPGGAPGDAPDTGAD
FT                   GVLSPTAAAWDAGLITREHALIITSALDDLPDHLTPGQRLTVEEGLVAKAQQVNPATLR
FT                   KAAKRALEALDLPEAEVDAHHDQLLHNQERAAWDAASFWMRDNHDGTWFGQFTLPELQA
FT                   HMLKKALEALTNPRRRTNNPNNPNNPKAGNGAAEGGVAPTGAGMAAPTGDGRFDRAVRD
FT                   QQRGQALAELIDHLPTDQLGTKINATVLIRTDLATLRGETDRAGITDTGTEISTSELRR
FT                   LASNAGLIPIVMNGTTIPLDLGRQRRFFTDSQRAALALVYDTCAAADCDRPFAWCEIHH
FT                   AQPWKPVHGPDGQLLHPGGGKTDLTNAIPLCGKHHRQLTDHRLTHTIHRDHHGKATITH
FT                   TWRKPGDPWNTSDPPTPDTHT"
FT   gene            complement(162367..162825)
FT                   /locus_tag="Ksed_01620"
FT   CDS_pept        complement(162367..162825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05250"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ25"
FT                   /protein_id="ACV05250.1"
FT                   /translation="MDGRAAASSEGELAPSEDEGLPPSEGDGAALLEEEGAGLDGLGEA
FT                   PASEGEADELGSSLGPASVGSLEGEPEGLASPAGLDSPTGPEELGEGGSGASSEQAASA
FT                   REPARAAVRSMCRVVFIRASKGSTSLLSHHGTTPGPGERFVHRIWVKT"
FT   gene            162824..163261
FT                   /locus_tag="Ksed_01630"
FT   CDS_pept        162824..163261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05251"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ26"
FT                   /protein_id="ACV05251.1"
FT                   /translation="MPPVAKENSEEGAEAFARWYVQTLAHLFRFPEKGVIEPYSEDSCQ
FT                   QCGTYEEVFAELVSAQQHQVGSTMNILGTYVGVADKPSTIEVVVAIEQGANRTVDANGV
FT                   TVRESDGVDGLGLRLNLHYAGGWRIDEIPTDPTAGDWVGRD"
FT   gene            163501..164139
FT                   /locus_tag="Ksed_01640"
FT   CDS_pept        163501..164139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05252"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ27"
FT                   /protein_id="ACV05252.1"
FT                   /translation="MCTEAEIKCDTAPGDGPWMVIARRELLTEDDSVQSTWEEIGSTCF
FT                   PEAIPGRSGQVADARIAKAFTVTKFALPVPATDPPRADPLVNKPVYFTTDFAEAGYESG
FT                   EIRTIPPGQMLGRDLKIVPELKNITYDYGDGTTHGPTTNTGAPYPDGTITHTYETTDPV
FT                   QPRITATYTGRYSLDGGPWRPLGIDVEVTGNPITLTPTEYTTELVQPPT"
FT   gene            complement(164426..164971)
FT                   /locus_tag="Ksed_01650"
FT   CDS_pept        complement(164426..164971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01650"
FT                   /product="guanyl-specific ribonuclease Sa"
FT                   /note="PFAM: ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05253"
FT                   /db_xref="GOA:C7NJ28"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ28"
FT                   /protein_id="ACV05253.1"
FT                   /translation="MWTARAILRILFACALAAIVIWGGGGIFSSLEDEENNQQEQDGGT
FT                   PGGSGDGATGANGRGGSGGADTAAGGGTAAGGTGIEPCDEGDLSREAADVIETIAEGGE
FT                   FAYPGKDGSTFGNREGLLPAEDRGYYAEYTVPTPGESDRGARRIVTGGDTTPRNGSSDP
FT                   EHWYWTADHYESFCEFSG"
FT   gene            complement(165055..165495)
FT                   /locus_tag="Ksed_01660"
FT   CDS_pept        complement(165055..165495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05254"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ29"
FT                   /protein_id="ACV05254.1"
FT                   /translation="MPTPHFPVTEFLSSGEPLAVVSPDQAEVAAAGARTADWTVLLAES
FT                   ADGSGLRALQAGLAESLDLPGAAAVNLDALADTLRDLPDRTPDAPGTLLVWTPAEGIGL
FT                   EDDGLATLLELLAETAAEGGTPRLAVLVSSAAVVRQLEEGEA"
FT   gene            165562..167109
FT                   /locus_tag="Ksed_01670"
FT   CDS_pept        165562..167109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05255"
FT                   /db_xref="GOA:C7NJ30"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ30"
FT                   /protein_id="ACV05255.1"
FT                   /translation="MSEPVQNALLITAVVCAVLALLIGLWLAFHVTSLRRQRFISARVL
FT                   AGAGAGDGQGPQRRSMASRQGEQRRYTAPAVRTGVDSVTMKRALDRAASRQEKSLAKMR
FT                   QEIDRTRAQVREELERTSRQVKEVSQGFDRVQQQASSDTQAIRQVSTDATQNLQRMTTD
FT                   VASLDERLVALQQQVAAAEERLQSAGLEELGAAQRQLDEWRQTVSQELDEATSHRATLA
FT                   EQAASDRTLLDTIDRGLGGVAGVVDELRRDTSTMQERATSLDERLVALQQQVAAAEERL
FT                   QSTGAGLEELGAAQRQLDEWRQTVSQELDEATSHRATLAEQAASDRTLLDTIDRGLGGV
FT                   AGVVDELRRDTSTMQERATSLDERLATLVGTTDTQAQRVEQLETGATQLGERTAGLDSA
FT                   LRALSESGDDLDRRLKKLEHTSESALTEVALVRYDAFGDMGGRMSFSVAMLDGVGDGLI
FT                   ITSLNGRSHSQTYAKSVTEGRGTTRLTAEEEQAVAAARGVETTNAPEQAVRPLRQRR"
FT   gene            complement(167208..168200)
FT                   /locus_tag="Ksed_01680"
FT   CDS_pept        complement(167208..168200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01680"
FT                   /product="sphingosine/diacylglycerol kinase-like enzyme"
FT                   /note="PFAM: Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05256"
FT                   /db_xref="GOA:C7NJ31"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ31"
FT                   /protein_id="ACV05256.1"
FT                   /translation="MPTTAEATGRDGVGRQRAGFVINPIKFDDVDDVRRQMERICAENG
FT                   WDEPLWLETTEEDPGAGQAREVLDAGCDLVVPIGGDGTVRTVASQLVGTKVPLGLVPGG
FT                   TGNLLARNLDLPVTSREDALNLALTGADRRVDVGQVRYWDTDGETHEEYFLVMGGVGMD
FT                   ADVMESTDDEVKKRFGWMAYARSAVLLGYDTPVPASIRTGEDEPVHKKIRSVLFGNVGK
FT                   LQGGVAVLPEARIDDGQLDTLVVAPRGITGWAGVVAGMVTRGSVGGGNVSYHQGTQVDV
FT                   QLATPTRAQVDGDGVGYVTRIAGRIVPEALTVRVRPEGQRGARRAGSAA"
FT   gene            168242..169522
FT                   /locus_tag="Ksed_01690"
FT   CDS_pept        168242..169522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01690"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: tRNA synthetase class II core domain (G, H, P,
FT                   S and T); Seryl-tRNA synthetase N-terminal domain; TIGRFAM:
FT                   seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05257"
FT                   /db_xref="GOA:C7NJ32"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ32"
FT                   /protein_id="ACV05257.1"
FT                   /translation="MIDIRELRANPDAVRASQRTRGEDESVVDRVLEVEARSRSKQAEF
FT                   ESLRAEQKTFGKTIAQAPADQKAELAAQGKEMAARVKALEAEAGELAAEADRLLRTIGN
FT                   VVKPQVPAGGEDDFEVLEEVGTPRDFAAEGFEPRDHLELGELLGAIDMERGAKVSGSRF
FT                   YFLTGIGARLELAMMNMALDLALKNGFTPMITPSLVNPDVMAGAGFLDSHADEVYHLEA
FT                   DDQYLVGTSEVALAGYHADEILDLADGPRRYAGWSTCYRREAGSHGKDTRGIIRVHQFT
FT                   KLEMFIYCTAEEAETEHERLLALEKEMLGAMELPYRVIDVAAGDLGGPAARKFDCEAWV
FT                   PTQGKHRELTSTSNCTTFQARRLRTRERVAGGKGTQVVATLNGTLATTRWLVAILENHQ
FT                   LPDGSVRVPEALRPYLGGLEVIEPVGR"
FT   gene            169519..170346
FT                   /locus_tag="Ksed_01700"
FT   CDS_pept        169519..170346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01700"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IIB; Cof subfamily of
FT                   IIB subfamily of haloacid dehalogenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05258"
FT                   /db_xref="GOA:C7NJ33"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ33"
FT                   /protein_id="ACV05258.1"
FT                   /translation="MTGATRPLMVCLDLDGTTIDYDSVLHPEVRDAVLATSAAGHTVLI
FT                   ATGRTLMATLPLARELELTTGYLVCSNGAVVVRLHPELPDGHEIVEKVTFDPGPALALL
FT                   REHLPGAFVAAEVIGVGHRISEGFPQDLLQGELTLASWEELGSEPVTRLTFHDPGGTEQ
FT                   EFLDAIDDIGLHGVNYSVGYTAWLDLAPEGVSKASALEGVRRWLGVEPGDTLAVGDQRN
FT                   DLEMLDWAARGVAMGQAPAEVLAAADEVTGHVDDHGLAQVLRSLEGVEAVLDR"
FT   gene            170343..171158
FT                   /locus_tag="Ksed_01710"
FT   CDS_pept        170343..171158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01710"
FT                   /product="rRNA methylase"
FT                   /note="PFAM: SpoU rRNA Methylase family; RNA 2'-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05259"
FT                   /db_xref="GOA:C7NJ34"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ34"
FT                   /protein_id="ACV05259.1"
FT                   /translation="MSPAPLHISSPANPRIKALRELRRRRAREATGSTLVEGYEELQIA
FT                   LAGGVRPRELYLCEELMADPAAQQDVVELASQRGAGIVTLSRAVFEKAAYREGPDGFLA
FT                   VVPTPGVALADLPQPDGPGLYVVAEHLEKPGNLGAILRTADAAGVDAVIAADPVTDWGN
FT                   PNVVRGSKGTVFSVPVATAPTPEVLDFLAGRGMTLVATTPHTEVLHTQVDLTGPVAIAV
FT                   GAEKTGLTASALEGATHRVRIPMVGRANSLNVATSAAIVVYEAVRQRLG"
FT   gene            171223..171876
FT                   /locus_tag="Ksed_01720"
FT   CDS_pept        171223..171876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05260"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ35"
FT                   /protein_id="ACV05260.1"
FT                   /translation="MRIDHVSFAAGPEGLDAAAARLGEALGIEVVDGGNHPRFGTRNMV
FT                   LPLADGRWVEVVEPLEHPVTDKVPFGQAVKARSEAGGGWLGWVVAMDDLSPVEERLGRD
FT                   SVLGNRHRPDGTELTWRQIGVKGLIADPQLPFFLRWDEGQKHPSEVGPSTATLASLQVA
FT                   GDPGRVRDWLGLSGEPGTDREDWEPEVSFDFVAPNGTPGLLSVTFQTQNGPVTV"
FT   gene            complement(171916..174105)
FT                   /locus_tag="Ksed_01730"
FT   CDS_pept        complement(171916..174105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01730"
FT                   /product="cation transport ATPase"
FT                   /note="PFAM: E1-E2 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05261"
FT                   /db_xref="GOA:C7NJ36"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ36"
FT                   /protein_id="ACV05261.1"
FT                   /translation="MGTRDAGYRVLGGRGLAGPGGGYPVARRRGEWAKYRSHIMAESSR
FT                   PAAETDPRDVLGNSSTPRTDERAPTTRRSTDRGVFAAVATVLLTLVALAAAFLVEAGPA
FT                   PAVLTAIPALGAWALAAPHAVADLRASWRSVLWLPVAAGVLSAVHGIAELATTGHTTAF
FT                   VGTTAAAAVLAVVPWAVRWARGRLLVRLLRMRRTLGVTATRIVESGGARRRTTVPRASL
FT                   EPGDEVLVPAGAVVPADLLVTDGEGLVTLQRLTHRADAHPVIPGDVVVAGAVPRNALVG
FT                   TVVRAGDDTAIARVLRPAQAALRQPSGPVLPVPPAPDAPVRAGAPARYREGVPRLPIQR
FT                   TTDKAAWWAVPLVLGVATVAGLAHGLLTDAGAGARVATAVLLAASPAAVLAAVPTALRA
FT                   ATLRGALLGLRMKGARPLQSARDIDLALVDPSSAIATGHPRLVEVLPMPGLDPDAALLA
FT                   AVSVAQDAEGPIARALSSAARARSMTPRPISDRTLRGAGMTARIKDVEVTLGTEDLFDS
FT                   IPPSLRPEPDDDAIVTYVGWGGRPTAMLRFRDRLRPGASEEVQRLLRADVVPHLMCAEP
FT                   AAVARRMAERVGVHASEVTGGLDDAGRVALVQEMLDEGHRVALLTRDTPDEAAVHADLV
FT                   IAPVWADEDNRVLAQVETVRPEMAAIADAVSLTRHTGAVVGQNVMLAAAYHAIAVVVVV
FT                   AGWVPPVGAAALSLVPLAGVLLGSHRVSVGTGTRV"
FT   gene            174195..174809
FT                   /locus_tag="Ksed_01740"
FT   CDS_pept        174195..174809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01740"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05262"
FT                   /db_xref="GOA:C7NJ37"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ37"
FT                   /protein_id="ACV05262.1"
FT                   /translation="MPADTLAPDHADHADRSESTVRSGAQVAVFAALIAALAVVPGLLI
FT                   FGGSVPVTLQTLGVTLAALALGPWAGAAAVLIYLALIAIGLPVGSGGAGGLGVLTGPTG
FT                   GYLVGFVLGAVVIGALARLAMRRGGRMVGLWLFVAGLAGLPVFYAVGVPWLKFATGMPW
FT                   GSAWQLGAAVFVPGDLLKAGLAAVIIAAVARALPDTLPSDR"
FT   gene            174824..175516
FT                   /locus_tag="Ksed_01750"
FT   CDS_pept        174824..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01750"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05263"
FT                   /db_xref="GOA:C7NJ38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ38"
FT                   /protein_id="ACV05263.1"
FT                   /translation="MSGPGPVIRFEDVSLTRQGRTALEGVSLTLTEPRVALIGANGSGK
FT                   STLARCIIGLDKPTAGRVEVNGLDVRRQARVVRREVGFLFSDPDHQIVMPTVREDLEFS
FT                   AGRRGWSAAQRADAVDAALVRAGLEGHADHPCHLLSGGQKQLLALAAVLMAGPSVLVAD
FT                   EPTTLLDLRNRRRVAAELMALEQQVVLVTHHLDLIEGVDRVVVLDEGRVVCDDRPEVSI
FT                   PFYERLMA"
FT   gene            175513..176142
FT                   /locus_tag="Ksed_01760"
FT   CDS_pept        175513..176142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01760"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ"
FT                   /note="PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05264"
FT                   /db_xref="GOA:C7NJ39"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ39"
FT                   /protein_id="ACV05264.1"
FT                   /translation="MSAIGVAVPGDSWLHRLPAGWKVGGLAVATLGMYLLGDWRAALGA
FT                   FAVSLLVLASARLPWEAVRLPLRMVLLLTVVLGVVQWAFVDAEHALRAAGRVGSAIVLA
FT                   WTVSLTTPVGAMMRVLQAVLSPLRRLGVDTDHWGLVVSMAVRSVPLMVAAAQSTNEARI
FT                   ARGRGLSVTSFAIPLVVRALRAAEMLGDALLARGYEPQGRQGKRRG"
FT   gene            complement(176152..176658)
FT                   /locus_tag="Ksed_01770"
FT   CDS_pept        complement(176152..176658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05265"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ40"
FT                   /protein_id="ACV05265.1"
FT                   /translation="MRVLVVGGTGMLLSTVEGLLADGHELWVLARRAPALEHPRLHPLL
FT                   VDYGDAAALDAALVAVTQEDGLFDGALVWAHSSAPHAPEVVARHVSGSFLHVLGSASAD
FT                   PSRPHPTPGWAGEGYRTVVLGFVAEGGRSRWLTNTEIAAGVLEAWRRRAARTVVGTVEP
FT                   WSARP"
FT   gene            complement(176877..177353)
FT                   /locus_tag="Ksed_01780"
FT   CDS_pept        complement(176877..177353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01780"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: MerR family regulatory protein; MerR, DNA
FT                   binding; TIGRFAM: redox-sensitive transcriptional activator
FT                   SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05266"
FT                   /db_xref="GOA:C7NJ41"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ41"
FT                   /protein_id="ACV05266.1"
FT                   /translation="MITPHDELTMSEVVRRSGVSASALRFYEARGLIKAERTATNRRIY
FT                   QRHVLRRLAVIRSAQAIGLSLSEIRAGFASVPTDRALTREEWQDLSAMWRETLEERIAA
FT                   LGELRDRLDGCIACGCLSLDTCPLRNPEDERRAEGPGPRAMPAVLALMNGTSAD"
FT   gene            177622..177792
FT                   /locus_tag="Ksed_01790"
FT   CDS_pept        177622..177792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05267"
FT                   /db_xref="GOA:C7NJ42"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ42"
FT                   /protein_id="ACV05267.1"
FT                   /translation="MAECPVQIETTLEAVHPVVEGAASFHVRVHRVHVAGDLVTPQGRG
FT                   QVPGSGVAILR"
FT   gene            complement(177797..179053)
FT                   /locus_tag="Ksed_01800"
FT   CDS_pept        complement(177797..179053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01800"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05268"
FT                   /db_xref="GOA:C7NJ43"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ43"
FT                   /protein_id="ACV05268.1"
FT                   /translation="MTAPHIVDPSGLLGEALAEASPDLMRSLLQDVINALLSADADAVA
FT                   GAEYGRPSAGRSAQRNGYRHRDLDTRVGTIDVAVPKLRSGTYFPEWLLERRKRAESALV
FT                   TVVADCYLAGVSTRRMDKLVKTLGINSLSKSQVSRMAESLDEHVEQFRHRPLDEAGPFT
FT                   FVSADALTMKVREGGRVINAVVLLAIGVNGDGHREVLGMRVATSETGAAWNSFFADLVA
FT                   RGLAGVRLVTSDAHAGLVEAIAAHLPGAAWQRCRTHYAANLMAVTPKSMWPAVKAMLHS
FT                   VYDQPDAAAVNAQFDRLLDYVSEKLPAVAEHLDAARADLLAFTAFPKDVWVQIWSNNPT
FT                   ERLNKEIRRRTDSVGIFPTREAIVRLVGAVLAEQTDEWAEGRRYLGLDVLARCRLNLVP
FT                   DTNTNTEEVTTSSLPALTA"
FT   gene            complement(179394..180764)
FT                   /locus_tag="Ksed_01810"
FT   CDS_pept        complement(179394..180764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01810"
FT                   /product="predicted transcriptional regulator with HTH
FT                   domain"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family;
FT                   Divergent AAA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05269"
FT                   /db_xref="GOA:C7NJ44"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ44"
FT                   /protein_id="ACV05269.1"
FT                   /translation="MSAERIAALLSRGEDQWFERKSGRIAPRDLAETLVALANAEGGTV
FT                   AVGLHAGQVDGVADDRANPLRQAAQDFTVPVVRAEVEEFQDPQGARILVYRVAPSQRVH
FT                   ETAKGDCFLRVGDESVRLRFTQRQELEHDRGPEPFDGTPSGAGLEDLDPAQVESYRTTL
FT                   GASTPEGLLRARNLLTPRGEVTVAGYLLLSEHPQERYPNAHVRVLRYLEDERGTGAGQS
FT                   LAADGDIRCEGPLPQQIEQATRTIAQMMPARRALTESGRFEALPLIPRDVWLEGLVNAV
FT                   VHRSYSLAGDHVRVEIFPSRMEITSPGRFPGLADPSDPQSIGRHARNPRIARVCADLGI
FT                   TQELGEGIRRMFVEMRRRGLTDPLYTQSPSAVRLVLSSADSVPEAVRSAVGKGALATLD
FT                   AMRLAGRPLGTGQVAELTGRSRPTVLRHLHRLREEGLVSWEGESAKDPRARWAVRGV"
FT   gene            complement(180905..182350)
FT                   /locus_tag="Ksed_01820"
FT   CDS_pept        complement(180905..182350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01820"
FT                   /product="Adenylosuccinate lyase"
FT                   /note="PFAM: Lyase; Adenylosuccinate lyase C-terminal;
FT                   TIGRFAM: adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05270"
FT                   /db_xref="GOA:C7NJ45"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJ45"
FT                   /protein_id="ACV05270.1"
FT                   /translation="MSMVDLSTLQPALALGPLDGRYRRQTAPLINHLSEAALNRMRLHV
FT                   EVEWLLHLTDARIFAGIEPLDDTERAGLRRIVEDFDGDDITALAEIEKETVHDVKAVEY
FT                   HLKKHLAQVLAGRGEEQVARTTELVHFACTSEDVNNLAYALMIQGSVQQVWLPAASGVV
FT                   DQVAAMARELRDVPLLSRTHGQTATPSTMGKELAVLAHRLGRQVRRIEGAEYLGKINGA
FT                   TGTYGAHVVAVPGADWPELSRTFVEHLGLTWNPLTTQIESHDWQAEVYADIARFNRVLH
FT                   NLCTDVWTYISMAYFAQVRGQGTVGSSTMPHKVNPIRFENAEANLEVSNALLDVLGTTL
FT                   VTSRLQRDLTDSSMQRNIGVALGHSLLALDNVRKGLDGLDAAPEQMAADLEANWEVLGE
FT                   PVQSTMRALAAQGVPGMEQPYERLKELTRGRRVDGDAMREFIRGLGLPAEDEARLVALT
FT                   PATYTGLASQLVNHLVTPSEAGR"
FT   gene            complement(182347..183729)
FT                   /locus_tag="Ksed_01830"
FT   CDS_pept        complement(182347..183729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05271"
FT                   /db_xref="GOA:C7NJE1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE1"
FT                   /protein_id="ACV05271.1"
FT                   /translation="MGEWGALEWVVALVLLGLVVGIVWFMTRGGAVQDRLSGRGQDHPE
FT                   IDEGDGYLPDEEGSRYDAGGQDAAEVADEGDRADDDRAVAADRDRRRDRDRANRPGKDA
FT                   RRKSAASREKTTTEREATEHPATDLFDQESDGPTTATAAGTTAGAAAATAGAHALGEDE
FT                   AADAGDDALVGTDATTAPEGDTSGPLGSVTDSDAEVEAGTVDEGDLSGSTGLREQDVLD
FT                   TTAQDAEKGAETGAEQDDPSDIEAGTSSDPGELHSIEAEDPDDVAFPGYEEQGASSHED
FT                   EADPADDQGVLGHDAELDAAADEDETTEVQDHEHLSDFTGPGSDGSDRLPADSSGGRPF
FT                   AVDEVDGDEADGDEDTSDTWDDVQPATGAGTVVEPGTVEPPEADFPADDEVPDVAPAPW
FT                   SDDESDHDEPGGPAPDEDESGDQQAPGVTATSTQEWLGRGEIPADMNTDNLDPYSTWQQ
FT                   GR"
FT   gene            183876..184325
FT                   /locus_tag="Ksed_01840"
FT   CDS_pept        183876..184325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05272"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE2"
FT                   /protein_id="ACV05272.1"
FT                   /translation="MTPRPHALHDALLSRVVGSAAFARSRSRSALVFGDPAAMERLCAL
FT                   AHDHLAALPGDQPPGVPADRLADAVQQSTAWVRHHAREVARGGLTPEQQGTLHLTRIRL
FT                   LLAALDFFVCDDDVVPDHHRHGLLDDVIALEWALAGMTRGAARAG"
FT   gene            complement(184361..185350)
FT                   /locus_tag="Ksed_01850"
FT   CDS_pept        complement(184361..185350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01850"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /note="PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05273"
FT                   /db_xref="GOA:C7NJE3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE3"
FT                   /protein_id="ACV05273.1"
FT                   /translation="MSPTLVLAVLAVLLTLGTPALLPLLPGLRRTPAAGLLLWQGCAVG
FT                   GFSAIVLLPVVAAHEFGGLFTANDTVHPWLVAAAAALSVALIARLLLAAHTVGTDLRTL
FT                   RRRHQEAVDLLDPRHREGDRLRVIDSPSPVAWCLPGRRARIVMSRAALEDLSVEELHGV
FT                   YLHERAHLRHRHDLVVEFFTVMDAAVPRALRHPRALAEVGLMVELLADRAAAREVGPVT
FT                   MGRALAHLGAGRALGRGRGPGQARDDDPCDGDDRGRGAGSVATRAPSPSAGVALTAGGH
FT                   LRATVVRVTALQEARRPHRAQAALVTTAAVVAALGPGAVAVTAAVTGA"
FT   gene            complement(185401..185796)
FT                   /locus_tag="Ksed_01860"
FT   CDS_pept        complement(185401..185796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01860"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05274"
FT                   /db_xref="GOA:C7NJE4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE4"
FT                   /protein_id="ACV05274.1"
FT                   /translation="MPNTASGLGDLEQAIMNHLWDTPAPQADGFTVRDVHETLGADRDI
FT                   AYTTVMTVMDRLSRKEFLTRTKQGRAYVYRAATSREDFVARLMRETLGDLRPTDRRAAV
FT                   LAFVDDAGADDVAALREALDRLESPTR"
FT   gene            complement(185928..189524)
FT                   /locus_tag="Ksed_01870"
FT   CDS_pept        complement(185928..189524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01870"
FT                   /product="cysteine export CydDC family ABC transporter
FT                   permease subunit/ATP-binding protein CydC"
FT                   /note="PFAM: ABC transporter; ABC transporter transmembrane
FT                   region; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; ABC
FT                   transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05275"
FT                   /db_xref="GOA:C7NJE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE5"
FT                   /protein_id="ACV05275.1"
FT                   /translation="MKPFDPRLLRLLPGTRKEVAAVAFPVVLQGVVAVLQALAVAWLAT
FT                   AVTASVYATLTGRPTPPAGLPDDPDPTLGQLGPFVVPSSLSTGSDAGSVTSLLAPALAV
FT                   AALLAVRGLLAGWVHHRSAVAGARVAGELREALAARWLAGGRGRSSTQLTAGVGQVEPY
FT                   VANFLPSLVAAAAVPVMVWLALAWVDLFSAVVVLLTLPLLPVFAALIGSSTANETARRW
FT                   RALDALAGHFLDVMRGLPTLVNLGRAEKQVRTIEEVGQRHRRATVTTLRTAFLTTAAME
FT                   LLSTISVAIVAVFVGLRLAHGDIGLMVGLAAILLAPEAYWPVRRVGADFHAAADGVETL
FT                   DAVLPLLEEPVRPRHPDAQGAADAPARATGDAPVRAEGVSLTHADGPTIALAQGWSLPA
FT                   AGLVAVTGPSGAGKSTLLWLLAGLVEPTRGQVVAPHSHLVTQRPYLPRGGVEAALRITP
FT                   AAARATDAELHGVVERVGLLPTIEQLPRGWETDLGDDGQGLSAGERARLGLARALLDDA
FT                   PVLLLDEPTAHLDADTAELVHRVLLEESARRLVVVATHRGELAHLAAWQVEVAAGRVAL
FT                   PVRGAGTGTAQTRPEPVAALEATLPVATAPEGAAHGGGRTASEPVPERAPEQVPGRDGE
FT                   RTPVVTTTPKLWRAALVGALSSLAGVALTATSGWLIVRAWEQPVVLMLMVAIVGVRTFG
FT                   LARPVLRYAERLDSHDVALDQLARRRAETYRRLVPLTPARLGRRGRARVLTGVVADLDD
FT                   VVMAAVRWWVPLVGALLTGLVAAALLAVLSPLIGLLVALQTLLVVGGSALVERRTAGAQ
FT                   QQELAARGRVWEAAHTAADRCDELRAVNAGGTALQTVVAADRDVVRWVRRRAAGQAAVR
FT                   AASWLLAGVVVAVAAVLAPSAGWGGPLVALLVLTPLALADVLGGVPDAVSAHSRARAAT
FT                   ERLEALLRQEPAVAQAGGPTQAGGPTQAGGPTQAEDSAQAEADAPVSAHPHLELADLTA
FT                   RWSGQAAPTVAGLDLDLAPGDRVALTGPSGAGKSTVLAVLARHLDPSGGDYTLDGVDVL
FT                   DLPLAVTRGTVAFQDDSPHVFSSTLRENLRTARPTATDAELEAVLADAGLGDFLDSLPD
FT                   RLDTMLGAGHRTVSGGEQARIGLARTLLSERPVVLLDEPVAHLDGPTARAVMQHLGTAT
FT                   AGRSVVLVSHRTEGHEWCDAEVRLESLVDARR"
FT   gene            complement(189535..190596)
FT                   /locus_tag="Ksed_01880"
FT   CDS_pept        complement(189535..190596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01880"
FT                   /product="cytochrome d oxidase cyd, subunit II"
FT                   /note="PFAM: Cytochrome oxidase subunit II; TIGRFAM:
FT                   cytochrome d oxidase, subunit II (cydB)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05276"
FT                   /db_xref="GOA:C7NJE6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE6"
FT                   /protein_id="ACV05276.1"
FT                   /translation="MELSIIWFVLIAVLWIGYFVLEGFDYGVGMLVPVLGRDADPAVAE
FT                   RKRRQVLNTIGPHWDGNEVWLLTAGGATFAAFPHWYATLFSGFYLPLLIILVGLILRGM
FT                   AIEYRHKQDDDTWRARWDKALVVGSFIPALLWGVAFTNIVVGVPIDADMEYTGTLWTLL
FT                   NPLALLGGLATLTVFLTHGALFVALKTVGEVRHQARGIALKVGLVAAVLTLAWMVWVMS
FT                   LTGDTLSWVLAVAGALVFVAGLALAAKSNEKGAFWCSFVAIALVVTALFVALFPDVMPS
FT                   STNAAWSLTHENASSSQYTLTIMTWVAVLLTPVVLAYQAWTYWVFRKRISTDDIPEPAP
FT                   IGTEATRELAEKG"
FT   gene            complement(190634..192073)
FT                   /locus_tag="Ksed_01890"
FT   CDS_pept        complement(190634..192073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01890"
FT                   /product="cytochrome bd-type quinol oxidase, subunit 1"
FT                   /note="PFAM: Bacterial Cytochrome Ubiquinol Oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05277"
FT                   /db_xref="GOA:C7NJE7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE7"
FT                   /protein_id="ACV05277.1"
FT                   /translation="MDALELARWQFGITTVYHFFFVPITIGLSFVVALMQTIWIRTRNP
FT                   EWLRLSKFYGKLFTINFALGLVTGIVQEFQFGMNWSDYSRFVGDIFGAPLAIEALLAFF
FT                   LESTFLGLWLFGWGRIPEVLHNAAIWLVHIGTALSAYFILAANSFMQNPVGYENNPETG
FT                   RAELVDFWAVLTNKVQLVTFPHVMAAATMTGAGLVVAVAGWHLWRKKFPKDAGMYRKAL
FT                   RLGAWMLLIGGLGTAVTGDIQGKIMTEVQPMKMAAAEGLYESDEHCADFSILTIGTPDG
FT                   EHEKFAITVPCVLSYLATGDFNGEVKGINELKEIYAEQYGNSGEARLEVSDYTPNIPVT
FT                   YWSFRWMIGMGMIGAAAAAALLWATRGDRTQLNSKWWFPATLLALFGPLLANSLGWIFT
FT                   EMGRQPWVVFGLMNTEDGVSPGVGATEVLISMLVFTLLYGALALVEVRLMVKYASAGAE
FT                   HVDAEKAQRLTADDEPHVFAY"
FT   gene            complement(192323..192922)
FT                   /locus_tag="Ksed_01900"
FT   CDS_pept        complement(192323..192922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01900"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Thioesterase superfamily; TIGRFAM:
FT                   phenylacetic acid degradation protein PaaD; uncharacterized
FT                   domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05278"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE8"
FT                   /protein_id="ACV05278.1"
FT                   /translation="MTWHDGLRSTASDGTDLGHVRGMWEVDGASRHMGIEVLDLDRVDG
FT                   LGQSVASMTITDTMVNGHGTTHGGMVFTFCDSVFALTCNSSGVTTVAAHCDIDFLAATQ
FT                   LGDVLVGVGTERFRWGRNGMTDVVVRRAPRAGERPAGSAATGQGAADGQGAGDGQGTAD
FT                   NAAPTPLRGGGPVPTDLETWPVVAVFTGRSKALPPR"
FT   gene            complement(192919..194280)
FT                   /locus_tag="Ksed_01910"
FT   CDS_pept        complement(192919..194280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01910"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase, C-terminal
FT                   domain; 3-hydroxyacyl-CoA dehydrogenase, NAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05279"
FT                   /db_xref="GOA:C7NJE9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJE9"
FT                   /protein_id="ACV05279.1"
FT                   /translation="MSSTEQTGTPQAHTDPSGSQDAPRYAVAVIGAGSMGAGIAQVAAQ
FT                   AGHEVHLVDVRDGAAAQAVEKLGATLRKLAGKGKISEADAEAAIGRLVVGPAANGDLAA
FT                   LPAMGLVIEAAVERLDVKQEVFSTLAEHQGADTILASNTSSLDIAAIAEGVAEPGRVIG
FT                   LHFFNPPPLMKLVEVIRGEQSSLQVLDAATELMRSWGKTPVRCTSTPGFIVNRVARPFY
FT                   GEAQRMAQRGSASPADLDLALTEYGGFAMGPFRLTDLIGQDVNYAVGHSVWQQTDQDPR
FT                   YEPTGFQDDLVQAGALGRKTGRGVYTYDDQGKPTDAEGDPFAARALARGPVETNVVART
FT                   IAMLVNEAVDLVHRGEASRRDVDTAMKLGTNYPKGPFEWLEELGAEKVLADLRVMDAAY
FT                   PTGRYRPSEALVAMVDASERGAGDRETGGPAAAGRGAGDRETGGHHTDEERERA"
FT   gene            complement(194430..195110)
FT                   /pseudo
FT                   /locus_tag="Ksed_01920"
FT   gene            195268..197016
FT                   /locus_tag="Ksed_01930"
FT   CDS_pept        195268..197016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01930"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   phenylacetic acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05280"
FT                   /db_xref="GOA:C7NJF0"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF0"
FT                   /protein_id="ACV05280.1"
FT                   /translation="MTETTAPTQATTTTPAIVPEGATALVEKHRDALTAATAALEARSF
FT                   HSRYNESPSPKVHGEDAAPNGLKAHEAHLGQKFSALESQPSTGQWVGSEKSPYGPELGA
FT                   SYPQLDVDAAMAAATTAQKAWRNAGPEARAAVCVEIIDRINARGFEMAQAVMHTSGQPF
FT                   VMAFQAGGPHAQDRALEAVTVALAEQRKVPESVIWEKPAKGEPIRMQKDYRVIGRGVGL
FT                   VIGCNTFPTWNAYPGIFASLATGNPVVVKPHPQAVLPLAITVEVAREVLAEAGFDAALV
FT                   QLAPEETGGTLAKDLALHPAVKIIDYTGGPGFGHWLETEAAAAGKLVYTEKAGLNTVIV
FT                   DSVETMRAATGNLAFSFSLYSGQMCTAPQNVYVKASGISTDEGELTAEEFAEKLGQTIT
FT                   AFNKDDAKAVEILGATVNDDVRGRANDFTGLASRLGGTPVLEPREVEHPAFPEAVVRTP
FT                   GIILLESDQRDAYSQECFGPVVFVIKTDSTEQSLRIATDTIQEHGAMTMAVYSTDEEVL
FT                   ADAREAAADAGVALSENLQGQVFVNQTAAFSDFHGTGANPAANAAYADAAFISNRFRVV
FT                   TTRRHV"
FT   gene            complement(197181..198755)
FT                   /locus_tag="Ksed_01940"
FT   CDS_pept        complement(197181..198755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05281"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF1"
FT                   /protein_id="ACV05281.1"
FT                   /translation="MDLVDGIGTRGAPTTSGAGDGLRGAGGVVGDPHAVVRVALEQANS
FT                   AADRLIDAVAQLGAHPEALDAATLERFVQDVQRLVNRHDRVRVRALDVVRRTREAGHAH
FT                   HDDDAQYTSGRTRTDTRRTHHDNTLARALGNQPRPPAAGLPGGADGGAGSGLGDDAGAA
FT                   PQLGDGAGAGSAQSPTAQAWDDGLINRDQALIITRALDDLPDHLSTEQRLAVETGLVAK
FT                   AQRMSLTRLRKAAQRALGELDLPQEQVDAHHNELVRNEENAAWEAANFWITDRGDGTMY
FT                   GQFTLPVLQGRMLEKALHALTSPRRLAHKKRARAEGTGLEGASWKDTQIDWAHERGKAL
FT                   AELINHLPTDKLGSKVNAILLVTTDLETLRGETDRAGVTDTGDAVSAEQTRHLAANAGI
FT                   IPLVMDGASQPLDLGRQRRFFTDTQRAALATKYTSCAERDCDRPFAWCEIHHDRPFHPR
FT                   RGPDGELLHRGGGRTDHANGIPLCGPHHHRTEDPRYTYTTTRDERGAATVTFRRRRPGD
FT                   PGEAVTR"
FT   gene            199035..201431
FT                   /locus_tag="Ksed_01950"
FT   CDS_pept        199035..201431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01950"
FT                   /product="Excinuclease ATPase subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: excinuclease ABC, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05282"
FT                   /db_xref="GOA:C7NJF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF2"
FT                   /protein_id="ACV05282.1"
FT                   /translation="MSVAREVVAARPYAGSVTENHTADRHDTIRARGARVNNLKNIDVD
FT                   IPKRRFTVVTGLSGSGKSSLVFGTLAAESRRLIDETYPSFVQQFMPANPRPDVDSLENL
FT                   SAAVIVDQERIGANSRSTVGTATDAAALLRIVWSHLSEPHVGGSQAFSFNVASASGSGI
FT                   LTVDKKNAKGETKKGEKATFEVIGGMCPACEGIGTVASLDEDLIVDRSLSLDEGALLVP
FT                   GYPVDSWGWRIFAESGKLDPAKKVADYSDDEWAWLMYQDATKVKIGDINMTYEGMVTRI
FT                   RRTWFGDREPKQAHIKAYKDAIATTAPCPECHGTRLNEAARTATVHGITLPEATAMQVD
FT                   ELAQWVKELDEPSLAPALAKLTGMLEAMVEIGLGYLSLDRTSSTLSGGEAQRIKMVRHL
FT                   GSSLTDISYVFDEPTAGLHPHDIEQMVGLLRSLRDAGNTVLVVEHKPAVITAADHVIDI
FT                   GPGSGTTGGEVVYAGPLDGLAGTDSVTAEHLDHRPTLRDEVRTPSGHLEIRGASTNNLK
FT                   GVDVDVPTGVLVAVTGVAGSGKSSLIHGSLGKRGDVLVIDQSPIKGSRRSNPATYTGLL
FT                   DPIRSEFAKANGVKPALFSPNSEGACPECKGAGVIYPEIALQNAAPTPCEVCGGRRFRD
FT                   DVLEYAFRGMSIADVFDLSVAEAVEVFTTGKAKTLLRRLLDVGLGYIRLGQPLPTLSGG
FT                   ERQRLKLAAQLKESDIFVLDEPSSGLHMADTAKLVDMLQGLVKGGATVIAIEHNLDVVS
FT                   QADHVIDVGPGAGHEGGEVVFTGTPAELTAADTATGRALKAATSS"
FT   gene            complement(201510..201929)
FT                   /locus_tag="Ksed_01960"
FT   CDS_pept        complement(201510..201929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05283"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF3"
FT                   /protein_id="ACV05283.1"
FT                   /translation="MSRKTGVRDLLALGVVTTAVLAGCSQDDCQAGRETPTEVVSALLT
FT                   ETGPEATVESVCEYSGEGFESKTSDWLNAVREQAGGADAASDLTVRELTGEQMARNHQV
FT                   QVSDADGPVATVTVWDVSEDGDRYLVQPHDEDIPR"
FT   gene            complement(202053..202241)
FT                   /pseudo
FT                   /locus_tag="Ksed_01970"
FT   gene            complement(202354..202611)
FT                   /locus_tag="Ksed_01980"
FT   CDS_pept        complement(202354..202611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05284"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF4"
FT                   /protein_id="ACV05284.1"
FT                   /translation="MPQLGQDGIFGIGPLEAGEEALWVQYTLVPQLDPVLARARELGAG
FT                   QVGEVMDLGFGRSAHLTTPAGAAFGLFEGSEEMREQMEQG"
FT   gene            complement(202718..203155)
FT                   /locus_tag="Ksed_01990"
FT   CDS_pept        complement(202718..203155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_01990"
FT                   /product="Protein of unknown function (DUF1428)"
FT                   /note="PFAM: Protein of unknown function (DUF1428)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05285"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF5"
FT                   /protein_id="ACV05285.1"
FT                   /translation="MTSDIRSGRGGPQGAACADVTMVPVAVNQREAYLAFEKRMAEVYR
FT                   DHGATQVTHYWHSGPPARQEDFHATGASPASASPGLAGVVGAGPGEAVVVTVTQWPSRA
FT                   ARDRGTAAATSDPRVLATLDEEPVFDGRRVIGETFEVVSRP"
FT   gene            complement(203155..203802)
FT                   /locus_tag="Ksed_02000"
FT   CDS_pept        complement(203155..203802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02000"
FT                   /product="uncharacterized conserved protein"
FT                   /note="TIGRFAM: uncharacterized Actinobacterial protein
FT                   TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05286"
FT                   /db_xref="GOA:C7NJF6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF6"
FT                   /protein_id="ACV05286.1"
FT                   /translation="MTTRREAPQATWPMVHAARGALVSDLERLQPAQWGHPTLCDDWDV
FT                   RHVTAHLTAAASTGRWSWLRSIAAARFRPDVHNDRRLQEHLGGSTEDTLGRFRAVVDAT
FT                   VAPTGDIAAWLGEVVVHAEDIRRPLGLEDTSDADAVAAVAAFFAARDFAVPSRSRTKGL
FT                   QLHATDSPFHSGTGPLVEGPTLSLVMVMAGRRSHLDGLTGAGVDQLAGRLED"
FT   gene            complement(203799..204299)
FT                   /locus_tag="Ksed_02010"
FT   CDS_pept        complement(203799..204299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02010"
FT                   /product="predicted esterase of the alpha/beta hydrolase
FT                   fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05287"
FT                   /db_xref="GOA:C7NJF7"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF7"
FT                   /protein_id="ACV05287.1"
FT                   /translation="MQMLFLHGAGGFQEDRELAERLTGAVGAELQMPECPDEDMSFEAW
FT                   ASVVRPAVGSLGADDLVVGHSFGGSILLGVLAEAAPEVRRGLVLAAPDWGVSGWDVAEY
FT                   APSGPPQGVRLSLHHCRDDEVVPVAHFAALAESVPGAAARVHPIGGHQFAGLEGDLMRE
FT                   MTR"
FT   gene            complement(204303..204995)
FT                   /locus_tag="Ksed_02020"
FT   CDS_pept        complement(204303..204995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02020"
FT                   /product="dihydrofolate reductase"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05288"
FT                   /db_xref="GOA:C7NJF8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF8"
FT                   /protein_id="ACV05288.1"
FT                   /translation="MTQRTRIHNLHVSLDGYAAGTFITREKPFGDALELMAGFDGRFIH
FT                   GMSDVDAPLTLERAMTTLWSQGIGAEIMGRGKFTPETGPWTDEGWRGWWGEEPPFSTPV
FT                   FVMTHHPRESMEFANGTVFHFVSGPPAEVLDQAKGAAGGLDVRIGGGPTSVRSFLADDL
FT                   VDVMHTVTVPVVLGEGTPLWDGLGGLQRRFSIEAVGSSDGVVHHLWNRWPRGVENASGE
FT                   ATPRTGGT"
FT   gene            complement(205082..205408)
FT                   /locus_tag="Ksed_02030"
FT   CDS_pept        complement(205082..205408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02030"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05289"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJF9"
FT                   /protein_id="ACV05289.1"
FT                   /translation="MYVDAPAQRLWTALTDAEETAIWWRHSSVSDWHVGSDWQHVRVDG
FT                   SGTVDGTGTVREASAPHRLAFTFPNAGDSRVAFDLAEHQGITRLTLTHTVLPSEHLRDA
FT                   VARV"
FT   gene            complement(205438..205812)
FT                   /locus_tag="Ksed_02040"
FT   CDS_pept        complement(205438..205812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05290"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG0"
FT                   /protein_id="ACV05290.1"
FT                   /translation="MTQPMEVTTVFVTRYVADHDEMAQWYARFLGRTWDAEPMLSCREW
FT                   HLGQEVFFQVIHDPDRAGETSFAFGARDLAGEGRRLTEMGLDPASSGDVAGFDDLRWMP
FT                   LTDPEGVETGVLNAGGVREG"
FT   gene            complement(205809..206612)
FT                   /locus_tag="Ksed_02050"
FT   CDS_pept        complement(205809..206612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02050"
FT                   /product="lactoylglutathione lyase family protein"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05291"
FT                   /db_xref="GOA:C7NJG1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG1"
FT                   /protein_id="ACV05291.1"
FT                   /translation="MTARTSTQRPGTPIWRDFWTTDPEGTAEFFRQLFSREVEPGLIAM
FT                   DIPAGGPEMGGYTTAQIDGRHVFGIGPALPCGVDVAAVFLATDDADVTHAKALELGATE
FT                   EIAPTTVPDHGRFSAIVDPAGALVAFYESHGMLGYGAVDELGFPCWQDLLTPDVAAAEA
FT                   FYGELFGFSFDHQMAPYSVAQLGQDGIFGIGPLEAGEEALWVQYTLVPQLDPVLARARE
FT                   LGAGQVGEVMDLGFGRSAHLTTPAGAAFGLFEGSEEMQTQMEAGQ"
FT   gene            complement(206612..207367)
FT                   /locus_tag="Ksed_02060"
FT   CDS_pept        complement(206612..207367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02060"
FT                   /product="lactoylglutathione lyase family protein"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05292"
FT                   /db_xref="GOA:C7NJG2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG2"
FT                   /protein_id="ACV05292.1"
FT                   /translation="MTARTTTQHPGTPVWRDFWTTDPEGTARFLTEVLGCTIRENGPEP
FT                   GYSVAELPQGAVCGIGPATAEEAPTDIAALFLASDDVDATHARALELGATEAIAPMDAG
FT                   PTGRFSTVVDPTGALVSFWQAGEQTGYAAVDEVGFPCWQTLYSTDADAARRFYGELFGI
FT                   EFGDDMPGYPIGGFGEDALFGIGPEASSSHWMQYVMVEDLDATLSTAVALGATETHRDS
FT                   APFGAWIDLRTPGGAAFGIFQTTDEQGEN"
FT   gene            207443..208099
FT                   /locus_tag="Ksed_02070"
FT   CDS_pept        207443..208099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02070"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05293"
FT                   /db_xref="GOA:C7NJG3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG3"
FT                   /protein_id="ACV05293.1"
FT                   /translation="MPSPPSDPGENPAPRGGYHHGDLRAALIEQAEAVAREKGPEALTM
FT                   RALTRQVGVSANAAYRHFADRAALVQEVTFRGQAAMARAMDAARAALPARADGAAHLTA
FT                   VGRSYIEAARAEPGLFRTAFTEPADLELSADPRAAGDSGLTPFLHLADALDRMVADGSL
FT                   AAELREGAEAPCWSAVHGFSMLVVSGPLRSAPAEVVDALAARTVATAVLGITQAP"
FT   gene            208142..208684
FT                   /locus_tag="Ksed_02080"
FT   CDS_pept        208142..208684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02080"
FT                   /product="Protein of unknown function (DUF664)"
FT                   /note="PFAM: Protein of unknown function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05294"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG4"
FT                   /protein_id="ACV05294.1"
FT                   /translation="MTTAAQNLTPDPPDTRPDQAFLAGDRENLEWWVELYRQTLPLKVG
FT                   GLTGEQLAQRAVPPSSLSLAGIVRHLTEVELYWCGEVVAGAEVPDVYFTPASPEGDFLD
FT                   AEAATAVQDVAAFSDAVDRARAWCAGVTDLDAPVAGTRHGNPVNLRWVYAHLIEEYARH
FT                   LGHADLLREVVDGRTGY"
FT   gene            complement(208678..209952)
FT                   /locus_tag="Ksed_02090"
FT   CDS_pept        complement(208678..209952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02090"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05295"
FT                   /db_xref="GOA:C7NJG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG5"
FT                   /protein_id="ACV05295.1"
FT                   /translation="MSALPLRGLLTAETFTITATRMSMVVIPWFVLVTTGSATQTGLVS
FT                   AAELLPLVVFKVLGGPLTDRLGPRRVACVCDLGSAAVFGLIPLLHLRGALPFWALLLLV
FT                   AAGGALRGPADGAKQAMIPGVTELARVPLERVTGYHGAIDRGSAMAGAAAAGLLITQLG
FT                   APRTLFVVAACFVLGAAALGATTAAASRPSAQRDTREPYLRSLLGGWDFIRHDAVLLGI
FT                   SGMVAVTNLLDLAWSAVLFPVWARETGAGAAGISLLLTVFSAAATVSSLAAARWAHRLP
FT                   RFRTYVIGFLVTGPVRFAVLTLGAPLWVVVTVFAVTGAASGFLNPILGAVIFERIPAGL
FT                   TGRVSALSASLGWSLMPLGGLLGGLLASGLGWRWALWALAGAYLVATLAPLVVPSFREF
FT                   DTRPAPPVLSDQADASWPAQEPAAQ"
FT   gene            complement(209962..210540)
FT                   /locus_tag="Ksed_02100"
FT   CDS_pept        complement(209962..210540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02100"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05296"
FT                   /db_xref="GOA:C7NJG6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG6"
FT                   /protein_id="ACV05296.1"
FT                   /translation="MTPPEISTPGPEGLRALSHPVRLRLLGLLRTSGPNTATGLAQHLG
FT                   VNSGATSYHLRQLAQHGFIEEDKGRGSSRERWWRAVHRSTRTSSKGLTPQERETFGAYQ
FT                   QAVAVVYSQQLQQVVEQAETLPAAWRRAGTTSDWMLRLTPERAHALRDALIEVITSWPE
FT                   EDVPEAQPYWVNLNAALSPHAMPPAPDQT"
FT   gene            210755..211954
FT                   /locus_tag="Ksed_02110"
FT   CDS_pept        210755..211954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02110"
FT                   /product="NUDIX family protein"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05297"
FT                   /db_xref="GOA:C7NJG7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG7"
FT                   /protein_id="ACV05297.1"
FT                   /translation="MTATSADQPPIVVTGVVVQDDAGRVLTVRKRGTERFMLPGGKPEP
FT                   GESPAQTGARELGEELGLRVDPASMQLLGAFSGPAANEPGRLLESTVFHARPEGEPRAA
FT                   AEIDELRWLPVDAGALDAEISPEFLAPMLADNVLPILRTARAEEAAIARLVDTAPEPGE
FT                   DIGTGGLVVETFGGRPDGVRPVTVLVHGGFWRPTIDRTHLRAAAHVLADHGFLVALPEY
FT                   RREPGNPRAALDDLLAVDDLLAADGWYDAPVAGIWVGHSAGGHLAMLRGLQPGRTPVGV
FT                   LSLAGAHDLTRTATEFLGHGAAVDWVGARPQEAPEAYAELDPRLLWPDAGRDHVMLVHG
FT                   SEDATVPPAHSEDFPAPSRIVPGAHHADLVDPDSPHWHHVHTAWLEVYAGMFQTSTPGS
FT                   "
FT   gene            212075..212485
FT                   /locus_tag="Ksed_02120"
FT   CDS_pept        212075..212485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05298"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG8"
FT                   /protein_id="ACV05298.1"
FT                   /translation="MSAGVMLRACIAPEDPEPIDLTAALAEAEADGPLLVPAGIPDDAF
FT                   VSWASQVEEDGVTRFAMQINRSPSGLARWCVVPQEHAETCAGGVSSGSVDGLFWSVSGE
FT                   VPTEGPLREGEPTTDWRGLDWVAENEARMGRD"
FT   gene            complement(212492..212647)
FT                   /pseudo
FT                   /locus_tag="Ksed_02130"
FT   gene            213123..213818
FT                   /locus_tag="Ksed_02140"
FT   CDS_pept        213123..213818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05299"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJG9"
FT                   /protein_id="ACV05299.1"
FT                   /translation="MSGPGGRDAEVEAFLPVPGQGGIVVRRVDDLGDQDLDDRASVRLR
FT                   KKGGEMAAAVERPGGEMQLLSQFNGPGDLETEYKISMPKSFRVEVLPGNQGVAFEDERG
FT                   QLVAGVAPAWAVTSSGNSLLTRFSWDEKQNVLTQEVEEVGLRPADYPVVTDPYLGKRLY
FT                   HKSTVTGTPQRYKVNAFVTAWGRTWTGRATFSYHKDEVRSQLGARANWYTGSIREQHYW
FT                   LFTNEGVVG"
FT   gene            213899..215206
FT                   /locus_tag="Ksed_02150"
FT   CDS_pept        213899..215206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02150"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05300"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NFM9"
FT                   /protein_id="ACV05300.1"
FT                   /translation="MLHPTFATPDLTTFCRLDELGLVAVGQLIEPDRATIECRVVEDDP
FT                   RCRKCGVEGVPRDTVTRPLAHEPFGHRPTTLLVRVRRYRCGHCRRTWRQDMTRAAAPRA
FT                   KISRGGLEWALRGIVIDHLTVTRVAAGLGVSWSAANAAVLAEGKRRLIDDPARFDGVTT
FT                   IGVDEHVWRHTRLGDKYVTVIIDLTPARNKTGPARLLDMVEGRSKAVFKQWLAARPADW
FT                   AKRIEVVAMDGFAGFKTAAAEELPDAVPVMDPFHVVRLAGDALDVCRRRVQQDTTGHRG
FT                   LKGDPLYKARRTLHTGASLLTDRQRARLDAVFASEEHVEVEATWGIYQRIVAAYREPDK
FT                   KKAKAMMQEVIAAISSGVPAALVEVRKLGRTMKQRAGDILAFFDRPGTSNGPTEAINGR
FT                   LEHLRGSALGFRNLTHYIARSLLEAGGFRPALHPRS"
FT   gene            complement(215469..216776)
FT                   /locus_tag="Ksed_02160"
FT   CDS_pept        complement(215469..216776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02160"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05301"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NFM9"
FT                   /protein_id="ACV05301.1"
FT                   /translation="MLHPTFATPDLTTFCRLDELGLVAVGQLIEPDRATIECRVVEDDP
FT                   RCRKCGVEGVPRDTVTRPLAHEPFGHRPTTLLVRVRRYRCGHCRRTWRQDMTRAAAPRA
FT                   KISRGGLEWALRGIVIDHLTVTRVAAGLGVSWSAANAAVLAEGKRRLIDDPARFDGVTT
FT                   IGVDEHVWRHTRLGDKYVTVIIDLTPARNKTGPARLLDMVEGRSKAVFKQWLAARPADW
FT                   AKRIEVVAMDGFAGFKTAAAEELPDAVPVMDPFHVVRLAGDALDVCRRRVQQDTTGHRG
FT                   LKGDPLYKARRTLHTGASLLTDRQRARLDAVFASEEHVEVEATWGIYQRIVAAYREPDK
FT                   KKAKAMMQEVIAAISSGVPAALVEVRKLGRTMKQRAGDILAFFDRPGTSNGPTEAINGR
FT                   LEHLRGSALGFRNLTHYIARSLLEAGGFRPALHPRS"
FT   gene            216935..217213
FT                   /locus_tag="Ksed_02170"
FT   CDS_pept        216935..217213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05302"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH2"
FT                   /protein_id="ACV05302.1"
FT                   /translation="MVVGTVPVEEDDQRSREFYAERFSFPSGDCRLADDWESSSHAPSD
FT                   ATVGDGVLGAEPEDSVESVFLRVECDGRVTTVEIPVVTERAVVLISD"
FT   gene            complement(217220..218497)
FT                   /locus_tag="Ksed_02180"
FT   CDS_pept        complement(217220..218497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02180"
FT                   /product="Kynureninase"
FT                   /note="PFAM: Aminotransferase class-V; TIGRFAM:
FT                   kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05303"
FT                   /db_xref="GOA:C7NJH3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH3"
FT                   /protein_id="ACV05303.1"
FT                   /translation="MTSLNTPDAVRARAAELDAADELAHLRERFVPMDACGTVGGAVLS
FT                   YLDGNSLGRPLKSAAEALDRIVSEAWGTRLIRSWDEQWMELPLRLGDRLGEVALGAAPG
FT                   QVVVADSTTVMLYKLLRAGLAAAQAADPARREIVVDTGNFPTDRYVAEGIAAECDAELV
FT                   WIEADAGTGVTTEQVRDAVGSATAAVVLSHVAYRSAYVADLPAITQVVHEAGGLVLWDL
FT                   CHSAGVVPVDLDEHEVDLAVGCSYKYLNGGPGAPAFGYVAARHQERMTQPIQGWMGHAE
FT                   PFVMGPGYQPSPGMRRFISGTPPVLGMVPLGEMVELVADVGLPALTAKATALTEFAIEV
FT                   TDGLLTRHGVSVDSPRDPAQRGGHVTLGHPAAREVIAALWEQGVIPDFREPDGVRLGMS
FT                   PASTSFAEVAEGLLLLDAELERAGRG"
FT   gene            complement(218553..218966)
FT                   /locus_tag="Ksed_02190"
FT   CDS_pept        complement(218553..218966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02190"
FT                   /product="predicted nucleic acid-binding protein, contains
FT                   PIN domain"
FT                   /note="PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05304"
FT                   /db_xref="GOA:C7NJH4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH4"
FT                   /protein_id="ACV05304.1"
FT                   /translation="MTAVFIDSTILLHAAGGDHAMRAPSRRWLEAAASGGMALHASVEA
FT                   GQEFLFHRLRKSTPEQATAQFGLIDGLITWHPFDEEVLRRSVALAATGALGGRDAMHAA
FT                   TALAAGFTEIVSADRDFDKVPGLARRDPGDLPD"
FT   gene            complement(218963..219229)
FT                   /locus_tag="Ksed_02200"
FT   CDS_pept        complement(218963..219229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05305"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH5"
FT                   /protein_id="ACV05305.1"
FT                   /translation="MQLLLDERRITLLRERATERGVSVSTVVRDAIDASFEDDDMARRA
FT                   QAARDFLALTADNARHEAAEPADLKRAVHDAMDAELIAKLERL"
FT   gene            complement(219327..220175)
FT                   /locus_tag="Ksed_02210"
FT   CDS_pept        complement(219327..220175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02210"
FT                   /product="Tryptophan 2,3-dioxygenase"
FT                   /note="PFAM: Tryptophan 2,3-dioxygenase; TIGRFAM:
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05306"
FT                   /db_xref="GOA:C7NJH6"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH6"
FT                   /protein_id="ACV05306.1"
FT                   /translation="MANTRDVEAGIHTDFREEMSYGGYLDLDRLLSAQHPVSTPPHHDE
FT                   MLFIIQHQTSELWLKLVLHEIRSAMELLAADEMRMSLKRIARVKHIQKTLTEQWSVLAT
FT                   LTPSEYMEFRDFLGHASGFQSWQYRGVEFALGNKNAAMLPVHEADPEAHALLTELLEAP
FT                   SLYDEFIRCLHRRGIEMPAHVLERDVTVAHEQDAELTAVFTHIYENASDHWDVYEACEE
FT                   LVDLEDNFQLWRFRHLKTVQRVIGMKTGTGGSSGVGFLQRALDLTFFPELFAVRTEIGT
FT                   A"
FT   gene            complement(220380..221135)
FT                   /locus_tag="Ksed_02220"
FT   CDS_pept        complement(220380..221135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02220"
FT                   /product="MIP family channel protein"
FT                   /note="PFAM: Major intrinsic protein; TIGRFAM: MIP family
FT                   channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05307"
FT                   /db_xref="GOA:C7NJH7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH7"
FT                   /protein_id="ACV05307.1"
FT                   /translation="MPKRLAAEALGTFWLVFGGCGSAIFAAASMGEAAGEPIHVGIGYL
FT                   GVALAFGLTVVTMAYAVGHVSGGHFNPAVTVGLATAGRHPWKDVLPYVVVQVIAGLVAG
FT                   GALYAIATGKAGFEAVGSMAANGYGANSPEGYSMMAVLLAEVILTAFFLYVILGATDDR
FT                   APQGFGPLAIGLALTLIHLISIPVSNTSVNPARSTGVAFFHGDGAPAQLWLFWLAPVLG
FT                   AVIAGISYHALLGEEKRSAIREAAAHDAA"
FT   gene            complement(221238..221912)
FT                   /locus_tag="Ksed_02230"
FT   CDS_pept        complement(221238..221912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02230"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05308"
FT                   /db_xref="GOA:C7NJH8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH8"
FT                   /protein_id="ACV05308.1"
FT                   /translation="MSTQRGVATIDPAGVRAAYDEVADTYADHFTATEAESPLELGMID
FT                   LFCSLLEGQRRVLDAGCGAGRLLPHLAGRGCTVEGVDLSPGMVARARADHPEFPAQVAS
FT                   LDDLPHADDTFDGVFSWYSTIHTGDADLPGLITEMRRVLRPGGLLLLAFQTGTGVRDIA
FT                   QAFREHGHEVELLRAHRSLEEVGARLTEQGMTSVARFDRLPLGTERDRQAVLIAREPAP
FT                   EA"
FT   gene            complement(221924..222256)
FT                   /locus_tag="Ksed_02240"
FT   CDS_pept        complement(221924..222256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02240"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05309"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJH9"
FT                   /protein_id="ACV05309.1"
FT                   /translation="MTTHQSSRIDTLVFTVPRDDADAVLAALFAAGAGRIGDYTECAFT
FT                   VDGVGQFRPVGDADPTIGTVGEIERVEERRCEVPFTAAEKEAILAALVAAHPYEEPSYF
FT                   VIANAA"
FT   gene            222322..223038
FT                   /locus_tag="Ksed_02250"
FT   CDS_pept        222322..223038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05310"
FT                   /db_xref="GOA:C7NJI0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI0"
FT                   /protein_id="ACV05310.1"
FT                   /translation="MIDELWIRVSATQPPLHPVAALALLGLAFAVTWSPAGHRVVRHLV
FT                   TIVHEAGHAVVAVLVGRRLSGITLHRDTSGVTVSRGRPRGPGMVATLLAGYPTPALLGL
FT                   AGSAVLGAGYSAAWLWLLVALCLGMLVFIRNGYGFLVVVGIGGVVGALSWWAPGWAVTA
FT                   TAHVTVWGLLLAAPRAVLSLHHGRQRARATGRRQAGDADQLADLTGVPGAVWVVLFGAV
FT                   CLACLAAALWLALPVR"
FT   gene            complement(223133..224080)
FT                   /locus_tag="Ksed_02260"
FT   CDS_pept        complement(223133..224080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05311"
FT                   /db_xref="GOA:C7NJI1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI1"
FT                   /protein_id="ACV05311.1"
FT                   /translation="MVVFHLPDARVADVRFAISPLVETALSLRVLAAPERFPLQVPWER
FT                   RARQRMGEVDLPVLRALLNRHGHTPDAITPAPRTLHATAAQEWEWLRATDPAVLAQDIR
FT                   AVTGHVDPALGRGAAMVTRVADALEGYWEACLAADWPRIRTVMQADLAHRGHVIARRGT
FT                   PAALNDLSPTVHLTGDTLEVVSRHGIDHEVDVGDRPLWLVPTLFSTRAAYPGSPDHPPM
FT                   VMYPARGQGGMWGAPPPVDADAVRALLGGPRARLLRMLAEPASTTVLAARLGVTASAVN
FT                   QHLQVMRAAGLLRAERAGRQVLYARTELGEQLAG"
FT   gene            224156..225481
FT                   /locus_tag="Ksed_02270"
FT   CDS_pept        224156..225481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02270"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05312"
FT                   /db_xref="GOA:C7NJI2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI2"
FT                   /protein_id="ACV05312.1"
FT                   /translation="MPASSTPRSTVAGRSPGPAADSARAVIGRLMRPLYLPSALYSVGT
FT                   GAAIPAQVLVGLSIGLDAGQVALALTLSGVVMVAGTAATGPVVERWGERAALVGSTAAA
FT                   VLAVTALVVAVATGMGQLPAYLVALAVFNLTDGVWGVARQELMAQWIPAAVRGRAVNTY
FT                   GASQRVGRLVGPFVAGALILAVGPVAGFVVFALAAVIGCVAILTAPAPVAPEPDGPLPQ
FT                   PRPEAGRAPETVAAAAAPSSVPSATPSRPAGHPRIPAGVWAGFWVVGLSVLALSALRIN
FT                   QEVLLPLWAAGVVHLPDARVSFAMGVWMALELALFLPAGAALDRWGPLPVALTCLVGLT
FT                   AGFALLLVPGGFWPAIVVLGLAGGTGSGIVKTLGLILAPAVGRPRFLGRWMALATVGTV
FT                   VAPGLVALTQRASLTASVLVTVAVGLAGALWLATAGRRYLAP"
FT   gene            complement(225490..226497)
FT                   /locus_tag="Ksed_02280"
FT   CDS_pept        complement(225490..226497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02280"
FT                   /product="Pirin-related protein"
FT                   /note="PFAM: Pirin C-terminal cupin domain; Pirin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05313"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI3"
FT                   /protein_id="ACV05313.1"
FT                   /translation="MSNPDPHPTETVCENDSSQPELLAPREVPLGGPRAMTVRRTLPQR
FT                   ALSLIGAWCFLDHYGPDEVTPTSGMKVPRHPHTGLATVSWLFDGAIDHLDSTGGEARIE
FT                   PGDLALMTAGRGITHQEFSTEDTHLLRGVQLWYALPDAERHGEPDLQTYRAPDVGLDGG
FT                   TARVFIGSLAGSTSPVRTRTAGLVAAEIVLDAGSEVVLELDPAFEYGVLADSGTPVVCD
FT                   ESMPVDHLRYHAPGHTHLVLGGGPDGARVVLVGGVPLGEQIVMWWNFVGRSHDEVAAYR
FT                   ARYQREIGAADGDPASTPVDEVDDDAELFGPWPNGTPDPIPAPVLPNARLRPRG"
FT   gene            complement(226633..227418)
FT                   /locus_tag="Ksed_02290"
FT   CDS_pept        complement(226633..227418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05314"
FT                   /db_xref="GOA:C7NJI4"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI4"
FT                   /protein_id="ACV05314.1"
FT                   /translation="MAVPQLNPDASELDRRANDRTWDEVVADFPQLAGANAPWNYYTQP
FT                   RQGDDYASQPGFDVNRDFHPDLDYVPSAQDFPGTSADPGWYIHPESQNIRDLYTDLQAE
FT                   FGTVDTFVDLHHQGPCYLVGDTGEEVTLSLSGKFVDIENHAQYDKGYDLEYSKRLNVAA
FT                   LDALQARGNSPFGNISLYDQEVDLPGTALGSFALNGSGTVLFEVRGQTQSWGAKKKGQL
FT                   VKAVETGLMGIVTSVADDSVDELDPTRYDDIPPTTYPRN"
FT   gene            227593..228096
FT                   /locus_tag="Ksed_02300"
FT   CDS_pept        227593..228096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02300"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /note="PFAM: Low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05315"
FT                   /db_xref="GOA:C7NJI5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI5"
FT                   /protein_id="ACV05315.1"
FT                   /translation="MHIECVCLGNICRSPAAEAVLRRKFAEAGLDEVTVTSAGTGDWHV
FT                   GQDPYHLSSQEGERRGYTFETVARQIAPGDFAGADLVLAMDEQNAEDLRGLAPTPQDAA
FT                   KVVALGAFAPGADAADPEPVPDPYGQDAAAFTAMYDQIEPACEGLVAAVQDGSWRQVVE
FT                   RAAR"
FT   gene            228093..228911
FT                   /locus_tag="Ksed_02310"
FT   CDS_pept        228093..228911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02310"
FT                   /product="fructosamine-3-kinase"
FT                   /note="PFAM: Fructosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05316"
FT                   /db_xref="GOA:C7NJI6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI6"
FT                   /protein_id="ACV05316.1"
FT                   /translation="MSAAATGSTGAEERDGERVFVKRHPSPPHRLLEFEAVGLRALADA
FT                   GARVPRVLHLGGTELVTTLVPGAGSGRPAAEGDFGRELAALHRTTRPAAPAVVDDAGVT
FT                   GYGAVDGDPAGWLGACEIDLTPCATWAESLLERRVLSLARRAVDEGALDPAAVELAGRL
FT                   GPEHLGPEEPPTLVHGDLWAGNRVVDRAGRSWLIDPSAQYGHREQDLAMMQLFGGFSEA
FT                   ELGAYCEAYPPAQGWRSRIGTYQLVPLLVHAILFGGGYGQQTMTVLRRVV"
FT   gene            complement(229121..230896)
FT                   /locus_tag="Ksed_02320"
FT   CDS_pept        complement(229121..230896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02320"
FT                   /product="subtilisin-like serine protease"
FT                   /note="PFAM: Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05317"
FT                   /db_xref="GOA:C7NJI7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI7"
FT                   /protein_id="ACV05317.1"
FT                   /translation="MSHTTRRIGAALGAIALTGTLVASSPSTAVPTTADPAQATTGAGT
FT                   QRHLVLAAEGADDASVRAAIEAAGGEVAQTNEAIALYTVNGPVDLAARLAGSTVIEGTM
FT                   ADKVIGYTPGSDLADKVRRADEVEKVRSQRPAHPASDRAHERATSEGHGRGKGKGKPQP
FT                   GPVPAGDSLSDRQWNIDMIDAPDAHRTATGKGARVGVMDTGVDGDHPDLAANFNAALSR
FT                   NFTTDIPEIDGPCEEADCKDANDVDEGGHGTHVASTIASARNGHGIVGVAPDADLVNLR
FT                   VGQDSGYFFLEPTLEALTYAPSAGVDVVNMSYYIDPWAFNCPNNPADSPEEQAEQRFTI
FT                   EATNRALGYARSHGVTLVSSLGNSALDLGKVTTDDSSPNYPEGEVREREIDNSCLDLPV
FT                   EGDGSMGVSAVGPSGLKSYYSNYGVAEIHVAAPGGAYRDFEDGSMTATPENLILAAAPK
FT                   GVLEESGDLDENGMPTSDFVVREELAGGEVAYYQYMQGTSMASPHVTGVAALVIEEKGQ
FT                   PDNRLGGRKMQPKRVEGAITTSAHERDCDAEVFSYPGLSDRYTATCEGDADFNGFYGHG
FT                   IINAASAVSKTPHKH"
FT   gene            complement(230995..231423)
FT                   /locus_tag="Ksed_02330"
FT   CDS_pept        complement(230995..231423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02330"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05318"
FT                   /db_xref="GOA:C7NJI8"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI8"
FT                   /protein_id="ACV05318.1"
FT                   /translation="MRQFFLKTVVNGIPLWVAALVVPGIAIGSQADGLGTRLLSVVLVA
FT                   LLFGVINTLVKPLVKLFSFPLIILSLGLFTFIINAAMLSLLSWASGALGLDFHVDSFFW
FT                   SAVLGAVVVTFVAMLLNLLLPDGEDDRVVLAGGQHRRY"
FT   gene            231527..232639
FT                   /locus_tag="Ksed_02340"
FT   CDS_pept        231527..232639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02340"
FT                   /product="aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05319"
FT                   /db_xref="GOA:C7NJI9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJI9"
FT                   /protein_id="ACV05319.1"
FT                   /translation="MSDPTSQAPSTSDQVRLRGALDALPAYKPGKPAPAVEGLTAYKVS
FT                   SNENPYPPLPSVQDAVSNAAQTFNRYPDMGAAAMLAGIADHCGVQPENVAIGTGSVGVL
FT                   QQLVQITCDPGDEVVYAWRSFEAYPIVIGLAGAQSVQVPLDAEARHDLDAMADAITDRT
FT                   RLVLVCTPNNPTGPSVRADELDAFLAKVPTDVLVVIDEAYLEFNESDETPDALAVQAAH
FT                   PNVVVLRTFSKAYGLAGLRVGYAVASPRVAEALRKAAVPFGVSQLAQDAVLASFEAMDE
FT                   LDERVAALKIQRRQVVDALTEQGWEIPESQANFVWLPLGDQTMDFAAFAGENGLVVRPF
FT                   AGEGARVTIGEDEANVRLIDLCRQWRERTA"
FT   gene            232819..234024
FT                   /locus_tag="Ksed_02350"
FT   CDS_pept        232819..234024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02350"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component alpha subunit"
FT                   /note="PFAM: Dehydrogenase E1 component; TIGRFAM: pyruvate
FT                   dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05320"
FT                   /db_xref="GOA:C7NJJ0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ0"
FT                   /protein_id="ACV05320.1"
FT                   /translation="MSDPNVEAAQDALQESASRAPEDAGAQPVDVTDGGPEMVQFLTPE
FT                   GERIETELNAPYARYLESIDAEAIKAMQRDMVLVRRVDAEGFALQRQGELGLWPSLLGQ
FT                   EAAQVGMGRALKPQDYVFPGYREHGLAWTKGVDPENLLGMFRGVNHGGWDSKQNNFHLY
FT                   TIVIGNQMLHATGYARGVQLDGAWATGDDTVDTAVVACTGDGGTSQGDYNEAMVFAAVA
FT                   KSPCVFFVQNNQWAISEPTHRNFVVEPFKRAAGFGFPGVRVDGNDILASLAVGAWALDH
FT                   ARSGKGPVLVEAFTYRMGAHTTSDDPTKYREDSQVEAWRAKDPIDRLKKHMVAQGIGDD
FT                   EFFAAIDAEAGEMAARVRKACQTMPDPELGTMFDHTYAAEHAPLNDEGREFVEYHAGFE
FT                   GN"
FT   gene            234029..235018
FT                   /locus_tag="Ksed_02360"
FT   CDS_pept        234029..235018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02360"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit"
FT                   /note="PFAM: Transketolase, C-terminal domain;
FT                   Transketolase, pyrimidine binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05321"
FT                   /db_xref="GOA:C7NJJ1"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ1"
FT                   /protein_id="ACV05321.1"
FT                   /translation="MSAKKMTLAKALNAGMRKAMTDDDKVVLLGEDIGRLGGVFRITEG
FT                   LVDDFGEERVIDTPLAESGIVGTAVGLALRGYRPVVEIQFDGFVYPAFDQIISQVSKMH
FT                   ARSLGQLKMPIVIRIPFGGGIGAVEHHSESNEAYFAHTAGLKVVCAATPEDGYWMMQQA
FT                   IASDDPVVFYEPKRRYHEKGEVEFSTDGQATTDLHASRVVKEGSDVTLVTYGPMVKTCM
FT                   QAAAAAAEEGRSLEVIDLRTLNPLDLAPVVESVKKTGRVVVVHEAPTFLGMGSEIAAQV
FT                   TEKCFYHLEAPVARCGGYNIPYPPSRFEEEYLPNLDRILFHVDEVLAH"
FT   gene            235040..236929
FT                   /locus_tag="Ksed_02370"
FT   CDS_pept        235040..236929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02370"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase component"
FT                   /note="PFAM: Biotin-requiring enzyme; 2-oxoacid
FT                   dehydrogenases acyltransferase (catalytic domain); e3
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05322"
FT                   /db_xref="GOA:C7NJJ2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ2"
FT                   /protein_id="ACV05322.1"
FT                   /translation="MSIQHYVLPDPGEGLTEAEIVAWKVKVGDEVKVNDVVVEVETAKS
FT                   LVELPVPFAGTVVELLAAEGDEVEVGAPIIAIDDGQGGSSAPAASGGASSMGADEGSGQ
FT                   SADSPAGASSTSQATAGNPASPEVGAAGSDAAGSGVEHYVLPDPGEGLTEAEIVAWKVK
FT                   VGDEVKVNDVVVEVETAKSLVELPIPFAGVVDALLAEEGQEVEVGAPIIAVRTGNATAP
FT                   APAAGGDQAAGGDAAAGDDGEERVANLVGYGAVAGSTTRRRRSGSGPGASTASAPVAGE
FT                   SLSGAPGEGGYGQRMVAEGSERRPGQQLHGAVGHAASGGDRPKAKPPVRKFAKDNGIDL
FT                   RTVAPTGPGGIITRQDVEQALAGGAQAGGQVAAAAPAAQAAPAASAPAASAGEREQRTP
FT                   IKGVRKVTAQAMVNSAFTAPHVTEFITFDISATMELVEKLKADREFKDIKVTPLLLVAK
FT                   AVVIAAQRNPEINAKWDEANQEIVQYADVNLGIAAATPRGLMVPNIKGAQEKSLVELGN
FT                   DLGDLISTARGGKTQPADMSGGTITITNVGVFGVDSGTPILNAGEAAILCFGAINRRPW
FT                   VVTDADGNETIEPRWVTELALSFDHRLVNGDLGSRFLADVAALLEDPGKAFIW"
FT   gene            237083..238294
FT                   /locus_tag="Ksed_02380"
FT   CDS_pept        237083..238294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02380"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05323"
FT                   /db_xref="GOA:C7NJJ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ3"
FT                   /protein_id="ACV05323.1"
FT                   /translation="MSTARLENWGTPLTPGGPTLRQLALSAYAPMLLWSVALAGTLPVL
FT                   PLIAMRLGATAGQAALIVALQGVAAMAVGIPAGMATERIGERRAMTGAGALSALAMLLV
FT                   LTTSSLAVLSLGVVMLGCSTSVFMLARQSYLTSAFPRRQLARAMSTLGGMARIGFFVGP
FT                   MLGALAIWQVGVRGPVAVSLALLLVLTLTTLWLPRLPGEAASKATRPPPMRGVITGHWR
FT                   TFTTLGVGVVLCAAARGSRTVIMPLWGHHIGVDDSVISLIVGLAGLLETLTFYPAGVLM
FT                   DRVSRRANAIPSMAILGAGIALVPLSGSALTLALAAVVIGFGNGLGSGLVMTLSGDVAP
FT                   EVGRTSFLAVMRTLADGGNASGPLVISGVTVLGGLGAAIVVAACFGFGASAAFARWVPR
FT                   GRPG"
FT   gene            238601..239422
FT                   /locus_tag="Ksed_02390"
FT   CDS_pept        238601..239422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05324"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ4"
FT                   /protein_id="ACV05324.1"
FT                   /translation="MLQDYAGGRAAPSGADGAARARTGSGGSGAFAVDGGLLDNPSAMD
FT                   TGSAVADRATAAASRALDRVVAALDASRRAEVDLLDGMAALHREVTSYLERRRDEGEPG
FT                   VYRPGDAAAVVVDEFVAATGESQALAYGVVGLVTRAAEVAECGRSAILDGRASLSRVLE
FT                   WHSSTAHLSSDDAVAIGEAVLTRGADGAPRSGPSFRAALGRRVRAADAADRTAAARRAE
FT                   AINQRGSWTTSRDDGTGSLTVVGEATRVSAASARLDAAAGQVPGSGVAILR"
FT   gene            complement(239427..240744)
FT                   /pseudo
FT                   /locus_tag="Ksed_02400"
FT   gene            241061..241657
FT                   /locus_tag="Ksed_02410"
FT   CDS_pept        241061..241657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02410"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05325"
FT                   /db_xref="GOA:C7NJJ5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ5"
FT                   /protein_id="ACV05325.1"
FT                   /translation="MVSSDWFPLPPVGEPVLPPARVTVVVGLDVLLDDPAGVNRGSPPT
FT                   AGASPPGMRGAPLGWVPGFGYLDPEHVRAVAVREGSVWQRLVADPVSGHAMAVSPHTYR
FT                   PTASVARFVRARDGMARDPGSGVGAASCEIDHVVPFDEGGQTVAENLQCLSTRGHTRKT
FT                   KGQWDASMTPDGVVEWTSLTGRRYTTHPFDYRELG"
FT   gene            241946..242308
FT                   /locus_tag="Ksed_02420"
FT   CDS_pept        241946..242308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05326"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ6"
FT                   /protein_id="ACV05326.1"
FT                   /translation="MSTSNTPHTPDAPGSGQPGGSGTSGQPGGSGTSGHGYAESRTGEE
FT                   ISRLLHYGHIIPVRRGLTADYVDRHFPGWTWNALMDVWRTAGIVVRTPGGIPDCDPRVR
FT                   AVHFTDAEHVHVEWAA"
FT   gene            complement(242399..243732)
FT                   /pseudo
FT                   /locus_tag="Ksed_02430"
FT   gene            243944..245599
FT                   /locus_tag="Ksed_02440"
FT   CDS_pept        243944..245599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02440"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05327"
FT                   /db_xref="GOA:C7NJJ7"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ7"
FT                   /protein_id="ACV05327.1"
FT                   /translation="MSVREVASKAWFSAPATAVRRGTLRAGAAALTRTYSLYKVHPAAW
FT                   RLTATNYQPWMGDFARFHAWMSCQMGYLRVPAYQQYLAEHDWEFRWWDLENYPVTDKDS
FT                   YVVRFDEASRCRDGELAMLGTLVDESSGSSGRPFNWVRGRNELADIHRNLAGFTAMMHR
FT                   GERLFVLNAYSMGAWATGTNTGIAMAKIGMVKNTGPDLDKIVDTIEHFGPGYTYLVAAY
FT                   PPFLKDLRDRLDADGFDWDAHTLHGLVGGEGMTEGLRDYCEERFATVRSGYGASDLTIG
FT                   IGGETDLTVWLRRALVDDPELREAVLGPGEDRTPMIFQYNPLETFLEVDDRGHLVCTLT
FT                   STAVLSPKLRYDIGDEAKLLDWHDLRRILRRHPRWSEPAGEAFQRAPMKLPLLLLYGRA
FT                   DSTVSFMGANIYPQDVENGLYEDSERAAAIAAFTVGLEPVPGDAVAQRPVLHLELREGA
FT                   ELPPSEREALAESARTGVVAYLARVSRDFAESLEESERAGEIAVEVHDAGTGLFADTGG
FT                   RIKRRYLRTAAPEPTEPADPSEPTDSAEPTEEIR"
FT   gene            245596..246108
FT                   /locus_tag="Ksed_02450"
FT   CDS_pept        245596..246108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05328"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ8"
FT                   /protein_id="ACV05328.1"
FT                   /translation="MRTTDFSAAPTKAQASAMFIGATRYNGPLAWARLTPKWLAMVRDM
FT                   KRMPGYCGHQVFWEAPWTLGTIGWFATRDDMMRFARTGTHREMMQWATDGTRNATGGWI
FT                   RLYTVDPHGYSNGVWRAEDGLMDHIEHFTPVASETEGPTVRRQPRDDEAVRRQPRTAIE
FT                   PGGAGER"
FT   gene            246098..247216
FT                   /locus_tag="Ksed_02460"
FT   CDS_pept        246098..247216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05329"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJJ9"
FT                   /protein_id="ACV05329.1"
FT                   /translation="MSAEVRVDPVRSRSALRAFCDFPVDLHPRELAVPLLESTVRSWHR
FT                   GEGPQADHGEVELLLARDAAGTVVGRTTVHTDDRMDARLGAAATLLGATEFATEQALRA
FT                   LVGAATERAEQESRSVLLGPVSLLPNQTGGVITSGHDERGFVDSPWNPDWYPAAWEACG
FT                   FTPLWPGATWICEGLQRRDATADLGAAVPLPAGVELHHGSRRDLADQLPVLRQMLNASF
FT                   AELPYYTPISAAELEAATDGLAHLLDESLLMYLTDAGRPVAFVLVVPDISHFVQHTGGR
FT                   LPWYQQLRLLVARSHYRREAILIIKGTVPKARGRGLMRWLHRELLTNLQAGGYETLRVT
FT                   QVGQGNEASAAPFRAMGGRPLHDVCFYRKELA"
FT   gene            247213..248190
FT                   /locus_tag="Ksed_02470"
FT   CDS_pept        247213..248190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05330"
FT                   /db_xref="GOA:C7NJK0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK0"
FT                   /protein_id="ACV05330.1"
FT                   /translation="MKPPAARLMARRADWQRAPSAHNTQPWTVTVTGDARLVIGWDAAR
FT                   TLPLGDPTGRDLMLSLGCVAEALAVVAADLGFAAHVDWAVDRAACRAGAVVLTGADQSA
FT                   DLLSGELLMALRERRTARGQHVQHPSADEVQALAGTAGVDAVVLPGALVDELLPVADRW
FT                   SMEGPAADELAQWLRLDRADPRYVQDGLSDRALELSRPEAAGLRWAMHPRIAPWLRRTG
FT                   AMRVLARQATVRPVGTVVALTDPADLSDEELAELGRRLLRLWLVADRSRWSAHPLSQLL
FT                   DCPETQEALGGALGAAPYAVFRLGRPASRPVRSARLSARPGTLG"
FT   gene            complement(248233..248658)
FT                   /locus_tag="Ksed_02480"
FT   CDS_pept        complement(248233..248658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02480"
FT                   /product="ChaB protein"
FT                   /note="PFAM: ChaB"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05331"
FT                   /db_xref="GOA:C7NJK1"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK1"
FT                   /protein_id="ACV05331.1"
FT                   /translation="MPKTGKDDHAKDSEIPDTLERSDQKAQDTFAKAYDSAVEQYDDES
FT                   RAARTAWAAVKQTHEKVGDHWEPKPENGPSDEASEEGGPDPQGDTAGGVDANASKEHLY
FT                   ELAQELDVEGRSNMTKDELVEALQKASERETRKARED"
FT   gene            complement(248731..249639)
FT                   /locus_tag="Ksed_02490"
FT   CDS_pept        complement(248731..249639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02490"
FT                   /product="uncharacterized conserved protein with
FT                   thioredoxin-like domain"
FT                   /note="PFAM: Sucrase/ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05332"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK2"
FT                   /protein_id="ACV05332.1"
FT                   /translation="MSPSPAFRCSDGARERGDTMVGTAPPARRWFLVEQNGDWGRSAWE
FT                   GLDCYDRAKEELRSRLESAGARLMLIRRPGARPEPGHPTRRFCLVDTDRPRPLLWGTAH
FT                   SDGDLVRAVESFNTWPDAEATVPQAGEPGIVMVCTHGLKDVCCAVRGRPVAAALAEEWP
FT                   EAVWECTHTGGDRFAANVVLLPDGAIYGGSDPASATADLRAHLAGAVDPTRLRGRCGLT
FT                   PPAQAAVAASMRELGPMGWGEVVMTGQSGSEGAWQVDLVVRGEPVQVTGHTVTTEPHQL
FT                   TCRAAGPAPMRLPVVKDVRAG"
FT   gene            complement(249636..250880)
FT                   /locus_tag="Ksed_02500"
FT   CDS_pept        complement(249636..250880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02500"
FT                   /product="Cupin superfamily protein"
FT                   /note="PFAM: Cupin superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05333"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK3"
FT                   /protein_id="ACV05333.1"
FT                   /translation="MTTPPAGSAPASQDRSTLGRLLAAAPADFAERSWGTTPRHVPATD
FT                   RAGDTFTDLFSLDAVDDLLTHRGLRTPFIRMAQDGTTLPENRFTRGGGTGAGASDQVDE
FT                   DRVRSLFAGGATIVLQGLHRTWPPIAEFARELGDELGHPVQVNAYITPPQNQGFSAHYD
FT                   VHDVFVLQVHGTKHWTLHEPVVAHPLRDQPWDTVREAVAHRAAQDAPLIDAVLAPGDVL
FT                   YLPRGTIHAAAAQGEISAHLTIGVHTWTPDHVTGAVLDAVRSRLRDQPTVRANLPLGAR
FT                   PDDAAVVGPTLEQLRGALHEAIDSLDAEELARYFRPQVRVTRRPDPAPPLAQLAAAEGL
FT                   GTASTVALRGGLELGDDPARPDRLHTRLGWFDLDEDARAVVTALQDGPRRLDALPAPLT
FT                   VVQDLVRRGLVEVQP"
FT   gene            complement(250881..251246)
FT                   /locus_tag="Ksed_02510"
FT   CDS_pept        complement(250881..251246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05334"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK4"
FT                   /protein_id="ACV05334.1"
FT                   /translation="MTDAPKNDEFDPTLAAGDGGADGAAGDGAAGDGGADGAAGDGAAG
FT                   DGGADGAAGDGAAGDGGADGAAGDGGAAGDGAAGDGGADGGAGPGGDGGADGGAGDAGA
FT                   DGGADGGAHGPADGGAV"
FT   gene            251597..252964
FT                   /locus_tag="Ksed_02520"
FT   CDS_pept        251597..252964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02520"
FT                   /product="primary replicative DNA helicase"
FT                   /note="PFAM: DnaB-like helicase N terminal domain;
FT                   DnaB-like helicase C terminal domain; TIGRFAM: replicative
FT                   DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05335"
FT                   /db_xref="GOA:C7NJK5"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK5"
FT                   /protein_id="ACV05335.1"
FT                   /translation="MSDHEYEPPPDDGPGMDRMPPQDVDAERSVLGGMLLSKDAIADVL
FT                   ELVRGVDYYRPAHELIHDAILDLFGRGEPADAITVADELTKRGNLQRAGGQAYLHQLMQ
FT                   AVPTAANAGYYAEIVAERAILRRLVEAGTRIVQMGYGQGGGEVEDVVNAAQAEVYAVSD
FT                   KRGAEDYQVIGEIFDATVDEIEHASGSAGEMIGVPTGFADLDALTNGLHGGQMIVLAAR
FT                   PAMGKSTMGLDICRSASIQHGLTSAIFSLEMSKTEIVMRMLSAEASIQLQKLRKGEVDE
FT                   HDWAKIAETQGRLSVAPLFIDDSPNLSLMEIRAKARRLKQQHNLRLVVIDYLQLMTSGK
FT                   KVESRQQEVSEFSRALKLLAKELEVPVIAISQLNRGPEQRTDKKPQMSDLRESGSIEQD
FT                   ADMVILLHREEAYEKESPRAGEADFIVAKHRNGPTDTITVAFQGHFSRFKDMAQGF"
FT   gene            complement(252999..253811)
FT                   /locus_tag="Ksed_02530"
FT   CDS_pept        complement(252999..253811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05336"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK6"
FT                   /protein_id="ACV05336.1"
FT                   /translation="MPADPAAPPPTRTIQLGTSGQQARIEADELGGHELFIGGHVQSHV
FT                   DLADPTHVRYEYLRRIATVIDEVTPAGAPLAVLHLGAGALTLVRYVQATRPASAQVVVD
FT                   IDRELVDFVTTTLPLPAGTDLEVVVGDAREAVAELAGERFDVVVLDVPSNTPETDHLAG
FT                   PDFHLELLDLLTEQGVLLVNVGDDDGLEFFAGQVRSLKEAATTEGHDGCWVLADAGMLD
FT                   HLALGNAVLAVGSGLRTAQAALAAAGPHPGAVLDPAGAAALADRIEQC"
FT   gene            253810..254121
FT                   /locus_tag="Ksed_02540"
FT   CDS_pept        253810..254121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02540"
FT                   /product="Rv0623-like transcription factor"
FT                   /note="PFAM: Rv0623-like transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05337"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK7"
FT                   /protein_id="ACV05337.1"
FT                   /translation="MGPVWCTSRWYRGTGRRCHACMALTIKNDRVCDLAREAAQRSGQS
FT                   QVSVIEQALERYLADHAEPVGRRVDEVLARIDASLAPGDAAAMRVELDRLYDERGLPA"
FT   gene            254118..254510
FT                   /locus_tag="Ksed_02550"
FT   CDS_pept        254118..254510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02550"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05338"
FT                   /db_xref="GOA:C7NJK8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK8"
FT                   /protein_id="ACV05338.1"
FT                   /translation="MIVDSSALVAILLAEPERQALLEAIQQAPEAAMTAASYLEVGMVV
FT                   DGRGNPVLSRQYDALLEALGIEVVDTTAEQARVARAAHRDFGRGSGHPARLNFGDCLSY
FT                   AAAVQDGVPLLFTGDDFIHTDVTPAR"
FT   gene            complement(254515..255285)
FT                   /locus_tag="Ksed_02560"
FT   CDS_pept        complement(254515..255285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02560"
FT                   /product="protein of unknown function (DUF1994)"
FT                   /note="PFAM: Domain of unknown function (DUF1994)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05339"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJK9"
FT                   /protein_id="ACV05339.1"
FT                   /translation="MAHSPVTTSAVPVPAEAPTSAAHVTKAPATLGATTVGTATLSTAP
FT                   LEATPITSGINPDMATVAGARYSAPLRTAIRRLPVARENNSGYSRDRQFGTWIDAHRDC
FT                   QNTRAEVLLSETRRTATYTSTKRRCTVKSDRWVTSLDNRVHSSATTVQIDHLVPVAEAW
FT                   GSGARHWTKAKRVRFYNDLGDARTLSAQSCAVNQSKGARGPEAWIPRVNKCRYINEWVA
FT                   VKIRWNLKVDATEKAALTRYAAKCPNVTLRVTKA"
FT   gene            complement(255404..256063)
FT                   /locus_tag="Ksed_02570"
FT   CDS_pept        complement(255404..256063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02570"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: uncharacterized Actinobacterial protein
FT                   TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05340"
FT                   /db_xref="GOA:C7NJL0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL0"
FT                   /protein_id="ACV05340.1"
FT                   /translation="MDPLSFPLPEARDLFAAQTRQLLDAVHSLYELDLLTPSLCAGWSR
FT                   LELVEHLRIGLDEMAAAACTTTDTAPDHDAASYWGSFARAEDEDPVPGIMWLRRTASAS
FT                   ARPAGAVERLTEAAERALAAVTSQRNHPVPFQSKVLAAGDFVGSWVVELAIHQWDLDLG
FT                   THPAPVGAVWARRTLEALAGCPLPASMPDDLAVLAGMGRRPWPDGIERPAAFPVAV"
FT   gene            complement(256113..256454)
FT                   /locus_tag="Ksed_02580"
FT   CDS_pept        complement(256113..256454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02580"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2200)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05341"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL1"
FT                   /protein_id="ACV05341.1"
FT                   /translation="MHKIFAMPVAEVYPHYVTKVEKKDRTVDELHQVIEWLTGFDEAQL
FT                   AKHLEDRTSFEDFFAAAELNPNASLITGSICGVKVQEVEDPLMQKIRYLDKLVDELAKG
FT                   RPMEKILRA"
FT   gene            complement(256490..256999)
FT                   /locus_tag="Ksed_02590"
FT   CDS_pept        complement(256490..256999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02590"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05342"
FT                   /db_xref="GOA:C7NJL2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL2"
FT                   /protein_id="ACV05342.1"
FT                   /translation="MGRPPASNGSPPDEPGSPPTGRGSALGWMPGFGYLDPDHVRKIAI
FT                   REGSVWQRLVADPLSGHAVSVSPFTYRPTASLARFVRARDGVARDPGCGSFGATEAERC
FT                   ELDHIVPFDVGGTTTADNLQALSRRGHTRKTKRQWEVTGDAGGSLRWTSLAGKRYTSDP
FT                   LDYRDF"
FT   gene            complement(257148..257810)
FT                   /locus_tag="Ksed_02600"
FT   CDS_pept        complement(257148..257810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05343"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL3"
FT                   /protein_id="ACV05343.1"
FT                   /translation="MRGEYKVPGGKLVAVEIETQGGGTGDRITEAFVSGDFFLEPDEAL
FT                   EDINGALLGLGVDSSVDDIATAIRQRLSDDVSLIGFSPEAVGIAVRRALGKASSWEDHH
FT                   FDLIGPVSMDPRMHVALDEVLARKVARGEAGQGRRGRAEPEPTAERPAPRPAAGRSAAL
FT                   REGAGPGRGAWTGRGAWRCRCSRRERRTGGPRDAPGTAGVHELRRGLQRLLPLPHCG"
FT   gene            258071..258466
FT                   /pseudo
FT                   /locus_tag="Ksed_02610"
FT   gene            complement(258907..260055)
FT                   /locus_tag="Ksed_02620"
FT   CDS_pept        complement(258907..260055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02620"
FT                   /product="transcriptional regulator with HTH domain and
FT                   aminotransferase domain"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05344"
FT                   /db_xref="GOA:C7NJL4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL4"
FT                   /protein_id="ACV05344.1"
FT                   /translation="MSSGFSPIPLPGDGGAPLHGGLPAAEALPVAALQDSFAQALARGS
FT                   LPTDELQYGTPAGRPELREALALRERTRTGRVSVTNGGLHGLHLVTRSLVAPGDLVTAE
FT                   TPTYPLAAGVFRAAGARTAVVPTCAEGIDLDALSRQLRAGEVPTCVYVVPYFHNPTGVS
FT                   ATGEVLTELHRLAVRYGFVVVADCAYRDLAPDPTRPEAVAGSDHWVELGSFSKTLGPGL
FT                   RIGWVHGPEWLVERVTAVRGVEDQHGSGVTQAAVAHLLSTPGRYDGAVTRAAALYAERT
FT                   RYVARLVADSDLGAAVELDPPAGGLFLWLTFRDPAVDVLLLAELAARRGTSFTPGTDFD
FT                   PTGTGHYSSSLRLGVGNQPRSELETGVRRLLQAFDDLRGVTR"
FT   gene            complement(260099..261460)
FT                   /locus_tag="Ksed_02630"
FT   CDS_pept        complement(260099..261460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02630"
FT                   /product="acetyltransferase (isoleucine patch superfamily)"
FT                   /note="PFAM: GDSL-like Lipase/Acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05345"
FT                   /db_xref="GOA:C7NJL5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL5"
FT                   /protein_id="ACV05345.1"
FT                   /translation="MSGSDQSQDVAEQLRSRFGDRIVVGEGCTFEEGVTIEVHERGMLV
FT                   LGRGVAVRRGTTVEVGPDAVCVIGDHVTIGENVFMYVMCGVLVGEGCGISNMVDIHDHN
FT                   HRERRPENLRTGALTPWDSGFDAAPVVIDPGAIISNKVSLVAGVRVGANTIVGANAVVS
FT                   RSLPPNSVAVGVPARVKSRFEADVVLGLDSAQVRVGFVGTSIMEHYEAYAPRMFQQWNL
FT                   PAVGESVTVESRRNRGYPERLVTGLAAAYPDVRWSTVNASVGGATSRDLVAVARDLAGR
FT                   DPHLDVTFVGCGVNDVWRGFQGRLQDAVGLEEYRENLEEILESLESVSHRCVVIGETPF
FT                   GPSLDPSGEMNAQLVEYGEAARAIAARHSAPYIDLAGPFRRALAASGGRLAEADDLWGD
FT                   GVHLSDLGDELVLQVLRDWDLAQGGFFEGLLTAPTLDQHDARAWYRHRTQTWTP"
FT   gene            complement(261447..262076)
FT                   /pseudo
FT                   /locus_tag="Ksed_02640"
FT   gene            262080..262202
FT                   /pseudo
FT                   /locus_tag="Ksed_02650"
FT   gene            complement(262489..262965)
FT                   /locus_tag="Ksed_02660"
FT   CDS_pept        complement(262489..262965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02660"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05346"
FT                   /db_xref="GOA:C7NJL6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL6"
FT                   /protein_id="ACV05346.1"
FT                   /translation="MSTLKDFNATTIDGTQQDLGEYAGQVVLVVNTASECGLTPQYEGL
FT                   EQLHQQYADRGLVVLGFPCNQFGAQEPGSDEEVAAFCQKNYGVTFPMFSKIDVNGEGQH
FT                   PLFAWLKEASGDTSDIAWNFGKFLVGRDGRTVTRIGPRTEPAELTEDIERALGA"
FT   gene            complement(263116..264075)
FT                   /locus_tag="Ksed_02670"
FT   CDS_pept        complement(263116..264075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02670"
FT                   /product="predicted permease, DMT superfamily"
FT                   /note="PFAM: Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05347"
FT                   /db_xref="GOA:C7NJL7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL7"
FT                   /protein_id="ACV05347.1"
FT                   /translation="MTTQATAPPSTTSGAPGGRALTVAVLSLMGATLFWAGNYVVGAAA
FT                   VETIDPVSLVWLRWVIAVVPLLALAQWLERPDWRALLRQWPWIVGLSALGMIAYTWLLY
FT                   VALEYTPPFNASLINAFNPALIVLMAVLLLGDRMTARKVVGVALALVGVLVVISGGDIA
FT                   AVFRTGVGTGELFMVSAVCVWTAYTIAGRMSPTLPPVSSTALQAVVAVVVMAPVTFAMG
FT                   GPTLPPSSGSLWALLFIAVFPSVLSYLLWNRALEVIPASSAGVFMNLVTVYVAAFTVLS
FT                   GGRITVPEAVGGVLVITGVVLTNVQRRIRPGAATTRPG"
FT   gene            264408..265601
FT                   /locus_tag="Ksed_02680"
FT   CDS_pept        264408..265601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05348"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL8"
FT                   /protein_id="ACV05348.1"
FT                   /translation="MRSTWMTTALGLSLAMGMTGTAVTAAPLDATAPAPAAATAENGPS
FT                   EARKQAILERLQELVPAQTPKADALAERLHIDTDARAAALQRAIDGSQYECGPTELNVW
FT                   VDAQLADWELFDILILQLTGALDWPMYEALLFQPDGPQTFGEDGERTHEMTKTFGKLQK
FT                   FWDTEGSDIQLGAMHGDVLMDDARIVPFLTVLYGVSEADAQEMADLVQELLADPKFEGG
FT                   DHPIFTLNAFAYSDAPSPEEEQLGLPDKIIMGDGIIEAMEGLGLGDVGPRGILAHEYGH
FT                   HVQYELGLFDDHARDAEATRETELEADAMAGYYLSHPRGERLRQQRVVDFIESFGEVGD
FT                   CSFTSDGHHGTPNQREASARWADELANAKGKKGHIHPAQFVSDTFRAVLPEILAPDA"
FT   gene            265668..266099
FT                   /locus_tag="Ksed_02690"
FT   CDS_pept        265668..266099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05349"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJL9"
FT                   /protein_id="ACV05349.1"
FT                   /translation="MTCFVSHTSVDCRNAYELSEFWRELLAYEMDVDDPNEPGHEECAI
FT                   HDPQSGHVILFLEVPDAKAVKNRIHFDLRPRDGVTRDEEVQRVLTLGATQVEDCRGIHG
FT                   TGTGWVVLADPEGNEFCILRSPHEVEAGGAEQADAGQGA"
FT   gene            266099..266911
FT                   /locus_tag="Ksed_02700"
FT   CDS_pept        266099..266911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02700"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05350"
FT                   /db_xref="GOA:C7NJM0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM0"
FT                   /protein_id="ACV05350.1"
FT                   /translation="MRVLVTGAAGKVGRVVVHGLLDLGHEVVGLDRADAPADLPAAVAW
FT                   HTVDCADPVAVDDVFSAERLDAVVHLAAHPVEADLPTILTSHLHTAAAVLEAMVAHDVR
FT                   RIVYASSNHAVGRTPRTDLLGVDTPPRPDTFYGVGKVAGEALLSLYVDRYGVEAVACRI
FT                   GSMLPEPTSVRALSTWLSPADAVRMVQAGLTAPDPGFAVLYGVSANTRGWWDLAPGQAL
FT                   GYAPQDDAEAYADRIEARPHDAAEGRHVGGPFAMDQSNRPAFGDAPED"
FT   gene            complement(266983..267525)
FT                   /locus_tag="Ksed_02710"
FT   CDS_pept        complement(266983..267525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02710"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05351"
FT                   /db_xref="GOA:C7NJM1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM1"
FT                   /protein_id="ACV05351.1"
FT                   /translation="MATAQGTLDWKPLGEHLDLVAPPVADAFGAGALPTAQVCEIDPGL
FT                   ADTAAFCETYDVLPEASANCVVVEGRRGEQTTRAAVLVLATDRADVNKTVRKHLGVRKV
FT                   SFADQPSTEEATGMTSGGITPIGLPGEWPVLVDQAVATAEWVVIGGGVRGSKLLASGAE
FT                   LAALSGAEVLDLTIPAA"
FT   gene            267631..268128
FT                   /locus_tag="Ksed_02720"
FT   CDS_pept        267631..268128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02720"
FT                   /product="Activator of Hsp90 ATPase homolog 1-like protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05352"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM2"
FT                   /protein_id="ACV05352.1"
FT                   /translation="MITGRHEQIDGTDHLVLRRGIEAPVEEVWAAFTESDRLGLWFATW
FT                   AGDPASGQVEVTWAFEEDMPTEPYVIEECDPPHHLRARNVHEDPTQVWTIDVALTEAEP
FT                   GTALTFSQPLSNREMVRDVGPGWEYYLDRLQESIETGHPSTIAWGGYAGLTPEYVREFD
FT                   LA"
FT   gene            complement(268175..269302)
FT                   /locus_tag="Ksed_02730"
FT   CDS_pept        complement(268175..269302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02730"
FT                   /product="penicillin-binding protein, beta-lactamase class
FT                   C"
FT                   /note="PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05353"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM3"
FT                   /protein_id="ACV05353.1"
FT                   /translation="MSALTERVQQVIDASTIPGAVTLVARGGDVRIAAQGAMAHGGAPM
FT                   PEDAIFRIMSMTKPVLTVATLRMVQSGRLGLDDPVQRWLPELADRTVLRTPTAALDEVE
FT                   PTRRPITVRHLLTNGSGYGMEMADTPLARGYEQAGMAAGPEPISPGADAWLSRLATLPL
FT                   AHHPGEGFRYHHSFAVLGILLQRVAGVARQALLEREVLGPLGMVDTGERVGPDQAHRLP
FT                   AAATWRGEELVELEPAGGGFHVGPAPYDTAHGELVSTAADYLRLARMLADGGHVDGQPF
FT                   LDPSLVAGMLRDQTPAVAKTPESFFPGFWSGTGWGWGGAVVLEGHHAGRYGWSGGLGTD
FT                   FFVDPDGTIGLLLTQVEMGERTMPLFSAFNDLARS"
FT   gene            complement(269299..269412)
FT                   /locus_tag="Ksed_02740"
FT   CDS_pept        complement(269299..269412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05354"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM4"
FT                   /protein_id="ACV05354.1"
FT                   /translation="MRIIVTQNITLEGRASSGGVTDTAPEVAEAVPSGGAA"
FT   gene            complement(269550..269975)
FT                   /locus_tag="Ksed_02750"
FT   CDS_pept        complement(269550..269975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05355"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM5"
FT                   /protein_id="ACV05355.1"
FT                   /translation="MGRMGGVTEGDGSELTPVTGWQSLWRGQYLTTTHGHEYALDVDFF
FT                   DVGEKLHLYRDGRQVAVGRTQAVFFSLTVLLVALGLELPQLLQAFTRADWWQELTGWTF
FT                   RSPIELPEQVNTGLSLAGVLAGLERALRMQHNALLDE"
FT   gene            270224..270718
FT                   /locus_tag="Ksed_02760"
FT   CDS_pept        270224..270718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05356"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM6"
FT                   /protein_id="ACV05356.1"
FT                   /translation="MNRHSRMLGGLTSAALLAPAMLIAPAAEALPAVMISQIVYDSFGA
FT                   TKDDYSTRSLNAEYIVLKNTTSVSRTVTGWTVKDATGFRYTLPTTTIPAKGTVRIHTGK
FT                   GTNTNARGATTPGHRYWGKTSYVWNNTGDTATLRNRAGSLVDTCKYTDKSTKDSIKSVA
FT                   C"
FT   gene            complement(270780..271262)
FT                   /locus_tag="Ksed_02770"
FT   CDS_pept        complement(270780..271262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02770"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05357"
FT                   /db_xref="GOA:C7NJM7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM7"
FT                   /protein_id="ACV05357.1"
FT                   /translation="MTTLADFSATALDGTDQSLAQYAGQVALVVNTASKCGFTPQYRGL
FT                   EELYQQHRDAGFVVLGFPCNQFAHQEPGSAEEIADFCSVNYGVSFPMFARVDVNGAGAH
FT                   PLWRWLKQEKGGLGVSTVKWNFTKFLVGRDGRVIRRYGPATAPARIGADIERALAT"
FT   gene            271379..272107
FT                   /locus_tag="Ksed_02780"
FT   CDS_pept        271379..272107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02780"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: B3/4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05358"
FT                   /db_xref="GOA:C7NJM8"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM8"
FT                   /protein_id="ACV05358.1"
FT                   /translation="MRDQTELQAFLEQCSVDDDVFALRPDYRAMLVAVDGIEPGGTDAE
FT                   AEELLARADAHAAEQLSAAPVEELPLVAAWRGAYRAFGAKPQRTRNSLESLLRRAAADG
FT                   LPRVNRLTDLYNAVSVLHGMPLGGEDLDRYAGTARLVRATGDEPFTVVSGGEEAVEHPR
FT                   PGEVVWCDDAGVTCRRWNWRQGPRTALHEGTTAALFILDALDPLTDAELTAAADDLILR
FT                   LGRLGPDIRTARRLVTRSAA"
FT   gene            272107..272760
FT                   /locus_tag="Ksed_02790"
FT   CDS_pept        272107..272760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02790"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Putative FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05359"
FT                   /db_xref="GOA:C7NJM9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJM9"
FT                   /protein_id="ACV05359.1"
FT                   /translation="MLVFPENAPVDAAEWRTWLEGPEMFGALAVNNTDPAGAPLVVPAH
FT                   ATLTGDEVVLHLARVNPVWKHLEAATEVRFVVTGDSAYVRNDWRAKPGVPPAEGVPTSY
FT                   YASVQFRCGVQVVDDPAGIAEVLTWQFADLQPDGGHAEVSPTDGPYARMLPAIRALRLP
FT                   VREVVASFKYDDEKPTEHRERVAAHLEERGRGSDAGAAAQQRRRLREVGERHVR"
FT   gene            272774..273187
FT                   /locus_tag="Ksed_02800"
FT   CDS_pept        272774..273187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02800"
FT                   /product="acetyltransferase, N-acetylglutamate synthase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05360"
FT                   /db_xref="GOA:C7NJN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN0"
FT                   /protein_id="ACV05360.1"
FT                   /translation="MITVTLSTDPALLDVDRIHHWLSTDTYWARGRSRETVESTIAHSL
FT                   NLGAYDEDGQQVGYARLVTDHTTFAWLCDVYVDPAVRGQGISHQLVQGMLAECEPMGLN
FT                   RIVLATHDAHGLYERYGWQVLPEPGQWMTRGRP"
FT   gene            273255..273545
FT                   /locus_tag="Ksed_02810"
FT   CDS_pept        273255..273545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02810"
FT                   /product="predicted acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05361"
FT                   /db_xref="GOA:C7NJN1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN1"
FT                   /protein_id="ACV05361.1"
FT                   /translation="MSEVTIRSNPETSRYEALLDGEVVGLADYRLAGQTMEITHTETDA
FT                   GHQGQGIAGQVVRTALDDARSKGLSVIPTCPYVENWISEHPDYQDLLAEKR"
FT   gene            273585..276047
FT                   /locus_tag="Ksed_02820"
FT   CDS_pept        273585..276047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02820"
FT                   /product="phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: XFP N-terminal domain; D-xylulose
FT                   5-phosphate/D-fructose 6-phosphate phosphoketolase; XFP
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05362"
FT                   /db_xref="GOA:C7NJN2"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN2"
FT                   /protein_id="ACV05362.1"
FT                   /translation="MITVPAWPDDPATPLDDEEARRLHAWWRAANYLSVGQIYLLDNPL
FT                   LREELAPEHVKPRLLGHWGTTPGLTFLYAHFNRAIRQRGLNACYVTGPGHGGPGLVAAT
FT                   YLEGTWTETYPDVGQDLDGLQRLCKQFSFPGGIPSHVAPEVPGSIHEGGELGYSLSHAY
FT                   GAMLDNPDQIAFTVVGDGEAETGPLATSWHANKFSDPQHDGVVLPVLHLNGYKIANPTV
FT                   LARIPEEELVSLMRGYGHTPLLFTAGFDDEDELSVHRRFAAVLDEALDLIAQIKADAGP
FT                   DSPRPAWPMIVFRTPKGWTGPEQVDGKQTEGHWRSHQVPLANARDTPEHLEVLANWLRS
FT                   YRPEELFAQDGALLPEIAAMAPQGEKRMSANPITNGGSVLRDLMLPDFRDHAVELTSPG
FT                   QPFSEATSVLGGYLREVMRRNPETFRLFGPDETASNRLQAVYEVTDKQWNAEYHPSDAE
FT                   DPMARAGRVLEMLSEHQCQGWLEGYLLTGRHGMLNSYEAFVHIVDSMVNQHAKWYKVTN
FT                   QLEWRRPLASLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKAEIVRVYLPPDANTLLS
FT                   TVDHCLRSRQYVNVVVAGKQPNPTWLTMEEAIAHCVRGIGIWPWAGTESDGDDPDVVLG
FT                   CAGDIPTIEVLAAAKILREEVPGLTFRVVNVVDLMRLQDEKAHPHGLSETQFHTLFPAG
FT                   TPVVFGYHGYPWLIHRLVYRHDTASHFHVRGYTEEGTTTTPFDMVMRNQLDRYQLVVDV
FT                   IDRVPALGSRYARLRQRMEDKRLQARAHAYEHGEDLPEVAQWQWGDAQDEADAQQGSVR
FT                   QDTGGDNV"
FT   gene            276141..277163
FT                   /locus_tag="Ksed_02830"
FT   CDS_pept        276141..277163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02830"
FT                   /product="uncharacterized conserved protein with
FT                   pentein-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05363"
FT                   /db_xref="InterPro:IPR014541"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN3"
FT                   /protein_id="ACV05363.1"
FT                   /translation="MSAQAPSSVILIRALNFTPNPSTAADNAFQSEVEAGTEPAEVSRR
FT                   AIAEMDALADALREAGVTVHVFEDDEQTRPDSVFPNNWVSTHAGGYVAVYPMYASNRRL
FT                   ERRTDVLEMLKSTYRVQTVVDYSGLEPDGIFLEGTGAMVLDHVSRVAYTARSHRADTTV
FT                   LERFCADFNYEPMAFDAVDSAGVPVYHTNVIATIGTDVALFALDMIADEQRRWAVGERL
FT                   TVNGRKIVEITEEQVREFAGNAIELMGKDGEGNPERIMAMSARALRSLTDAQVAAIEES
FT                   CRIVAVDIPTIELAGGSVRCMIAGIHLDQRRDVERPFTEAVQAIDEHPHSLDGLEVRND
FT                   "
FT   gene            complement(277218..277682)
FT                   /locus_tag="Ksed_02840"
FT   CDS_pept        complement(277218..277682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05364"
FT                   /db_xref="GOA:C7NJN4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN4"
FT                   /protein_id="ACV05364.1"
FT                   /translation="MFESLQNFTDSLPEALQWAGVALISAIPFVESYFGSTIGILAGMH
FT                   PAVAIPAAIVGNIVSMVVIVSLAGKGRDLAVGEKEDSPRRAKLRRTFDRWGVPGVSLLG
FT                   QTLLPSQITSAMMVGFGADRRQVILWQCLSIVLWGVAFGMLAAAGVQFIR"
FT   gene            complement(277836..278356)
FT                   /pseudo
FT                   /locus_tag="Ksed_02850"
FT   gene            complement(278449..279675)
FT                   /locus_tag="Ksed_02860"
FT   CDS_pept        complement(278449..279675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02860"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05365"
FT                   /db_xref="GOA:C7NJN5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN5"
FT                   /protein_id="ACV05365.1"
FT                   /translation="MGAVSRVSSSRAPAPHFAAPTEKAVHNFSLYSLVSVGFVLASFLL
FT                   LDGAMLWVGLPTLRWVGIPLLLVFFVLGLALTRGALPLGSGEQDSPAAAPWWMVLATTG
FT                   VATALAGLQVWQEPASGASMSAYTMLVLSMVLGLSVRIRPASLLTALAAGVVTLVVAAR
FT                   HPEHAVVVAPGMLLGFVGLAIGYFSAWSMEVVRQQARSRHLLADLAVAEERLRFSRDLH
FT                   DTFGRTLSVVSLKAELGAELARRGRTEEAAAEMDGVRQVTQEGAAEVRRVVSGYRNLDP
FT                   AAEWAGARAVLRAAGIEVEATGKELLERCAAWSDTAREAVAWTLREAVTNILRHSDARQ
FT                   VQLALGEHDGWVEVEVANDGGHPAVPGHRGTGLQGLQDRVTAAGGHLHHESTNGRFVLT
FT                   ASIPSQEIP"
FT   gene            complement(279675..280148)
FT                   /locus_tag="Ksed_02870"
FT   CDS_pept        complement(279675..280148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02870"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05366"
FT                   /db_xref="GOA:C7NJN6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN6"
FT                   /protein_id="ACV05366.1"
FT                   /translation="MTTPRDAEPVPPRARPGTGPDSPDALGEVFLSTSRRLRHHIAHSL
FT                   APTGMVPHHARALRIVDRDGPMRLGELAAALHVVPRSVTDVVDALADAGWVTRTPDPAD
FT                   RRATVITTTAAGRARAREVEQVRRAAGDDFFASLPAADRATLRRILQALGEEA"
FT   gene            280219..282060
FT                   /locus_tag="Ksed_02880"
FT   CDS_pept        280219..282060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02880"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05367"
FT                   /db_xref="GOA:C7NJN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN7"
FT                   /protein_id="ACV05367.1"
FT                   /translation="MPVTVTPMHAMGPTGGGGPGRRGPQKISRADRAQLAQRPVEYGRV
FT                   VALFRPHGRTLAVVTAIIVLTSAVAMAQPFLVREAVDVAIPQQDVRLLLLVVGGMVGVA
FT                   AVTAMLGVVQTWMAAQVGQEVMHTLRSRLFAHLQGQSFSFFTRARAGEVQSRLINDVGG
FT                   MQGVVTTTATSTASNVTTAVATMVAMLALSWRLSLISLVVVPPAIWLTRKVALLRREIT
FT                   SQQQAALADLHVRIEEGLSVSGVRLAKTLGTTRQDAARFDEVSHGLIDLEMRAQLAGRW
FT                   RMATMQIVFAAIPAAIYLAAGLPATSGGMTIGTLIAFTTLQAGIFRPLMGLLNVGAQWV
FT                   SSMALFSRVFEYLDLEPDVVPPADPVPLDPTAVRGDVRLDAVSFRYAGSGRDALREVSV
FT                   EVPAGSSLALVGHTGSGKSTLAALVSRLYDPAAGRITIDGVDVRELDPEVLARIVGVVS
FT                   QETYLVHASIRENLLRAAPEATEVDLWRALGAAQVADLVAGLPDGLDTLVGSRGYRFSG
FT                   GEQQRLAIARTILRDPPVLVLDEATSALDNATERALQQALDTVSRGRTTITIAHRLSTV
FT                   EAADQIVVLAEGRVAERGTHAELLARDGVYADLALVA"
FT   gene            complement(282079..282642)
FT                   /locus_tag="Ksed_02890"
FT   CDS_pept        complement(282079..282642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02890"
FT                   /product="conserved hypothetical protein TIGR03086"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR03086;
FT                   uncharacterized Actinobacterial protein TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05368"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN8"
FT                   /protein_id="ACV05368.1"
FT                   /translation="MSLESGLHARFAQAFGEVADQVTDWDAPTPVKEWRARDIVEHLID
FT                   WYESVLEGWVDMDLPDRDPQDGPATAWHKRTADVQELLDDSERSTIELANGPFSGQTIA
FT                   EMTGELYVSDVFMHTWDLARSAGVEADLDPEYAEQMLEGMLPIETMLRQSGQYGPAVET
FT                   DSEDPVERLMAFIGRDVHAWTARA"
FT   gene            282840..283331
FT                   /locus_tag="Ksed_02900"
FT   CDS_pept        282840..283331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05369"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJN9"
FT                   /protein_id="ACV05369.1"
FT                   /translation="MNAPQSGTPLKIGMFLFEKVMTQRSTPVILTISPGRIVLASADRV
FT                   VADVPADQVRTKVSRVLKVNELHGPWGKWMLGAVGAAKSEDFTDAQATEVIEAQKAAQQ
FT                   DPALAQLELARTVWVGQPTTADGSWTGSLSSMAKGETKMQPRIAPMVDEALLAAGVQRA
FT                   "
FT   gene            complement(283338..285053)
FT                   /locus_tag="Ksed_02910"
FT   CDS_pept        complement(283338..285053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02910"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domain"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05370"
FT                   /db_xref="GOA:C7NJP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP0"
FT                   /protein_id="ACV05370.1"
FT                   /translation="MPHLELHDIEYWLPDGRPLLGGVGFRVGDRHRTALVGPNGTGKTT
FT                   LMRILSGEITDFEGQVTASGSVALMPQFIGRVRDDSTVRDLLLGVAPTPLRDAGRAVDA
FT                   AELRIMEVDDEAAQMDYAQALVDWGDVGGYDYETQVWDEVTLAALGVPFEKAQFRAVNT
FT                   LSGGEQKRVVLEALLRGPAQILLLDEPDNYLDVPGKRWLEQRLRDCGKSVLFISHDREL
FT                   LSEVATHVVTLEPHAAGATAWTHAGSFATWHDAREARNAALEEHLRRWEEEHAKLKALV
FT                   LRLKVKAEYNDGMAPRYRAAQTRLAKFEEAGPPEKVATTQNVRMRLRGGRTAKRAVVTE
FT                   QLELRVPALDGGGQATLMQPFDLEVWFGERVAVLGSNGSGKSHFLRLLAGGGSDPEPEH
FT                   RPVGDVTPPPVDHRGVARLGSRVRPGWFAQTQDHPGLVGRTLLEILHRGDEHRDGMGRE
FT                   QAAKTLDRYGLAGASERGYDQLSGGQQARFGILLLELSGATLLLLDEPTDNLDLHSAEA
FT                   LQDALEPFEGTVLAVTHDRWFARTFDRFLVFTSDGVVVETPEAVWDEERVRRRR"
FT   gene            285176..285535
FT                   /locus_tag="Ksed_02920"
FT   CDS_pept        285176..285535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02920"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05371"
FT                   /db_xref="GOA:C7NJP1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP1"
FT                   /protein_id="ACV05371.1"
FT                   /translation="MHEFDDRSPIYLQIAEQIRRDVATGELGEGDQVMSTTQYATTYRI
FT                   NPATANRAMALLVDEGVVHKRRGVGMYVSQGARERVVAARRSTYWTEVLDPALAEARAL
FT                   GIEAAAIIDHVRRTS"
FT   gene            285532..286269
FT                   /locus_tag="Ksed_02930"
FT   CDS_pept        285532..286269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02930"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05372"
FT                   /db_xref="GOA:C7NJP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP2"
FT                   /protein_id="ACV05372.1"
FT                   /translation="MTGGWEVTLQGVIQRFGRTTALDGVDVAFRPGVITGLIGRNGAGK
FT                   TTLLQAVAALRPVTEGQVLVDGAPVWEDAARTSRVCLLGHTGGVLEDVRIAATLDLYRM
FT                   LRPDWDEAAFRRVADRLEVPLDGRPSRLSTGQRSAFAAALALASLAEVTLLDEVHIGLD
FT                   AVARRRLTEAILEEYAERPRTIVLSSHLLDEVEEVMEDVVVLHEGRVVAAGPAGELREE
FT                   HTRGGGRLASLTDVLENLSGGAS"
FT   gene            286266..287072
FT                   /locus_tag="Ksed_02940"
FT   CDS_pept        286266..287072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05373"
FT                   /db_xref="GOA:C7NJP3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP3"
FT                   /protein_id="ACV05373.1"
FT                   /translation="MSTSAAPVDRRAGGPATGRPQWLAVARSIVRHVVVDLAIGLGVTV
FT                   GLAAVALLLLWFFVVRQETSDQAGGMWSDAGSFTLGLGAMILALVLVIAGIVVVVTTVT
FT                   GYTRVWLAAGATRRSVWAGHWAAVVTVLATWAAGLAAVLLAARFARTGSGSGGPSWSSI
FT                   GSLDWGYLANGVTLLLTALVVTLLFVRFGAFLALVVLALWWIVLPVGLSLVDVPQVVAA
FT                   VLWPPVAVGGTEARAVGDAANLWTELTQAALLAVAHWLIVRRMPAV"
FT   misc_binding    287141..287234
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            287227..288045
FT                   /locus_tag="Ksed_02960"
FT   CDS_pept        287227..288045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02960"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /note="PFAM: Hydroxyethylthiazole kinase family; TIGRFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05374"
FT                   /db_xref="GOA:C7NJP4"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP4"
FT                   /protein_id="ACV05374.1"
FT                   /translation="MTHAHALRGHDLTRAQLATTWDALRTRSPLVQCLTNRVATTLSAN
FT                   VLLAAGASPAMVDTPREARAFAGVASAVLVNLGTPTEESMQGIAEAVTGARESGTPWVL
FT                   DPIGAGGLPWRSGIATGLLAKRPTIVRGNASEVIGLAGGRGGRGADSIDHPESAVRAAC
FT                   RLVERSGGAVAISGAVDHLVDGRRLALLGHGHPWLTQVTGAGCALGALMAACVACTEDP
FT                   LLAAATATAAYTVAAERAAELSRGPGSLMPALLDELAQLTPESLAAAVQL"
FT   gene            complement(288163..289044)
FT                   /locus_tag="Ksed_02970"
FT   CDS_pept        complement(288163..289044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02970"
FT                   /product="predicted oxidoreductase, aryl-alcohol
FT                   dehydrogenase like protein"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05375"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJP5"
FT                   /protein_id="ACV05375.1"
FT                   /translation="MRTRNLGNDTVGRHQVGAIGMGLMTMSQDGEPPRQQLLDTVTAAL
FT                   EAGVTLFDTADAYGQGTAGEQAMGQNERLIAGLLDELGVRSEVVLATKAGHTRGEDGSW
FT                   GLDSRPEYLREAAEASLARLGVKQIQLWQHHRPDPECDYRATMEALREVADSGIVAMVG
FT                   ISNADPEQIRTAHDVLGDRLVSVQNQFSPKFRSSAREIEVCTELGLAFLPWSPLGGLNE
FT                   AKELAEKHPAFAEVADERGVSPQQVALAWELAQSEVVIPIPGAKRPQSITNSAAAAEID
FT                   LTDRELERLDAS"
FT   misc_binding    289108..289202
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            289256..289903
FT                   /locus_tag="Ksed_02990"
FT   CDS_pept        289256..289903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_02990"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="PFAM: Thiamine monophosphate synthase/TENI; TIGRFAM:
FT                   thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05376"
FT                   /db_xref="GOA:C7NJY9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJY9"
FT                   /protein_id="ACV05376.1"
FT                   /translation="MDLSLYLVTDSAMAGSRGLADVVARAVAAGVTCVQLREKAASDEE
FT                   VVALGRQLVEMLAGTGVPLLIDDRVHLVHPIGADGVHIGQEDTPPTAARAALGPEAIIG
FT                   LSVHDAAQVDAANALPPATLDYIGLGPVWATGTKDGHAPPIGPEGLADLRRRSHHPAVA
FT                   IGGVKAHTLAELAGSGVEGVAVVSAICAAADVPAATRELREALAASPLQGEL"
FT   gene            289900..290697
FT                   /locus_tag="Ksed_03000"
FT   CDS_pept        289900..290697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03000"
FT                   /product="hydroxymethylpyrimidine
FT                   kinase/phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05377"
FT                   /db_xref="GOA:C7NJZ0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ0"
FT                   /protein_id="ACV05377.1"
FT                   /translation="MSTPTVLSIAGSDPSGGAGIQADLKTFSALGAYGCAALTALTAQN
FT                   TRGVTGIHPVPPEFVRDQVLTLVDDVQVDAVKIGMLGSAAVAEAVADLVGEVLDCPVVL
FT                   DPVMVSTAGARLLDRDAVEAVLRLAPLVDLVTPNGPEAAVMLGCEEARTVTQQTEQAQE
FT                   LYRRLGTRVLLKGGHLPGPRATDVLADHDGTATLTALRVVTDNTHGTGCTLSSAIAALL
FT                   PQRGDWGDAIEGAKDYLTDALRRSDELGIGHGAGPVHHFHEWW"
FT   gene            complement(290720..291160)
FT                   /locus_tag="Ksed_03010"
FT   CDS_pept        complement(290720..291160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03010"
FT                   /product="uncharacterized stress protein (general stress
FT                   protein 26)"
FT                   /note="PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05378"
FT                   /db_xref="GOA:C7NJZ1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ1"
FT                   /protein_id="ACV05378.1"
FT                   /translation="MRDTRIAVLTYTDEQGRLVSMPMGTQTFDDPSTVWFITGLDTDKV
FT                   NAIRANPQVSVSYSSDDGWVSYSGTATPSQDKAKLDELWDASASAFMDTEKDDPRSGLL
FT                   EIHRQTAEFWASDGAVRTAFEFAKGLVSKDRPDMGTNDTVQL"
FT   gene            complement(291342..292571)
FT                   /locus_tag="Ksed_03020"
FT   CDS_pept        complement(291342..292571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03020"
FT                   /product="alpha-hydroxyacid dehydrogenase, FMN-dependent
FT                   L-lactate dehydrogenase"
FT                   /note="PFAM: FMN-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05379"
FT                   /db_xref="GOA:C7NJZ2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ2"
FT                   /protein_id="ACV05379.1"
FT                   /translation="MRRQLPNPRELAPLMRFSKPTLNRTTARLAKAADIADVRRIARRV
FT                   TPTGPFDYVDGAANSEESMRRNTEAYRNLELRPTVLRDVGEVDLSTEVFGQRSELPVGL
FT                   APTGFTRMMHAAGEPAVARAAQSAGVPYTLSTMGTTAIEDLAAQVPDARRWFQLYSWRE
FT                   DRDRARGLVERAQENGYDTLMVTVDTATGGLRYRDHRNGMTIPPQLTARTLVDASYRPR
FT                   WWFDFLTTEPLRFATLSSSAGDSMDVIMKTFDPTLSWADIEWIREVWAGPLLVKGIQTP
FT                   SDAQRALDAGCDGVYLSNHGGRQLDRAPVPLAELPGIREVLGPDVPIIVDSGITSGVDV
FT                   LGALALGADFTMIGRAYLYGLMAGGQRGVERVLDILRAELQVGMQLLGVRSVDELGPQH
FT                   VRLDHRAPRD"
FT   gene            complement(292679..293509)
FT                   /locus_tag="Ksed_03030"
FT   CDS_pept        complement(292679..293509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03030"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR family regulatory protein; Bacterial
FT                   transcription activator, effector binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05380"
FT                   /db_xref="GOA:C7NJZ3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ3"
FT                   /protein_id="ACV05380.1"
FT                   /translation="MTDTPNPMSIGQFSSLTRLSVRMLRHYDKHDVLTPAEVDAASGYR
FT                   LYTSDQLADAADVRRLRDVGFGVSAIAALLTSRGTPAWEHALRMQRQSLTADLLAAQQR
FT                   MALLDRMLQTKEKTMSIEISETTLPSTTMVLLRGAIPSYSEEGVLWEQFIPELGRQGLT
FT                   PIGPGGVVENDPTYVEAGPDVSVWLPVAPGTTARGPLEVHELPEQRAVKATITGPYSQI
FT                   SEAHAQMAQYMGQEGLTEASPGDGPVGKVVNRYLSDPSNTPEADLLTEVYRPLA"
FT   gene            complement(293543..293842)
FT                   /locus_tag="Ksed_03040"
FT   CDS_pept        complement(293543..293842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05381"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ4"
FT                   /protein_id="ACV05381.1"
FT                   /translation="MSTTHARHQLDEIIHAPTRFSIVAALASTDKAEFAAVRGAVEISD
FT                   STLSKQASALEQAHEARLAGDEFRLVHEGHAASVGGRIAGTRPRRRTGIVAGGS"
FT   gene            complement(293839..294276)
FT                   /locus_tag="Ksed_03050"
FT   CDS_pept        complement(293839..294276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05382"
FT                   /db_xref="GOA:C7NJZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ5"
FT                   /protein_id="ACV05382.1"
FT                   /translation="MENTTHTPNAREAQAAPDGASGARVTSGKDLSTLRFTAAAVSLAM
FT                   AAVLVLFHVTQSSAIGLIIGMSVYIAMIRPMTMVAQQAKSLPRGYTKQYTGAVVASSLL
FT                   YGVGILVSVLTEAPLWLMIGLAVLVALPGVIVATRLGKSAR"
FT   gene            complement(294400..295515)
FT                   /locus_tag="Ksed_03060"
FT   CDS_pept        complement(294400..295515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03060"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="PFAM: Alanine dehydrogenase/PNT, N-terminal domain;
FT                   Alanine dehydrogenase/PNT, C-terminal domain; TIGRFAM:
FT                   alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05383"
FT                   /db_xref="GOA:C7NJZ6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ6"
FT                   /protein_id="ACV05383.1"
FT                   /translation="MRIGVPTEVKNNEYRVGMTPVGVRELTGRGHEVLVQAGAGVGSSI
FT                   TDEEYAAQGARIVESADEVWGEAEMVVKVKEPIAEEYGRLRADQVLFTYLHLAAEPELT
FT                   KALIDAGTTSIAYETVQRPDRSLPLLYPMSEVAGCLAPQVGAASLLKARGGRGVLMGGV
FT                   GGVAGAKVAVLGAGTAGQNAANIAMGMGADVTLLDIDLEKLRMSFWRYGNRVHGIASSE
FT                   LAIERAVTEADLVIGSVLIPGAAAPKLVTNDLVAQMKPGSVLVDIAIDQGGCFEDSHPT
FT                   THDDPTFEVHDSIFYCVANMPGAVPATSTQALTNATLPYTLRIADAGWKAALGADEALA
FT                   KGLATHAGSLYSAPVGEALGIESKDPAGLLG"
FT   gene            295635..297356
FT                   /locus_tag="Ksed_03070"
FT   CDS_pept        295635..297356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03070"
FT                   /product="carbon starvation protein, predicted membrane
FT                   protein"
FT                   /note="PFAM: Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05384"
FT                   /db_xref="GOA:C7NJZ7"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ7"
FT                   /protein_id="ACV05384.1"
FT                   /translation="MNSLVLVLVGIAMILAGYLLYSRWLATRVYTLDAGFRTPSHALRD
FT                   DVDFVPTNKYVLWGHHFTSVAGAAPIVGPAVAVIWGWLPAFLWVTLGTIFFAGMHDLGA
FT                   LWASVRNRGQSIGSLSARYIGRRGANLFLVVIFLLLLMVNAAFAVVISGLLVSTPSAVI
FT                   PTWGAIAVALLIGQAIYRFRWNLPIVSVVGVVALYALIWLGDQYPVSLPDTVLGMPASG
FT                   VWIVILFAYAGIASVLPVWLLLQPRDYINGLQLFLALGILFAAVLISTPTVVAPAINDA
FT                   VPEGTPGIAPLLFVTIACGAISGFHGMVASGTSSKQLDNETDARFVGYFGAVGEGLLAL
FT                   GAIVATTAGFQTLADWEEVYSAFGQGGVAAFVEGGGSIVQNGLGLPQSLSATILATTAV
FT                   LFAATTMDTGVRLQRFVVSEIGEVMGVTLNKWVSTAIVLVVAVGLTFAAGADGSGGMLI
FT                   WPLFGTTNQIMAGLTLAIVAVMLLRRGRPALPAIIPLTFVLIMSVLALLVQMGTFWQDR
FT                   NWLLLVLDVIILVAAVWVIVEAVGAMVRASRGEVDDDEHDPLDADEGATARDAVSR"
FT   gene            297340..297648
FT                   /locus_tag="Ksed_03080"
FT   CDS_pept        297340..297648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05385"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ8"
FT                   /protein_id="ACV05385.1"
FT                   /translation="MPSPAESPDGLAGLGARVRAGLRAVGAWAEESYHLPYRSTLARAQ
FT                   ADEDDLFMLMVLGESLGLPNPMGYHSLELLPAVYERFHVWHQRMGMDRSPLDHMSCC"
FT   gene            297662..298630
FT                   /locus_tag="Ksed_03090"
FT   CDS_pept        297662..298630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03090"
FT                   /product="oxyanion-translocating ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; TIGRFAM:
FT                   arsenite-activated ATPase (arsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05386"
FT                   /db_xref="GOA:C7NJZ9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NJZ9"
FT                   /protein_id="ACV05386.1"
FT                   /translation="MSSLLETLLTRSTLFVGGKGGVGKTTMASAVALEAARRGRRTLLV
FT                   STDPAHNLGHLWGRRLGGRVTAVREGLEVLEIDPTREVEEHLAAVGRTMRRMMPEHLHG
FT                   EVARHLDAAREAPGTQEAALLEAVADVVAGAPERDLVVFDTAPSGHTSRLLSLPEHLRA
FT                   WTDALLARQDSSARFGQALRGLGDADASSRRARRDAEIRGVLERRRARFELLRTTFTAP
FT                   ETGFLLVMTAERLPADETLELHDTLAGLGVGIDGLVVNRRSPRDQGEFLARRHVQEQVH
FT                   LDRVRTALPDLPALEIPLHDTDPVGEDGLAQVVRALAGEPG"
FT   gene            298738..299355
FT                   /locus_tag="Ksed_03100"
FT   CDS_pept        298738..299355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03100"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Vitamin K epoxide reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05387"
FT                   /db_xref="GOA:C7NK00"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK00"
FT                   /protein_id="ACV05387.1"
FT                   /translation="MSERIEETGTSGPGWATDKALGWLLTLTGLVGWAASATLVWERLN
FT                   LYENPLHRTSCDVNPLVSCGTVMQTPQAELFGFPNPLIGIVGYALVVAFGVALLAGAHF
FT                   SRWLWACIWVGVALAGVFLIWLWSQALFEIVKLCIYCMVAWAATIPMFLGLTGALVSRG
FT                   TFGLSDGVRRFAREWTWVTVIVVYVAVTASVLAVFLPKFMAQ"
FT   gene            complement(299422..299886)
FT                   /locus_tag="Ksed_03110"
FT   CDS_pept        complement(299422..299886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03110"
FT                   /product="Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /note="PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05388"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK01"
FT                   /protein_id="ACV05388.1"
FT                   /translation="MAQNFIVSRSREIAAAPETVFPYLDDLHRWQLWSPWEGLDADLHR
FT                   TYSEPANGVGARYAWEGNRKAGKGRLEITHAEPSRVALDLHFEKPFRADSQVAFTLEPT
FT                   ALGTLVTWAMSGRKNLMMRALSPVVNMDKMLGQDVEKGLAQLQVAVERGA"
FT   gene            299939..300781
FT                   /locus_tag="Ksed_03120"
FT   CDS_pept        299939..300781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03120"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /note="PFAM: NAD synthase; TIGRFAM: NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05389"
FT                   /db_xref="GOA:C7NK02"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK02"
FT                   /protein_id="ACV05389.1"
FT                   /translation="MRELQRVIVDEMGVRAQVDPAQEVERRVDFLVNYLRATGTKGFVL
FT                   GISGGVDSTLAGRLAQLAAERHREQGGDAVFVAVRLPHHVQHDEDDARAAMQFVAADEE
FT                   VIYDVGPAVDAFEEQFAVALGQEVSDFNKGNIKARLRMVAQYAIAGERSLLVVGTDHGA
FT                   ESVTGFFTKFGDGGADILPLFGLHKGQNRELARHLGAPERLWAKVPTADLLDDQPGRPD
FT                   EDELGLTYADIDTYLEGGEVPDEVADRIEQRWRTSRHKRTTPVTIHDTWWRTDNQMED"
FT   gene            300783..301610
FT                   /locus_tag="Ksed_03130"
FT   CDS_pept        300783..301610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03130"
FT                   /product="short-chain dehydrogenase of unknown substrate
FT                   specificity"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05390"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK03"
FT                   /protein_id="ACV05390.1"
FT                   /translation="MQLEGKVFAVTGGGNGIGREVVLGLLRAGSRVAALDLSAEGLAAT
FT                   VAEAEAEGSAAMLTTHPVDVTQRDAVSTLPEQVVTAHGAVDGLVNVAGIIQPFVTVDAL
FT                   TPEQIERVMNVNFWGVVNTCQAFLPHLQARPEAAIVNFASMGALTPVPGQAAYGASKAA
FT                   VKLFTEGLYCELKDGPVDVTIVFPGAIATDIAGNSGVTVNAPADDTAAAEASTHPTTSA
FT                   VDAAEATIGAIESGAYRLVIGKDAKFVDWASRVAPQWAANYITKKMADLLERA"
FT   gene            301607..301996
FT                   /locus_tag="Ksed_03140"
FT   CDS_pept        301607..301996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05391"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK04"
FT                   /protein_id="ACV05391.1"
FT                   /translation="MTDQSSPAEGAVPPPGPMPEPSLSDFERFRRAQFLFAQKLYREAA
FT                   VELETLLGTSDPGHGLSEVRLTLARAYFHSAQLSRAEGLAREMLAERPEDGYVAVLLAR
FT                   SLERQGRDAEAAPYLERARVLGQDV"
FT   gene            302059..303276
FT                   /locus_tag="Ksed_03150"
FT   CDS_pept        302059..303276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03150"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05392"
FT                   /db_xref="GOA:C7NK05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK05"
FT                   /protein_id="ACV05392.1"
FT                   /translation="MTAAPHRPGQGPAGRRPAAPLVFWLAAATFGIGITEFAAMTLLPF
FT                   YAAEFGVPEHTASMAVSAYALGVVIGAPLLSMAVARWERRKALVALLALFVVGNLLGAA
FT                   ANSLPTLVAARFVAGLPHGALFGIAQLVAATAMGRERAAQAVAWVLTGLTVATVVGVPT
FT                   LSALGQATSWRVPFVLVAVGGVVVAAVLARLVPPGGGSRKGSALAELGALRNPDVLLPL
FT                   AMGAIGFGGMFAVYSFLSATLLQHTHAPGWAVPIVLMAYGVGGTLGNLVAGRSPEHRLL
FT                   ITAGAFQAFIGVATLVYSFTVDHWWLMLVSVALVGFGGGMVVPLQTRLMHVAGEAQTMA
FT                   AALNHAAFNAANALGPAVASAALAAGWGWRSTGWVGVLLALGGLAVWAVIMVRERRGAS
FT                   ALAAAG"
FT   gene            303337..303678
FT                   /locus_tag="Ksed_03160"
FT   CDS_pept        303337..303678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03160"
FT                   /product="predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /note="PFAM: 6-O-methylguanine DNA methyltransferase, DNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05393"
FT                   /db_xref="GOA:C7NK06"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK06"
FT                   /protein_id="ACV05393.1"
FT                   /translation="MNELLVEKVLRCVELVPRGRVVAYGEVGRIVGTAARVVGAVMASH
FT                   GHLVHWWRVTNHAGDLRPDLLARALPHWQEEGIAVKPNGLGCRIEEYRVDLDWLAAAWA
FT                   EDAADLPEA"
FT   gene            303804..304757
FT                   /locus_tag="Ksed_03170"
FT   CDS_pept        303804..304757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03170"
FT                   /product="formiminoglutamase"
FT                   /note="PFAM: Arginase family; TIGRFAM:
FT                   formimidoylglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05394"
FT                   /db_xref="GOA:C7NK07"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK07"
FT                   /protein_id="ACV05394.1"
FT                   /translation="MSEQRSTSWTGRDDGPGPEHRRWHHIATGSAGPGEGRGPHVGIVG
FT                   FASDEGVRRNSGRQGAAEAPPLLRAALAGLAAHRPFTLTDHGDTGYDGQDLEAGHDAVG
FT                   DVIATSLDADDLTVVLGGGHETAWGCYLGRARSQRFGADEAMGRTVVVNLDAHFDLRQA
FT                   GRPSSGTPFLQMARAEQEAGRHLDYAVVGIAEPSNTTVLFDTARQLGVRWLTDVDSTEE
FT                   RALAFLDEVLAVADHVHLEIDLDVLPADIAPGVSAPAAVGVPMRTTSAVVRHLAASGKL
FT                   RIVDVAEYNPRYDVDSRTAKAAARLVADIVHALPGA"
FT   gene            304960..305523
FT                   /locus_tag="Ksed_03180"
FT   CDS_pept        304960..305523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03180"
FT                   /product="peroxiredoxin"
FT                   /note="PFAM: AhpC/TSA family; TIGRFAM: peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05395"
FT                   /db_xref="GOA:C7NK08"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK08"
FT                   /protein_id="ACV05395.1"
FT                   /translation="MSLINTTIKPFQTTGFVNGEFKDFSDADIQGKWAIFFFYPADFTF
FT                   VCPTELGDLADYYEELQGLGVEVFSVSTDTHFTHKAWHGSSDTVGKVTYPMLGDPTQQI
FT                   SRNFEILREDEGLANRGTFLVDPDGVIQFIEVTSEGIGRNAAELVRKVKAAQYIRKNPG
FT                   QVCPAKWEEGAETLEPSLDLVGKI"
FT   gene            305750..307432
FT                   /locus_tag="Ksed_03190"
FT   CDS_pept        305750..307432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03190"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   TIGRFAM: alkyl hydroperoxide reductase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05396"
FT                   /db_xref="GOA:C7NK09"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK09"
FT                   /protein_id="ACV05396.1"
FT                   /translation="MLDQNLATQLRQLLGNLKRPIELLTTVEADATDATSRETLELCAE
FT                   IAEMSELVTTREAEGEERADRAPSFRIQAAADTSSAVTFAGLPMGHEFTSLVLALLNIG
FT                   GHPSKAAAETIEQIRGIEGTHRFETFFSQSCQNCPDVVQALDLMATLNPNITHVAIDGS
FT                   AFPEEADERGVMAVPTVFLDGEDFGSGRMTLEEIVERIDTGAAEAAADRLADADPYEVL
FT                   VLGGGPAGSTAAIYAARKGIRTGLVAERMGGQVNDTMSIENVSGTSHTEGPKLAADLER
FT                   HVNDYEVELVKSQEAVGVTPAEAEGGYHSVELASGATLRSRSLVIATGASWRTMGVPGE
FT                   DEYRNKGVTFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTVLEFMDSMRAD
FT                   QVLQDKLRSLPNVDIVLGAATKEVVGDGSRVTGLKYEERATGESHQLELEGVFVQIGLV
FT                   PNSAFLKESGVELTDRGEVVIDGRGATNVPGIFAAGDVSTVPYKQIVVAFGSGSTASLS
FT                   AFDHLIRTSAPADEPASETAAATKVVDSENEPTDVADLADANS"
FT   gene            307429..308331
FT                   /locus_tag="Ksed_03200"
FT   CDS_pept        307429..308331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03200"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: LysR substrate binding domain; Bacterial
FT                   regulatory helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05397"
FT                   /db_xref="GOA:C7NK10"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK10"
FT                   /protein_id="ACV05397.1"
FT                   /translation="MNLRDLEYLVALGDHRNFGRAAAACGVSQPTLSTQVKKLEAVLGC
FT                   ALVERAGRQTLLTPAGEQIAGRARRMLGHAEAIHRVAEQARDPRSGSLRLGIFPTLAPY
FT                   LLPHVVPAVHQALPELNLLLVEERTPDLMQQLREGTLDAVVLAGPLTDPGLAVEPLFRE
FT                   DFLLAVPLDHPLAGQETVDPSVLGDESVLLLEDGHCLRDQALDVCRSSGAVEMDGFRAT
FT                   SLETLRHMVASGVGVTLMPRMAVDRPGGPGGVATVEFTAPAPHRDIVLAWRTSSVQDDL
FT                   MPELADLLRSVPAPLATPA"
FT   gene            308363..308944
FT                   /locus_tag="Ksed_03210"
FT   CDS_pept        308363..308944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03210"
FT                   /product="acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05398"
FT                   /db_xref="GOA:C7NK11"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK11"
FT                   /protein_id="ACV05398.1"
FT                   /translation="MDQERGSPPVDEVEVDRLRLADVESLARVHGLIWRATYTGLLPDA
FT                   VLDSLDPVAGAARWREVAQRLADEGPTGAAHPLGSNGPPPVADTRVARQQDGHVLGFIS
FT                   VGPPRDDDPPAPRELWALNLDPRWHGTGLADRLLTAALPTGPAYLWVLEGNERAIAYYG
FT                   KRGFTDTGRRKELIHRTGPTGVAEWCLLRP"
FT   gene            complement(308946..310898)
FT                   /locus_tag="Ksed_03220"
FT   CDS_pept        complement(308946..310898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03220"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="PFAM: Ion channel; TrkA-C domain; TrkA-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05399"
FT                   /db_xref="GOA:C7NK12"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK12"
FT                   /protein_id="ACV05399.1"
FT                   /translation="MVNPLTRMTAQHRAIRTDSQRREKVDVPRDDSALDVLQLALRRMR
FT                   MPVLLVVLVFSISVIGLSLMPGVDAEGNPHRLTLFDSLYFMSYTATTIGFGEIPYSFTI
FT                   YQRMWVMGSIFASVASWTFAITSMFSLLSAPGFRAAMTSLRIQRVLRRTRDPFYIVVGN
FT                   GQTGAAVVEGLLAIHRDVVVVDQDPERLERLTMGQTTGSVLGLHGDARKVETLGSAGLG
FT                   NSYCHGVLAMTDDDETNLAVVMSVNLLRPDVPVIARSNTAAMADRMRDFFPEHVVNPLD
FT                   EYGKYLTMQLKRPHTHRLSQWLMNTPGTLIGPYRPGLADGRWVVVSDGEFGQEVARDLA
FT                   SAGLDVTRVDPVGELVDLTDVVGVVVGAESDIVNMSVAARVRAANPDCYLALRQKSLAR
FT                   RATTEAFAPDSVFVPAELVAHEAMAYLISPNYWHFVRKVMEREDEWAKEVLSALQRRVG
FT                   RRTPEAARLDVSREHAPALHAWLQGNRITLGQLLTHPETDRTLPVYTAVLSREGERIEA
FT                   PQADLPLQVGDIVMVLGTPSGLADLTSTVHNSADVEYLATGVRVPRTLVFRALRRLRRG
FT                   GPGASGPDSPGPGGAPAGQADGEQPRPRHITPRPGHRPPSTWSGTHRRRSTVPRRGGPG
FT                   GADRTGGTGASSNRG"
FT   gene            complement(310914..311300)
FT                   /locus_tag="Ksed_03230"
FT   CDS_pept        complement(310914..311300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05400"
FT                   /db_xref="GOA:C7NK13"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK13"
FT                   /protein_id="ACV05400.1"
FT                   /translation="MNFEKVVFGFFVLLAATVNFGYVLGDIGDPALHNPYELYIAVAVN
FT                   IVATILKVGDRTHVGAIHLAASLVACLQLVAAAGLWVVADQTGDGIPDAHEMASVVSIA
FT                   AGALLANLVSLVILVVETVNYRGR"
FT   gene            311589..312278
FT                   /locus_tag="Ksed_03240"
FT   CDS_pept        311589..312278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03240"
FT                   /product="response regulator with CheY-like receiver domain
FT                   and winged-helix DNA-binding domain"
FT                   /note="PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05401"
FT                   /db_xref="GOA:C7NK14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK14"
FT                   /protein_id="ACV05401.1"
FT                   /translation="MNQTQTAVHVLLVEDDEMLRETTALVLERQGFTVSTASDGVEGLD
FT                   ALRRETFDVAVVDVMMPRMDGITFARKVREGSDLPIVLLTARDLPHDQLAGFQVGVDDY
FT                   VTKPFDGEVLAARLRAVLRRVDTVPEEPATATIRVADLSVNRDGMVVKRAGETISLSAT
FT                   EFRLLEVLLDHRGRVLSRHQLLEMVWDIGSWGDTHVVEVTVQRLRRKIGAERIVTVRGA
FT                   GYKLVDA"
FT   gene            312275..313630
FT                   /locus_tag="Ksed_03250"
FT   CDS_pept        312275..313630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03250"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; HAMP domain; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05402"
FT                   /db_xref="GOA:C7NK15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK15"
FT                   /protein_id="ACV05402.1"
FT                   /translation="MTPDRPRGGRRAAPAHSGGIPTHRLDAAVTGPMRVRGHTSRETPH
FT                   PGTTHWRDSIRTRIVLAVMLVSIMTSAGLGALLSAQAADAARESLRHQAITRLDTVSDS
FT                   YRLDGRVRLGATADPDVPPLELTQGMQEGDRRSYYDGETMWASERLGRDVLLTVQLEDD
FT                   LLEQQDTARYRTLLPSLAVTALTAAAAAWLLGNALSSRLRRAAVAADAMAHGDTSARTD
FT                   QGGSDEVAALTRAVDTLAVTLQTRLEAERAFTADVAQELRTPVTGLVSAVELLPEGRPA
FT                   TLVRTQVGRLRRLVEDLLEVSRLESGSEVATLEEHDLGEIVDRTVRFLAVSAPCERVEL
FT                   RGDAPGRVMIDPRRFERIMANLLVNVQRHGGGHCVITVVRHAVVVDDFGDGYPEEIIER
FT                   GPQRFHGSGATKGTGLGLTIISKQAATMGATVEFDRARGGGARTVLHFEPAD"
FT   gene            complement(313648..314178)
FT                   /locus_tag="Ksed_03260"
FT   CDS_pept        complement(313648..314178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05403"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK16"
FT                   /protein_id="ACV05403.1"
FT                   /translation="MHHLFRRHNWVLAAACSVLVAACSGADEAPQTHGESSTSAPSSAV
FT                   GTQELSAQGGAEGASPASEVGAEPMILDCLGEGSMVRPETLSLDCQETNATLSKLQWSQ
FT                   WDTEGAKGSGEFSVNNCAPNCAEGTVETYQVDVQAPDVKTSEAGSVYTSITVNFHDGRP
FT                   VGSTSRETYELPH"
FT   gene            314409..315722
FT                   /locus_tag="Ksed_03270"
FT   CDS_pept        314409..315722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03270"
FT                   /product="outer membrane protein/peptidoglycan-associated
FT                   (lipo)protein"
FT                   /note="PFAM: OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05404"
FT                   /db_xref="GOA:C7NK17"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK17"
FT                   /protein_id="ACV05404.1"
FT                   /translation="MSDNWGEDDRLEARDGDGVDRYDISDEDHEEWYEVSRRYRRGLGG
FT                   WWWLALLAIPLLLALLGMLFGGDDEGEGDGDASSSTNSGNTSSSTNSAEAPSAAAVSYT
FT                   GGADKVSFSATAPSEADRDALVKAVENANEGKTVTSEVSVDESAPLVTGPALGALTAAL
FT                   TAGGDDLSISGDAEALTLSGEVADAAAKKKVASELAKVYPDAEITNELTAAAGGGGKSP
FT                   SAKPSASSPAESSPAESSPAAPSPSASSPAAPSPSASSPAPSPSTTSEPSPSATSEPAP
FT                   SVTSEPTKTPDPSRTDEPGPDPSVDPGLAAVNKIEDLTCKNAPASMKGISAAYPMRFPS
FT                   SSDALYGESAVNAARIGEKLAGCDFDVVVVGHTDSVGGEVNERLSAFRAEKIAQALVVA
FT                   GVDFDRIQQSNASASQPIASNETEDGRAKNRRVEILVK"
FT   gene            315736..315894
FT                   /locus_tag="Ksed_03280"
FT   CDS_pept        315736..315894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05405"
FT                   /db_xref="GOA:C7NK18"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK18"
FT                   /protein_id="ACV05405.1"
FT                   /translation="MAEFLMEWLWYLVAFVVGALAMYVVIGMTVPADSEEAAFSDLPGA
FT                   REIGDDA"
FT   gene            315891..317048
FT                   /locus_tag="Ksed_03290"
FT   CDS_pept        315891..317048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05406"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK19"
FT                   /protein_id="ACV05406.1"
FT                   /translation="MNWLLMILSFALGGLTTWLWSVRTVTRVIPASEYDRHLDAQYDDE
FT                   DDALERDGDTRDGAAGLGAAGVAGGAAGAAALSDRDRDDDYLEVDEDHGRYTERDDVAL
FT                   ADDAEATDDAVLADDLEPADERELTSDEDDLAGADEAAGAHALGDLDEDDAASEGEFVS
FT                   TDAEVTDDDADLDTTSVAGAGAATGVAGFAAGSQLEDEDASELGDGIEGDDDVVDPAST
FT                   ATVAPGTTGGDVVVVEEIEDVDGQPVGRSASDAHTEAIPMVGQGMTDEDVDAASADDLQ
FT                   PVDADAEYADEVDPIAPDASFLEDSEDVDGDEAVEDDAPYGPGSARSAADGSGPEGWAI
FT                   KGNADSGLFHTEESPGYENTRAEVWFADEASAIAAGFRHWDRKQR"
FT   gene            complement(317139..317975)
FT                   /locus_tag="Ksed_03300"
FT   CDS_pept        complement(317139..317975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03300"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05407"
FT                   /db_xref="GOA:C7NK20"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK20"
FT                   /protein_id="ACV05407.1"
FT                   /translation="MTTGALVLAATPIGDPADAAPRLSAELTGADLVAAEDTRRTLRLA
FT                   SALDITLTAPIVSYHEHNEASRTAELTARIAEGARVVLVTDAGMPSVSDPGYRLVQACV
FT                   EQELVVTCVPGPSAALMALAVSGLPVDRFCFEGFPPRKAGPRAAMLAGLAQERRTMIFF
FT                   EAPHRLADTLGAMATAFGADRPAAVCRELTKTYEEVRRGPLEELAQWAVEASRGEITVV
FT                   VQGATPRAADPAAASERVRELVADGVRLKDACKQVAAETGLPARELYESVLSRRSS"
FT   gene            318134..318745
FT                   /locus_tag="Ksed_03310"
FT   CDS_pept        318134..318745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05408"
FT                   /db_xref="GOA:C7NK21"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK21"
FT                   /protein_id="ACV05408.1"
FT                   /translation="MLAALTGLGLSAAAGFNAYIPFLIVACVARFTTLITLPSEFAWIE
FT                   SWWAIGGAAILLVVEMTVDKIAVVDHVNDAVGTFLRPMTGGLIFAATSAADSIDNSQWM
FT                   AEHPWVGVIAGIIVAGLVHSGKAAARPVVNASTAGVGAPVVSVAEDAAAISLSLVAVFA
FT                   PLFVLVLLAVLAWIVWSLWRRFKRLTGRRRPEPEYVPLSS"
FT   gene            318755..320557
FT                   /locus_tag="Ksed_03320"
FT   CDS_pept        318755..320557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03320"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="PFAM: tRNA synthetases class I (M); TIGRFAM:
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05409"
FT                   /db_xref="GOA:C7NK22"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK22"
FT                   /protein_id="ACV05409.1"
FT                   /translation="MTKVLSAVAWPYANGPRHLGHVAGFGVPSDVYSRYMRMAGHDVLM
FT                   VSGTDEHGTPILVQAEAAGKTPREFVDENNRAICEDLTALGLSYDLFTRTTTVNHHTVV
FT                   REMFTAVHRNGYFVEQTQLGAISPSTGRTLPDRYIEGTCPICGDDSARGDQCDNCGNQL
FT                   DPADLIDPRSKINGETPEFIETNHFLLDLPALADALGEWLAERDASGAWRPNVIAFSRN
FT                   ILEEIRPRAMTRDIDWGIKVPLPDWEDAPKRLYVWFDAVIGYLSASIEWARRSGDPEAW
FT                   RSWWNDPETLSAYFMGKDNIVFHSQIWPAELLAHNGQGSRGGEPGPFGELVLPTTVVSS
FT                   EFMTLEGKQFSTSRGHVIYVRDVMERQQPDAVRYYLSAVAPETSDADFSWEEFARRING
FT                   ELVAGWGNLVNRTASMIAKSFGEIPQPGELQEVDRALLEAVRGGYATVGGLLERFRNRQ
FT                   ALAEAMRLVSEANAYISTTEPFKLKGAENAERLATVLWTCAQAVTELNTLLSPFLPHTA
FT                   NEVEKALGGDAVIAPLPRVEEVTDLDDPSVSYPVITGDYTVGVRWEPRDVTVGAPVAKP
FT                   TPIFRKLDDEAVARERELTTASGE"
FT   gene            320565..321428
FT                   /locus_tag="Ksed_03330"
FT   CDS_pept        320565..321428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03330"
FT                   /product="hydrolase, TatD family"
FT                   /note="PFAM: TatD related DNase; TIGRFAM: hydrolase, TatD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05410"
FT                   /db_xref="GOA:C7NK23"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK23"
FT                   /protein_id="ACV05410.1"
FT                   /translation="MSPHSSPRRAERPPAPEPLPVPVVDNHTHIDIERDGVAMGADDGV
FT                   HGVIAQARVVGVDRLVQIGCDLESARHTASVVDRHPEVLGGVALHPNEVPVLAAAGELD
FT                   AALEEIDRLARGERIRVVGETGLDYFRTPPEGRGAQVEAFRWHIAKAKELGRALQIHDR
FT                   DAHEDVLRVLAEEGAPEKTVMHCFSGDIGMARECVERGYLLSFAGTVTFKNARDLRDAL
FT                   SVVPLDQVLVETDAPYLTPHPHRGAPNAPYLVPLTVRVMATTLNVSVPELCAAISENSE
FT                   RVYGPW"
FT   gene            321472..321747
FT                   /locus_tag="Ksed_03340"
FT   CDS_pept        321472..321747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05411"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK24"
FT                   /protein_id="ACV05411.1"
FT                   /translation="MPDRTPDGRWIVVDGRRWRASDPAIPEAFRAELVQELMRARREVR
FT                   SRGDSARPAVHDAKVALGERGDPWWEAPTDEGLGPIRLAAGEDLPR"
FT   gene            321744..322319
FT                   /locus_tag="Ksed_03350"
FT   CDS_pept        321744..322319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05412"
FT                   /db_xref="GOA:C7NK25"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK25"
FT                   /protein_id="ACV05412.1"
FT                   /translation="MRPGDLLRAVAFLSVPAAWAHAGFASGACLFLVCGAVMGIRWLGY
FT                   RTDADAAACLVLLTVAWAAVTGLYEVVPGLDLLAHVAGTAVATAAVWQALRRLDPAAGS
FT                   PNPWVQAVLLVGLAAVLSVLWEVGEWLGHHLVDQTIRVGYDDTVTDLLAGLLGGGIVAL
FT                   RPDPASSRAPNPAPLPSAPSTPSPQEAR"
FT   gene            322316..324058
FT                   /locus_tag="Ksed_03360"
FT   CDS_pept        322316..324058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03360"
FT                   /product="cell wall-associated hydrolase,
FT                   invasion-associated protein"
FT                   /note="PFAM: NlpC/P60 family; Glycosyl transferase family
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05413"
FT                   /db_xref="GOA:C7NK26"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK26"
FT                   /protein_id="ACV05413.1"
FT                   /translation="MSTVSVIIPVLDDAPALDVCLGHLMRQRVLPDEVVVVDNGEQPTA
FT                   GLVRRSDLPFPVRVVHEPRRGTASATAAGFDAAHGDLLARCDADCRPDDGWVGALAAAF
FT                   AADRGLDAVTGHIAFHDLSGWSGTLGTLFYRTGMGLGMHLALARPPLWGSNLALRATAW
FT                   QRCRDAVHPDDPLVHDDLDLSFALGPLARVRRVRDLRVTAEARIFDSPRHLVTRVRRAL
FT                   RTCRLGWRRQPPGHRWVNRLTGGRYLWAKEPREELRAGDVAFVDVTVATLWVEPGTDRP
FT                   LDAPAVGAPVDPEAWNRVLDDDAREWMVGQVETQAQLGARVTVTERRGDWAHVVVHDQP
FT                   TPRDPRGYPGWVPVAQVRTNPTFDRQLAERELAVVTADSTLLSATSSGGRPRLAVGVTT
FT                   TLPVLSARAGAVELALPDGSAAWADAGDVARVPRPSHAPAPAADPAPTGEQLVATAERF
FT                   LGLRYLWAGVSPWGLDCSGFALLAHRIHGIEIPRDADAQAEAGEAVEAEDLRPGDLLFF
FT                   AEPGGVGFVHHVGMYHGQGRMIHAPNPRSAVCVVDWRAWDANREFSGARRYLSERSAGA
FT                   PAPG"
FT   gene            complement(324021..324509)
FT                   /locus_tag="Ksed_03370"
FT   CDS_pept        complement(324021..324509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05414"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK27"
FT                   /protein_id="ACV05414.1"
FT                   /translation="MMSRSSNEATNLVLGHVGLAAVARTLADAGTARTRVERLIGDPVG
FT                   VARGLALRTSPADLVRLLHLTTAPGLLTAQHRLAAELMTRPTVAPIGSAVAPGVPWLSK
FT                   SGEVEGYRHDVARIGAPGTDGPEGVRYLAVCTQGLSQAAGDAVIIALTRALVPQHCAR"
FT   gene            complement(324506..324847)
FT                   /locus_tag="Ksed_03380"
FT   CDS_pept        complement(324506..324847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05415"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK28"
FT                   /protein_id="ACV05415.1"
FT                   /translation="MAMTSTDRPDRPTRPAPPEDPAVGWTLAAEDGTVLDDHHGTREFY
FT                   AASTLKVGVLLTALRAVEAGTVDLADPLVSTRTFTGADGEPFTLSGDHVDPSSPPRAAR
FT                   SPSTRPWPR"
FT   gene            324870..325778
FT                   /locus_tag="Ksed_03390"
FT   CDS_pept        324870..325778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03390"
FT                   /product="dimethyladenosine transferase"
FT                   /note="PFAM: Ribosomal RNA adenine dimethylase; TIGRFAM:
FT                   dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05416"
FT                   /db_xref="GOA:C7NK29"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK29"
FT                   /protein_id="ACV05416.1"
FT                   /translation="MAPVTPDQDPAPRATEAPDAGLLGPARVRELADRLGVSPTKQWGQ
FT                   NFVIDKGTVRRIVRASGVGPGDHVVEVGPGLGSLTLALLPVVDSLTAVEVDPRLAEALP
FT                   DTVAALAPERATDLRVVHADALRVTELPGPAPTALVANLPYNIAVPVVLTFLERFPSLR
FT                   TVLVMVQLEVAERMSAAPGSKIYGAPSPKCAWYGPTRLAGRIGRNVFWPAPNVDSGLVR
FT                   IDVQPREDAGVSRQEVFACIDAAFAQRRKTLRAALAEWAGSAQQAEEALVAAGIDPRTR
FT                   GEVLDVHGFIALAAARNRLRE"
FT   gene            325803..326780
FT                   /locus_tag="Ksed_03400"
FT   CDS_pept        325803..326780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03400"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /note="PFAM: GHMP kinases C terminal; GHMP kinases N
FT                   terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05417"
FT                   /db_xref="GOA:C7NK30"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK30"
FT                   /protein_id="ACV05417.1"
FT                   /translation="MTAQPAPRIATVRVPAKVNLALRVGAPDPGSGYHPLATVFHAVDL
FT                   TDEVTVRRARRFSLEVTGRFTEGVPADETNLAWQAVVLLRHHYRQTCGVRTPLPVAITL
FT                   EKNIPVAGGMAGGSADAAGALLAANEVWGNELTIEDLRDIAAELGADVPFALLGGNALG
FT                   LGRGDELSTVLARGQLHWVFCVSPEGLSTPEVYRAFDRLAGWDQGPTMDTIEAWETPPE
FT                   PPEDLLQALRSGDAVEVGQHLENDLQEAAVELQPGLRETLAAGADVGALTGIVSGSGPT
FT                   IALLASSHDHALDISVGMAALRPEVEVFVASGPAPGARVVSTRS"
FT   gene            326807..328693
FT                   /locus_tag="Ksed_03410"
FT   CDS_pept        326807..328693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03410"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domain"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05418"
FT                   /db_xref="GOA:C7NK31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK31"
FT                   /protein_id="ACV05418.1"
FT                   /translation="MNPPSPRANLVNAESLHLVVGTQVLLDDVSLGLNDGDRIGVVGRN
FT                   GGGKSSLLRALSGELAVDSGRVVRSRGATIGRLRQQDDFAAGATVRDVVLPGLEEHEWA
FT                   ADARIRGILNGLLGGLDAEGLGGLGAPVAGMSGGERRRMALAALLVADPDVLLLDEPTN
FT                   HLDVEGVAWLAEHLQGRRRPGSALVVVTHDRWFLDAVVEQTWEVVEGQVHQYEGGYAAF
FT                   VQARAERARVERATEERRQNILRKELAWLRRGAPARTSKPKFRIEAADALIAGEPEPRD
FT                   DVQLARFATTRLGKDVYDLVNATVAVGEGEERTTLLDGVTWRLGPGDRYGIVGVNGAGK
FT                   STLLRVLLEQVPLAGGKLKVGRTVQPAILSQDLRELDEVAGMTVIDAITNVRSFTVLDG
FT                   KEVSASSLAKRLGFSGPRQQSRVSDLSGGERRRLQFVRLLLDEPNVLMLDEPTNDLDIE
FT                   TLTSMEDVLDGWAGTLLVVSHDRYLLERMANRQVALLGDGRIRDLPGGVEQYLELRRER
FT                   RAAGVGTGRGGRDLAGAGAGAAGGSGDAGGGTGAPASGLSPAQERQLTKAMARAEKQIE
FT                   KLTQQAERVHAQMAEAATDPDRLAELTAQERDLRAQHDAAEAEWLEAAEQLE"
FT   gene            328893..330245
FT                   /locus_tag="Ksed_03420"
FT   CDS_pept        328893..330245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03420"
FT                   /product="NADPH-dependent glutamate synthase beta
FT                   chain-like oxidoreductase"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05419"
FT                   /db_xref="GOA:C7NK32"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK32"
FT                   /protein_id="ACV05419.1"
FT                   /translation="MRVAVIGAGPAGIYAADILTKELEQASVDVYDRLPAPYGLVRYGV
FT                   APDHPRIKEIVKALRRVLAGDQIRFIGNVDFGTDVTFEQLRENYDAVIFATGAMGDRPL
FT                   DIPGIEKEGSFGAADFVSWYDGHPDVPREWPLEAESVAVIGAGNVALDVARMLAKPADE
FT                   QLTTEIPDNVYQGLKANRAKDVHVFARRGPAHLKFSPMEFRELSHSPSVDVVMTEEGFE
FT                   IDDAGQEAIQAAKSTKLVVDTLLKYLEKEPTGAPHRIHLHLMQAPVEVLGDGSVTGLRT
FT                   EVMQYNGDGSVSGTGEFRDWDVQAVYRAVGYRSTPLQGLPFDHGSGTVPHEAGRVLEGG
FT                   APKEAAYVTGWIKRGPVGLIGHTKSDAKETIESLLADLESLPAPVGSPDAMLDQLRERG
FT                   VDFTLFDEWERLDAHEMALGAASERERIKVVSREDMIAAGREAAEEFRASA"
FT   gene            330477..331421
FT                   /locus_tag="Ksed_03430"
FT   CDS_pept        330477..331421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03430"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Polyphosphate kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05420"
FT                   /db_xref="GOA:C7NK33"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK33"
FT                   /protein_id="ACV05420.1"
FT                   /translation="MATSNPTEQTPGMTPYQPDPEIAKELEALHARLAERGTPVDGNAW
FT                   RHGYPYDTKMKRGEYEATKHDLQIELLKMQHHIKRNGDKIAILFEGRDAAGKGGSINRF
FT                   TEHLNPRGARVVALEKPTEREATQWYFQRYVPHLPSGGEIVFFDRSWYNRAGVERVMGY
FT                   CTPAQYQEFMRSAPEFERMLVNSGTTLFKFWFSVGRAEQAARFTKRHTDPVRHWKLSPT
FT                   DVASLDKWDAYTEAKEAMFFYTNTGDAPWTVIRSNDKKRARLEAMRVVLSQVDYPMKDE
FT                   SVVGTPDPNIVLSAKDAVDDGESSPSRDFPKVR"
FT   gene            complement(331543..332052)
FT                   /locus_tag="Ksed_03440"
FT   CDS_pept        complement(331543..332052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03440"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05421"
FT                   /db_xref="GOA:C7NK34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK34"
FT                   /protein_id="ACV05421.1"
FT                   /translation="MDTSGRPQQDEVDLVMAAWHRERPDLDLQPLAVLSRISRMARLLD
FT                   LARREAFGAGSLDPWEFDVLSALRRAGAPHELSPGALVAQTLVTSGTMTNRIDRLVDRG
FT                   HVERLPSRTDRRGVIVRLTESGRDAVDAAMEQLLTHERELLAGVGEAEQAEVADALRRV
FT                   LSRLEH"
FT   gene            332147..332518
FT                   /locus_tag="Ksed_03450"
FT   CDS_pept        332147..332518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03450"
FT                   /product="ketosteroid isomerase-like protein"
FT                   /note="PFAM: Nuclear transport factor 2 (NTF2) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05422"
FT                   /db_xref="GOA:C7NK35"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK35"
FT                   /protein_id="ACV05422.1"
FT                   /translation="MTDRSSAEAVVRAYYDAVDADDVETLIGLFAADATYERPGYEPFV
FT                   GHEALRAFYTGDRVIASGKHTLDAVVVDATGEQVAVHGRFEGTLKDGSAAAVRFADFYV
FT                   LDEAGLFARRTTFFHAPAV"
FT   gene            332529..332723
FT                   /locus_tag="Ksed_03460"
FT   CDS_pept        332529..332723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05423"
FT                   /db_xref="GOA:C7NK36"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK36"
FT                   /protein_id="ACV05423.1"
FT                   /translation="MNRLFDNPTAVIMAGGSFLLLLVAVTVLVSLMFRSSRRAAENERA
FT                   RAERHDLGLDHGEDQPSPR"
FT   gene            332765..332846
FT                   /locus_tag="Ksed_03470"
FT   tRNA            332765..332846
FT                   /locus_tag="Ksed_03470"
FT                   /product="tRNA-Gln"
FT   gene            332955..334427
FT                   /locus_tag="Ksed_03480"
FT   CDS_pept        332955..334427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03480"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase
FT                   /glucosamine-1-phosphate N-acetyltransferase"
FT                   /note="PFAM: Uncharacterized protein family UPF0007;
FT                   Bacterial transferase hexapeptide (three repeats); TIGRFAM:
FT                   UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05424"
FT                   /db_xref="GOA:C7NK37"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK37"
FT                   /protein_id="ACV05424.1"
FT                   /translation="MSTAQPAAVIVLAAGEGTRMKSTLPKVLHPIGGRTLLGHALHAAR
FT                   QAGPQHLSVVVRHERERVAAHVAEVDPGALIVDQDEVKGTGRAAEAGLSVLPADLTGTV
FT                   IITMGDVPLLTAQTLTDLTAAHEAAGAAVTVITAELDDPTGYGRIVRDADGSVLKVMEH
FT                   KDALAAREAGGEDAHVVDIREINSGIWAFDAAVLREFLPQLGTNNTQGEKYLTDVLGLS
FT                   RGAGGSVAAHKITDTLQIEGVNNRAQLSELGAELNRRLVRRWQMEGVTVVDPATTWIDV
FT                   DVTLGRDVVIRPNTQLLGACTIGDDVVLGPDTTLTDVEVGRGASVVRTHGELSVIGEGA
FT                   SVGPFAYLRPNTELGRDAKIGTFVETKNSSIGTGTKVPHLTYVGDAEIGDHSNIGASSV
FT                   FVNYDGVTKSRTRIGSHCRTGSDTMFIAPVTVGDGAYTGAGTVVRKDVPPGALAITVAP
FT                   QKNIEGWVQEKRPGTAAAQAADEVASERSSEG"
FT   gene            334467..335471
FT                   /locus_tag="Ksed_03490"
FT   CDS_pept        334467..335471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03490"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05425"
FT                   /db_xref="GOA:C7NK38"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK38"
FT                   /protein_id="ACV05425.1"
FT                   /translation="MSDHEQDVPLAIQRTTEKNLMVFSGRAHPSLATAIADGLGSQVVP
FT                   TEAYEFANGELYVRYSESVRGCDAFVIQAHTAPINTWLMEHLIMVDALKRASAKRITVV
FT                   LPFYGYARQDKKHRGREPISARLMADLFKTAGADRLMAVDLHTAQIQGFFDGPVDHLMA
FT                   MPILADYVRDKYGDEDLVVVSPDAGRIKVAEQWAERLGNRPLAFIHKTRDITRPNESVA
FT                   NRVIGEVEGRMCVLVDDMIDSGGTICKAAEAIMAQGAKGVIIAATHGILSGPASERLRD
FT                   SVAREVILTDTLPIAEDRQFETLTVLPIAPLLSRAIREVFEDGSVTSMFDGRA"
FT   gene            335720..336400
FT                   /locus_tag="Ksed_03500"
FT   CDS_pept        335720..336400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03500"
FT                   /product="LSU ribosomal protein L25P"
FT                   /note="PFAM: Ribosomal L25p family; TIGRFAM: ribosomal
FT                   protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05426"
FT                   /db_xref="GOA:C7NK39"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK39"
FT                   /protein_id="ACV05426.1"
FT                   /translation="MANKTIKLTCTERTTFGKGAARQARREGGIPAVVYGHGEGPFHVI
FT                   LPGHEAFIALRHTNALMTLTWGSGEDRLVLAKDVQRDPIKPIIEHVDFVIVDRNEKVDV
FT                   DIAIHLDGEAGPETVVSVPTSTVTVKAPVLDIPESITVSVEGAEAGTLIHAGDLELPEG
FT                   VELVTDAEETIINVSEAISEEALEAELAEAEAEAGIEQDESDEEAAEAAEGGDDAEGED
FT                   EKSE"
FT   gene            336558..337166
FT                   /locus_tag="Ksed_03510"
FT   CDS_pept        336558..337166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03510"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="PFAM: Peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05427"
FT                   /db_xref="GOA:C7NK40"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK40"
FT                   /protein_id="ACV05427.1"
FT                   /translation="MEIDDDPWLVAGLGNPGPRYAGNRHNVGAMVVAEMAAGAGVKLSA
FT                   ARQARAVSAETRLGTLPGGRPGRRVVLATPLDFMNLSGGPVSGLMKYHGIDVDHLVVLH
FT                   DELDIDFGAVRLKKGGGEGGHNGLRSITQSLGTKDYHRIRLGIGRPPGRMDVADFVLRD
FT                   FSPTERAELPFLLGDGADAVERLLHHGLEAAQQFHHSPR"
FT   gene            complement(337175..338101)
FT                   /locus_tag="Ksed_03520"
FT   CDS_pept        complement(337175..338101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03520"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="PFAM: Phosphoglycerate mutase family; NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05428"
FT                   /db_xref="GOA:C7NK41"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK41"
FT                   /protein_id="ACV05428.1"
FT                   /translation="MSTEHVVEAAGAVPWRRRKGRLQVALVHRAHYDDWSWPKGKVDPG
FT                   ELLPQTAAREVAEEASLAVRLGMPLPTSEYRMPNGNLKRVHYWAAHVVESLGALEHEVD
FT                   EVAWLSPPQARKRLSYPHDREQLDRLVELDDQGMLDTRVLVVLRHALAVRREDWDGVDA
FT                   ERPLVPAGFDRAKALAPTLQAFGVDRIVSSPAARCSDSVAPFAAVAALKPRLKAGLSEE
FT                   GHRAAPHKAAKHVAKALGTGRSTVLCSHGPVLPSMLEAVAERTLPGSRAERTVLQLARE
FT                   GMTKGGFVVLHLTGQGESSKVLASETW"
FT   gene            complement(338098..340410)
FT                   /locus_tag="Ksed_03530"
FT   CDS_pept        complement(338098..340410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03530"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05429"
FT                   /db_xref="GOA:C7NK42"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK42"
FT                   /protein_id="ACV05429.1"
FT                   /translation="MADSSATTTAKHGDPSPTSDGTGNGTPRPAAHIIQPPQPRRPRDA
FT                   GGRFVSSADPAPDGELPADRFLERETSWLQFNERVLELAADPAVPLLERARFLAIFASN
FT                   LDEFFMVRVAGLKRRIATGLAVRSASGQEPQEVLSMVGRSAHALMTEQSRLYSDEIMPA
FT                   LAAEGIHVVRWKDLQDAERDAFEEFFVRDVYPVLTPLAVDPAHPFPYISGLSLNLAVTL
FT                   ADPRTFQEHFARVKVPPALPRLLRVSHVLGTDESDEQIQESEHGIRFLPIEDVIAAHLS
FT                   LLFPGMEIKQTYTFRVTRNEDLEVEEDEAENLLTALERELTRRRFGPAVRLEVEEDMTP
FT                   EVRAILQRELDVTTHEVYVLPAPLDLRSMNTVADLRISDLRWPAFRTHTHPALAPVERS
FT                   AEADVLGTMRERDVLLHHPYDSFSTSVQRFLEQAAADPHVLAIKQTLYRTSGDSPIIRA
FT                   LIEAAESGKQVLAVVEIKARFDEENNITWARQLERAGVHVVYGQVGLKTHAKLCLVVRQ
FT                   EADGLQRYVHIGTGNYNPKTARLYEDLGLLSTDPQVTEDVTRLFNQLSGMAPRSTFQRL
FT                   LVAPRSVRSGLVQLMDEQAARARKGHPARVRVKANSIVDEAFIDACYRASQAGVQVDVW
FT                   VRGICALRPGVPGLSENIRVRSVLGRFLEHSRVVVAGIPGDPANPLRALIGSADMMHRN
FT                   LDRRVEAMVELRDPAHVCHLDELFELAFSPDVATWHLDAEGVWTRHHLDEAGEPLKDIQ
FT                   FEIEKDYAQRRRKGRRR"
FT   gene            complement(340513..341403)
FT                   /locus_tag="Ksed_03540"
FT   CDS_pept        complement(340513..341403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03540"
FT                   /product="mycothiol biosynthesis acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family; TIGRFAM:
FT                   mycothiol biosynthesis acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05430"
FT                   /db_xref="GOA:C7NK43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7NK43"
FT                   /protein_id="ACV05430.1"
FT                   /translation="MSPDLTHRSPEELTPEDSQAIGDLARRAARADGVDPLNEESLLAL
FT                   RHRTPGRVHVLAHDQDRLVGYGTLAHGSAEVVTDPDARKAGLGGRLLDALLEHDPELLL
FT                   WAHGDMDGGRRLAASRGMVPRRPLWRMERPVAGEFSELPPVELPEGISVRPFVAGQDDE
FT                   AWLRVNSRAFADHAEQGRMTAEDLTARTQEDWFDASGFLLLVDDTRDGEVVGFHWTKVD
FT                   QLPVGEVYVVGVDPERQGEGLGRVATLVGLHHLADRGVETVELYVDGDNRAAVTTYGRL
FT                   GFERAAVDVQYGPPV"
FT   gene            complement(341429..342214)
FT                   /locus_tag="Ksed_03550"
FT   CDS_pept        complement(341429..342214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03550"
FT                   /product="response regulator with CheY-like receiver domain
FT                   and winged-helix DNA-binding domain"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05431"
FT                   /db_xref="GOA:C7NK44"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK44"
FT                   /protein_id="ACV05431.1"
FT                   /translation="MPRVVLLHRGPAPALDSPALEAMALLDWTVEPMGVGPGPAQPPRS
FT                   PGEPPPVLVVDARDQLAAHRDLARELASTHPDCARLVVLRPEDLAAWTSRWEADDLLLS
FT                   TAGPGEVTARVRVAGQRAAARRGAAAGQRAGEGLTSGSGEGRSDAGAAGPGAAPPGEGD
FT                   SIDLGGLVIHRDSWSARLRGRTLDLTFREFELLAHLATHPGRVFTREELLEDLWEGTRL
FT                   SGTRTVDVHVRRLRSKLGPEHEGLIVTVRNVGYRMEARA"
FT   gene            342281..343099
FT                   /locus_tag="Ksed_03560"
FT   CDS_pept        342281..343099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05432"
FT                   /db_xref="GOA:C7NK45"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK45"
FT                   /protein_id="ACV05432.1"
FT                   /translation="MPSPGPSSADPRRGSAAPSSFRGQRAAARSAALCAIVLALAGWGA
FT                   GPLAAAAVATVAGAIVAVGWGRVLDLPSARGTRVVLGAVVALAVLAAVIGHLDDASFAL
FT                   SVWWALPVAGGVWASLAHQVWRSDGRPRVVDLLTAEVFAVLVIVAGFLWSWATPAAALA
FT                   AAAGLAATALVDSVAPRQRFVAWAVGVVVGLAVAATWWAVRDDVSTARSLTLGSVAVLA
FT                   PTISQATRLVLLRLPAVRSGVTGGVVVGVVSASLAGIVTGLFAMVSPLIG"
FT   gene            343134..343643
FT                   /locus_tag="Ksed_03570"
FT   CDS_pept        343134..343643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03570"
FT                   /product="protein of unknown function (DUF1794)"
FT                   /note="PFAM: Domain of unknown function (DUF1794)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05433"
FT                   /db_xref="GOA:C7NK46"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK46"
FT                   /protein_id="ACV05433.1"
FT                   /translation="MVFHIDADMSPRLAPLAWMLGRWEGAGVVGYPDRESGHFGQELIA
FT                   THDGREFITWTSRTWMLDEDGRPGEPYAVESGFWRPEGEDGEFVLLLAHPTGYVEQYFG
FT                   ARHPERPSIEMATDGILRTAGAEEYTAAKRLYGLVDGDLMWVMDMAYKGHPMTSHMSAQ
FT                   LKRVEG"
FT   gene            complement(343716..345062)
FT                   /locus_tag="Ksed_03580"
FT   CDS_pept        complement(343716..345062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03580"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain protein"
FT                   /note="PFAM: Cell envelope-related transcriptional
FT                   attenuator domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05434"
FT                   /db_xref="GOA:C7NK47"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK47"
FT                   /protein_id="ACV05434.1"
FT                   /translation="MADMSERPHDPHLDPTGPGGGDGPRATGSSPAGTTPRRRGLRGPW
FT                   RWGCGLLAVLVAIPLVIAAVWFFNLNSTLKDNIVHEALLPDEVDDDHTPDVPRDVDTDG
FT                   DGKGDINIDTDGDGKPDLNLDTDRDGKADYRVDSDGDGTVDATRGSKDKGGDDEDGDGR
FT                   ADGDTNLDGVVDEKDGDGEDSKAVPSPDEDGSADDPAPGADGARNILLIGEDGVGAPYR
FT                   SDVMILAHLNASGDEVTLVHFPRDLYVPIPGYGHNKLNAAYAIGGPQLLTRTFQGMLDV
FT                   KIDDVAITDFENFKAVTNELGGVTVDNPQASPEFPEGAVRLETGEEALRFVRERKTLGL
FT                   GDIGRGERQMSFLQGLVDKAMSPSVASNPNKLSGMVDAGTQGVRVSGGLSVGEIRSLAF
FT                   DFVRGGKGGLNYRTAPWLNVGWSPGGASIVVVDWPGMRDLGETIRNDAF"
FT   gene            345137..346297
FT                   /locus_tag="Ksed_03590"
FT   CDS_pept        345137..346297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03590"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="PFAM: Aminomethyltransferase folate-binding domain;
FT                   TIGRFAM: folate-binding protein YgfZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05435"
FT                   /db_xref="GOA:C7NK48"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK48"
FT                   /protein_id="ACV05435.1"
FT                   /translation="MVRWGWNAGGATPCSPGVTDAPTGTPQDHDAPQEAAASPLSGRPG
FT                   AVRMHSRIALHHGDPLREQRLLEEGLAVVDLGDRGVVTVSGPDRLSWLHSLLTQQVGDL
FT                   APGQSAEAMVLTPQGRIEHVLHLVDDGATTWITTDPGHAAPLSSFLESMRFMLRVEVAD
FT                   RSADLRVVGEPHSAPGLPGEPPVWVDPWPGPVGATAVRTADDLEVHPGEGWAWREVVLP
FT                   AEAVEEWVADRPLAGWWALEALRIAAWRPSAQEVDDRSIPHELDWLRTAVHLQKGCYRG
FT                   QETVARVQNLGQPPRRLVFLHLDGSGHELPAVGSEVHSGAVAGDPASGKVVGRLTSVGR
FT                   HHELGPIGLAVVKRSAPAEETLTIGATAAAQEVVVAAGGRPARRRV"
FT   gene            346427..347569
FT                   /locus_tag="Ksed_03600"
FT   CDS_pept        346427..347569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03600"
FT                   /product="conserved domain protein, TIGR02271+C111"
FT                   /note="PFAM: Domain of unknown function (DUF2382);
FT                   PRC-barrel domain; TIGRFAM: conserved domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05436"
FT                   /db_xref="GOA:C7NK49"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="InterPro:IPR019060"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK49"
FT                   /protein_id="ACV05436.1"
FT                   /translation="MISKEQLQDLRGGDLFGTDNEKIGSISDIYLDDQTGQPAWATVNV
FT                   GMFSGDSFVPLDDATIADGGLAVPYTKDKVKDAPQIEAGQHLDAEHEVELYRYYGVQFD
FT                   GDNAGTDTTDTLDRQDGRVDGAPVEGQDRGEFGRWDSGDAAAAGAGTAGVAGAAGYAGH
FT                   DTDTDARADYDRQYGDDTALDVERDRAAAADTDQRAGFFGGDRDADATTAVPTAAAGTD
FT                   YDRDRTADYDRDRAQAVDGERTSVTRHEERLNVGKERRETGAVRLKKYVVEEDETISVP
FT                   LERESIEVERRDITDGQAIGDWDFGDDELEITLIEEHPVISKEVYAVEEIGLNKKVVTE
FT                   NRQVTERVRRERVDIEGLDDNAQTGRDNGGLFGGRQNDRI"
FT   gene            347686..348696
FT                   /locus_tag="Ksed_03610"
FT   CDS_pept        347686..348696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03610"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05437"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK50"
FT                   /protein_id="ACV05437.1"
FT                   /translation="MTSPTPAAGSTPLAQAPVIAHVVRGELVESVHHGLGVLTSAAGEV
FT                   EVAVGDVRAAMFPRSSNKPMQAVGMLRSGAELTGRHLALVCASHSGEPFHLDAVQENLQ
FT                   AAGLTTAYLQNTPSFPIDEQAKAAYVAAGNGASSLAQNCSGKHSGMLAACVAAGWDTQT
FT                   YLSPEHPLQQAIREAVEDLSGDTVEHVAVDGCGAPVMSISLAGLARSFGRIAAAGEGPE
FT                   KTVGDAMREHPQYVGGTRREVTQLMRAVPGSIAKDGAEAVLAMGLPDGRGLAVKVTDGN
FT                   ERACYAVAVELLRTAGIENEALDRLAEVRVMGHGRQVGSVVVTDAVGAGAQGEGA"
FT   gene            348696..349064
FT                   /locus_tag="Ksed_03620"
FT   CDS_pept        348696..349064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03620"
FT                   /product="Protein of unknown function (DUF2516)"
FT                   /note="PFAM: Protein of unknown function (DUF2516)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05438"
FT                   /db_xref="GOA:C7NK51"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK51"
FT                   /protein_id="ACV05438.1"
FT                   /translation="MGSIAYTIMSIETWVLAALAVAGLVVEAKALLHVLTTRVDAFPAA
FT                   DARTKPFWAIVLALCTLLGTWYVWIMGWALVSGAIASFPPLTIIGVIAVTVAGVYLAGT
FT                   RPRIEGVLANAQSPGKLW"
FT   gene            349061..349915
FT                   /locus_tag="Ksed_03630"
FT   CDS_pept        349061..349915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03630"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05439"
FT                   /db_xref="GOA:C7NK52"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK52"
FT                   /protein_id="ACV05439.1"
FT                   /translation="MTAGQAPRTHLLDGPDGPLEVLQTGSGEPTTVFGHGLAGTIDTTR
FT                   PFATGVRGSKVFLHFRGHGRSVAPVPAAHTSTPADGAPAAHATGWGYGSLAADLRRVAD
FT                   ATGATRALGVSMGAGALTRILSEEPDRFERVVLVIPAVIDAVREDRALDRMAAMAQLVE
FT                   SGDVEALAASLLAEQPPQVQGDRHVQVWCAQQARQLVGTPVGTALRALPHEYPIEDRSV
FT                   LAAVEAPVLLIGQVEDDAHPAHVAAELGEALGNATVEILPPGGLMWSHRTRVRSLVADF
FT                   LNA"
FT   gene            complement(349982..350758)
FT                   /locus_tag="Ksed_03640"
FT   CDS_pept        complement(349982..350758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05440"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK53"
FT                   /protein_id="ACV05440.1"
FT                   /translation="MRPVGDITRGTTAANRLRRVDRWMVRRLGATLRATPEPLVVDLGF
FT                   GALPLTTAETFHRVRRVAPTARVVGLEIDAARVAAAAPWARAGLEFRRGGFELAGLTGR
FT                   ATAIRAFNVLRQYPEEAVPGAWELLRAGLAPGGLVLEGTSNEVGRRAAWVTLDRSGPLT
FT                   LTFAWAMAEVDPPSAIAERLPKVLIHHNVPGQPVHTLLEDLDAAWHTHAHLATWGRRQR
FT                   FVAAVHTLAARWPVVSARTEARRGELTVPWEAVAPL"
FT   gene            350809..352050
FT                   /locus_tag="Ksed_03650"
FT   CDS_pept        350809..352050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03650"
FT                   /product="glycosyltransferase"
FT                   /note="PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05441"
FT                   /db_xref="GOA:C7NK54"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK54"
FT                   /protein_id="ACV05441.1"
FT                   /translation="MSYTCASAGSVVVLSMHTSPLSDPGEGDAGGMNVYVRQLSRAMVG
FT                   EGAAVHVVTRSDTGEAWEARDEGVAVAGLPVGPPDAAKEDLPALVPDFARAVAQHLAAR
FT                   ELAPDVVHSHYWLSGMVALALPGLTATWAHTMHTLGATKNAELAGTDDREPAARLEGER
FT                   RILESVDLAVASTCPECGQLRAQGAPAERCVVIPPGVDARTFHPLEPAARDAVRHAVRQ
FT                   ELGLPADALLLVQAGRWQPAKGQVVLLEAVEHLWEAGIRAHAVFVGGPSGAGDAGELPR
FT                   RIEQSPARDGLLPRGAVPPAELARLLHAADLVVVPSRTESFGLVAVEAMACGTPVVAAR
FT                   VGGLPDAVGDAAALVDGHDPRDWAEALAGLLADPAARAALGEAGRRRAATMSWRDTARA
FT                   HLEAYRTARRQEAP"
FT   gene            352047..352652
FT                   /locus_tag="Ksed_03660"
FT   CDS_pept        352047..352652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03660"
FT                   /product="Protein of unknown function (DUF2596)"
FT                   /note="PFAM: Protein of unknown function (DUF2596)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05442"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK55"
FT                   /protein_id="ACV05442.1"
FT                   /translation="MTAAENAAARGDDDGPGGRPAGSPGQQAALDVVDRWVALHADPAS
FT                   PEHVEGVEAERLADDDGRPTGAWVITLPGERKLKTVVSVRVGEKSLGLIAFVVRNPDEN
FT                   HAAVYRMLLRRTLDLPGLAYAIDDSGDVYLTGRTPVRGVTDTWFDEAMGAVLQASDGIF
FT                   NEVLAKGFLTAMQTEWDWRTSRGESTRNLEAFRHLLAD"
FT   gene            352673..353428
FT                   /locus_tag="Ksed_03670"
FT   CDS_pept        352673..353428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03670"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="PFAM: Phosphoglycerate mutase family; TIGRFAM:
FT                   phosphoglycerate mutase, BPG-dependent, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05443"
FT                   /db_xref="GOA:C7NK56"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK56"
FT                   /protein_id="ACV05443.1"
FT                   /translation="MTNAAHTLVLLRHGQSLWNEKNLFTGWVDVDLTEKGRAEARRGGE
FT                   LLVAEGYLPDVLHTSRLRRAITTANLALDAADRHWIDVKRSWRLNERHYGALQGKDKAQ
FT                   VKDKYGEEQFMAWRRGYDTPPPPIEADDEYSQAGDPRYADLGAEVPATECLKDVVERLR
FT                   PYWAEEIVPDLQAGRTVLVTAHGNSLRALVKELDGISDADIAELNIPTGIPLVYELDGN
FT                   FRPLTPGGRYLDPEAAAGAIQEVANQGSK"
FT   gene            complement(353490..354170)
FT                   /locus_tag="Ksed_03680"
FT   CDS_pept        complement(353490..354170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03680"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="PFAM: PhoU domain; TIGRFAM: phosphate transport
FT                   system regulatory protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05444"
FT                   /db_xref="GOA:C7NK57"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK57"
FT                   /protein_id="ACV05444.1"
FT                   /translation="MRTNFTRALEAMSAQMVEMNRLVAGAVDGANRALGTADGSLAERV
FT                   ISGDDRIDAFYAEIEENAIELLARESPVARDLRLVVTSLQLSASLERTGDLARHVAELV
FT                   RMRYPELTVPAPARPTIAEMGRLAHSLVQEAGDALATHRADAADRLETLDDSLDALHLK
FT                   VFDIVREHITDTQEAVDLTLLSRYYERMGDHSVSVGRRVDYLVTGELDRPGDEAHVVTL
FT                   PRTS"
FT   gene            354322..355518
FT                   /locus_tag="Ksed_03690"
FT   CDS_pept        354322..355518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03690"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05445"
FT                   /db_xref="GOA:C7NK58"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK58"
FT                   /protein_id="ACV05445.1"
FT                   /translation="MDPLVWAAVGSFLVIGLLVGWWVGRKQPRERRGAQAAGGDSFPDG
FT                   VRQVLDSLTSTVIVLDAANRVVHSTHHAADQGYVRDGVVPHPAIRDLVEEMRSTREVQD
FT                   DEVEVTRSVLAGGRVSVGCRVFPLGQDRVVILLEDRSRARRVEQVRRDFVANVSHELKT
FT                   PVGGIALLAEAVQDARDEPEAVERFARRMVVEADRLSHLVQEIVEFSRLQAGETIEDPQ
FT                   PVNVVEVISAAVDHVRVHAEGRGVAVRQAGIAHGLPHQVFGDAELLTTAVRNLIVNAVN
FT                   YSDRGTKVIVAAQPGESEGTVRIVVTDQGIGIPTGDLERIFERFYRVDSARSRHTGGTG
FT                   LGLAIVKHIVANHGGAISVWSRPGTGSTFTIELPVVELTESPNGGPDGASGAPTASVR"
FT   gene            355548..356228
FT                   /locus_tag="Ksed_03700"
FT   CDS_pept        355548..356228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03700"
FT                   /product="response regulator with CheY-like receiver domain
FT                   and winged-helix DNA-binding domain"
FT                   /note="PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05446"
FT                   /db_xref="GOA:C7NK59"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK59"
FT                   /protein_id="ACV05446.1"
FT                   /translation="MTRILIVEDEASFSDPLSWLLEREGHEVVVREDGRSGLEEFTRNP
FT                   ADLVLLDVMLPGMSGVEVCRELRRESSVPIIMLTAKDSEVDKVVGLEIGADDYVTKPYS
FT                   ARELLARINAVLRRRIAPPAQEDHIVRVGDVELDADSHVVVVRGEPVSMPLKEFELLEM
FT                   LMRNHGRVLTRAQLIDRVWGADYVGDTKTLDVHIKRVRGKVEENPSSPRMITTIRGLGY
FT                   KFEG"
FT   gene            complement(356277..356813)
FT                   /locus_tag="Ksed_03710"
FT   CDS_pept        complement(356277..356813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05447"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK60"
FT                   /protein_id="ACV05447.1"
FT                   /translation="MITTARSAVPARTGRRLAALCLVGMIGLTGCQALSPLETTRDYAP
FT                   ANGELVRSGDVSVMDLHVLATEPQSEGRLLGTVVNSGTEPQEVMLAVEGSEVWASTVEP
FT                   SQRVNLAEEEITLAEAAAPGAFQLLTVSAAGQDTEQRVPVMLPTGQYEQYAPEGWEALE
FT                   RPTREDLESEGGGGH"
FT   gene            356902..357384
FT                   /locus_tag="Ksed_03720"
FT   CDS_pept        356902..357384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03720"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: CarD-like/TRCF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05448"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK61"
FT                   /protein_id="ACV05448.1"
FT                   /translation="MTFEVGETVVYPHHGAALIEEVKQRKVKGKEMTYLKLKVAQGDLT
FT                   IEVPAENCDLVGVRDVVDAEGLEKVFGVLRAENCEEPTNWSRRYKANLEKLASGDVIKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLAKARQILVSELALAEKTDEERAEATLDEVLAS"
FT   gene            357407..358672
FT                   /locus_tag="Ksed_03730"
FT   CDS_pept        357407..358672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03730"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase/2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="PFAM: YgbB family; Uncharacterized protein family
FT                   UPF0007; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05449"
FT                   /db_xref="GOA:C7NK62"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK62"
FT                   /protein_id="ACV05449.1"
FT                   /translation="MTTHDPDAVPGVGVVVVAAGSGTRLGAGLPKAFVEVDGATLLEHA
FT                   LDGLLASERVGEVVVVAPAGWEDLAAELLGRAASCPCPHRTAVVTGGAERSDSVAAGLA
FT                   ALSDAVDLVLVHDAARCFTPPEVFGRVVDAVRAGAAGAVPALPVVDTIKVVDDEDRVTG
FT                   TPARASLRAVQTPQGFRREVLARAHAAAVGAGAAATDDALLVEQLGEPVVAVAGDPRSA
FT                   KITTPADLADWQRRDAVQEPTPPSHAAAPGARTDGPATALPRTGIGTDVHAWAPEGDDR
FT                   PLWLGCVEFPGERGVAGHSDGDVAAHAACNALLSAAGLGDLGSVFGTGRPEMAGASGAQ
FT                   MLAHVAGMLEGAGFAIGNVAVQVVAPRPKIGPRRAEMEAAMSAALGGAVVSVSAATTDG
FT                   LGFIGRGEGLVGLATALVAPRG"
FT   gene            358758..359849
FT                   /locus_tag="Ksed_03740"
FT   CDS_pept        358758..359849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03740"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /EC_number="1.1.1.306"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase; TIGRFAM: mycothiol-dependent
FT                   formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05450"
FT                   /db_xref="GOA:C7NK63"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK63"
FT                   /protein_id="ACV05450.1"
FT                   /translation="MPSTVKGVIARSKNAPVEVVDIVVPDPGPGEAVVKISTCGVCHTD
FT                   LHYKQGGISDDYPFLLGHEANGVVEAVGEGVADLEPGDTVVLNWRAVCGTCRACARGEA
FT                   WYCFNTHNASQKMTLTDGTELEPALGIGAFAEKTLVAAGQCTKVDPEADAAATGLLGCG
FT                   VMAGFGAAVNTGGVKRGDSVAVIGCGGVGMAAIAGAVVAGATTVIAVDLDPRKLEKAKE
FT                   LGATRTVNPSDGDVVEAVRELTGGFGADVVVDAVGRPETYEQAFYARDLAGTVVLVGVP
FT                   TPDMEITLPLLEVFGRGGALKSSWYGDCLPSRDFPVLVDLYKQGRLDLDAFVSERIGMQ
FT                   DIEQAFDKMHRGDVLRSVVEVKA"
FT   gene            359846..360532
FT                   /locus_tag="Ksed_03750"
FT   CDS_pept        359846..360532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03750"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05451"
FT                   /db_xref="GOA:C7NK64"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK64"
FT                   /protein_id="ACV05451.1"
FT                   /translation="MSEQHKSTGSAQRVATPFQIEGVRVERVVTSGSFELDGGSWEVDN
FT                   NVWVLGNDSECVVIDPGHEGAPILEAVGKRSLRAVLHTHAHNDHINATGEVTGDKWSPT
FT                   HLHPADRMLWDAVYPVAPDHDLDHGQRITIAGVEMEVLHTPGHSPGAVCFYVPALGILF
FT                   SGDTLFAGGPGATGRSFSDFGQIIQSITDQLLVLPQDTKVLTGHGDATTIGAEAPHRQE
FT                   WIDRGH"
FT   gene            360612..362114
FT                   /locus_tag="Ksed_03760"
FT   CDS_pept        360612..362114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03760"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="PFAM: DALR domain; tRNA synthetases class I (C)
FT                   catalytic domain; TIGRFAM: cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05452"
FT                   /db_xref="GOA:C7NK65"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK65"
FT                   /protein_id="ACV05452.1"
FT                   /translation="MTLRLHDSATREVRDFVPRVPGRASIYICGLTTQTSPHIGHLRFA
FT                   VAFDVLRRWMERGHGLEVTLVRNVTDIDDKILAKSAEHSVAWNEWSQRYERETSAALET
FT                   IGVRPPSYEPRATGHVPDMIELMERLIERGHAYPADDGSGDVYFDVRSWPAYGELTRQS
FT                   IDDMTPATDADPRGKRDPRDFALWKGAKADEPHTATWPTPWGRGRPGWHLECSAMAWRW
FT                   LGEEFDIHGGGNDLRFPHHENEQAQSRAAGFGFTNFWLHNGMLTTGGEKMSKSIGNTLT
FT                   VQELTKIYRPLAVRWLLATVHYRSALEYTPTSLDEATAQVERVEGFLRRALEAAATTPD
FT                   ALRAEAADVALPPAFSEAMDDDVNVSAALAVVFEHVRRGNAALASGADHEGVRQTAVAV
FT                   AGMLDVLGLDPLAPQWDGGAEGDAAALQALDGLVSERLAARAAAKKEKDFATADAIRDA
FT                   LAALGITVADGPAGVTWELATPTPAGDRPTDDSTGPTTTQED"
FT   gene            362116..363087
FT                   /locus_tag="Ksed_03770"
FT   CDS_pept        362116..363087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03770"
FT                   /product="rRNA methylase, putative, group 3"
FT                   /note="PFAM: SpoU rRNA Methylase family; RNA 2'-O ribose
FT                   methyltransferase substrate binding; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05453"
FT                   /db_xref="GOA:C7NK66"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK66"
FT                   /protein_id="ACV05453.1"
FT                   /translation="MRGNSSRRGAVRKGSSKKGMQVGSGGHRRKGLQGKGPTPKAEERE
FT                   YHPAAKRARRAEKSAGGQRPVRGSKARSGKDSTEMVLGRNAVLEALRTQVPATHLYVAS
FT                   TIESDDRVKEALRLASEQGVPLLEAGRPELDRLSNGEVHQGLVLQVPPYTYGDLDTLLD
FT                   ATADVTPLFVALDGITDPRNLGAIIRSAAAFGAHGIIITERRSAGVTAAAWRTSAGAAA
FT                   RLPVARVTNLNRALQELRSQGIFVIGLDADGDVELPGLPLAPDPLVVVVGSEGKGISRL
FT                   TREHCDQIVSIPMTAGNESLNAGTAAAVTLYEIARERAQYEG"
FT   gene            complement(363268..364539)
FT                   /locus_tag="Ksed_03780"
FT   CDS_pept        complement(363268..364539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05454"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK67"
FT                   /protein_id="ACV05454.1"
FT                   /translation="MAYDITAARMKPGLFALPWDTPLDQWPTELISALPRGISRHVVRF
FT                   VEVDGEILAVKEITEHLARKEYRLLHVLDRMGQPAVDPVAVVAGRTDAAGEPLDACLVT
FT                   KHLPYSLPYRSLFSQTLRRATAVKLIDALAVLLTRVHMAGMFWGDVSLSNTLFRRDAGE
FT                   FAAYVVDVETAELHERLTDGQRQHDLFLAHGNVAGELMDLIGGGFLPEETDPLAIADRL
FT                   QERYDLLWAELTETEEIPADQHWRVAERISVLNELGFDVGEIEVTTDIGGSHLRIQPKI
FT                   VDAGHHTRRLMRLTGLDVEENQARRLLNDLDSFTASQGRQNDDESLVAHEWLTRIYEPI
FT                   TRRVPAELRGRLEPAELFHEVLEHRWYLSEREQRAVPIEEAIVHYVESILPTKRPEEVL
FT                   LAPRDATSPETVDRPATGEASPSP"
FT   gene            364717..366120
FT                   /locus_tag="Ksed_03790"
FT   CDS_pept        364717..366120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03790"
FT                   /product="maltose-binding periplasmic protein"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05455"
FT                   /db_xref="GOA:C7NK68"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK68"
FT                   /protein_id="ACV05455.1"
FT                   /translation="MKRNTLSLAASVSIAALTLSACGGDSESSDSETSSGNGATSQESP
FT                   VESGSGDESSDPAEDESGSGDESSAPAEDEPAAGESSAPAAAPKRDENADLVIWADDLR
FT                   TEALNEVKNSFEEEQGITVAVQTVANEQLRQQFKDATQAGEGPDIIVAPHDWAGEFVQD
FT                   GVITPVQLSEETLNSFSPEAAEATKYDGQTYGTPYAVESLGLIRNTELAPEAPKTMEEL
FT                   VKTGQSLVKEGKTKNVMSLQVGKQGDAYHAYPFLAAYGGSLFAKQDGGGYSTELTVGSE
FT                   EMVKGAQKWAWLAEQKALNTNIDSSNALSLFAEGDAPYVISGPWALEQAEEAGISYEVT
FT                   AIPPFEDGGQPISLLGVQMFYVSAKAENGVLAQEFVSNFAATDEVQLAMFEAGQRPPAL
FT                   NSAYEKAAESDETVAAWKAAAEGGDPMPNIPAMNAVWAPLGQATADIVGGKPAAERMKA
FT                   AAEEIKKAL"
FT   gene            366230..367807
FT                   /locus_tag="Ksed_03800"
FT   CDS_pept        366230..367807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03800"
FT                   /product="permease component of ABC-type sugar transporter"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05456"
FT                   /db_xref="GOA:C7NK69"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR032550"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK69"
FT                   /protein_id="ACV05456.1"
FT                   /translation="MSANVGLGAPAGGRTGNPGGTVLKWLLILAVLALGAFAVQRSLEA
FT                   GAWIGVVLAAFLAMMTLVVYATRRFVPMKYLWPGLVLLLALQVWPLVYTVALSFTNTGA
FT                   GHQLTKDETVEIIQASSVQQVEGSERYALSVAVPEGADPTTGDLVYLLTDNEGAHFAGS
FT                   LDGLEEIGDGVETTSAGKITAAEGYQLLDSKQVNERSKELNEFAVPVDDGGIKALGLSQ
FT                   AFVGEAQITYDESADTLTDQRTGTVYVPSEDARWVPQDGDGNPLPQGWKQNVGFDNYLK
FT                   VLQDDTLRGGFLSIFAWNLGFAALSVVTTFVLGMLLALLFNDERLKGKAVYRSLLILPY
FT                   AIPVYVSALVWSSMFNQDFGLINDLSGLDVDWLGNPWAARAAILITNLWLGFPYMFIIC
FT                   TGALQAIPADVKEAAAMDGAGWWRTVRSVIMPLLLVAVGPLLIASFAFNFNNFGLIYLL
FT                   TEGGPFVQGNTDIGSTDLLITYAYRLAFEGATPNFGLASAVAVYIFFIVAAFGAIGFSR
FT                   TKALEEVN"
FT   gene            367809..368768
FT                   /locus_tag="Ksed_03810"
FT   CDS_pept        367809..368768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03810"
FT                   /product="carbohydrate ABC transporter membrane protein"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05457"
FT                   /db_xref="GOA:C7NK70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK70"
FT                   /protein_id="ACV05457.1"
FT                   /translation="MSTAINPSDAVGPQDGAPVAGVTDEESSPPPASRTRMVGQRRGTG
FT                   TWWRHLLVWVAIAWSLFPIVFILSAALNPAGTLATSSLIPSGFSLENWRELFETRPYWT
FT                   WYRNALVISLVATAGAVFIGACAAYAFSRLRFTGRRPGLFALLLVQMFPALLTFVALYF
FT                   TMVRVGEIIPAIGLNTSLGLILVYLGGAMGANIWLLKGYFDTVPRELDEAATIDGASHA
FT                   RIFFTMTLRLVAPILVTVAMLAFVQFWGEFMLASIFLKDADAQTLGVGLWQMQQGNEKN
FT                   AQFGEFAAGALLASIPVVVLYLVFQRQLVSGLTSGSVK"
FT   gene            368768..369769
FT                   /locus_tag="Ksed_03820"
FT   CDS_pept        368768..369769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03820"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05458"
FT                   /db_xref="GOA:C7NK71"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK71"
FT                   /protein_id="ACV05458.1"
FT                   /translation="MLRPTRLQDLAARAGVSQATVSRVLNGHSVRPASSDAVVRALDAL
FT                   GLDRPAHLQPRRGGLVGLITPELSNPIFPALAQAIETRLAPSGYTAVLCTQAVGGVSEE
FT                   DYVELLLQRDVAALVVASGTHADTRNSTERYQRLIDRGLPLVLINGTRDEVADHCLACD
FT                   DALGVEMALEHLVSLGHRRIGLAVGPRHFVPVRRKVRALRAVGERLGVQVDVEHTFYTV
FT                   EGGAAAGTALLDRGATAVVAASDLMALGAIREAVARGVQVPGELSVVGFDDSILMQFTN
FT                   PPLTTVRQPVEALARATVDRLQWQLQGQEPPRHGEVLFAPELVVRGTTAAVG"
FT   gene            complement(369774..370640)
FT                   /locus_tag="Ksed_03830"
FT   CDS_pept        complement(369774..370640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03830"
FT                   /product="trehalose-phosphatase"
FT                   /note="PFAM: Trehalose-phosphatase; TIGRFAM:
FT                   trehalose-phosphatase; HAD-superfamily hydrolase, subfamily
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05459"
FT                   /db_xref="GOA:C7NK72"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK72"
FT                   /protein_id="ACV05459.1"
FT                   /translation="MTDTTRTPEPAASAGAPLPPPDQAHLARTPWLVVATDFDGTLAPF
FT                   QDDPMAVVPHPDSIAALRRLAALPTTQVVLVSGRDVTTLHQLSGLGPQDGVSLLGSHGG
FT                   EQWRVGQDAPTGLDEDEVAQRDMLIAGARGLVAEHPGTTLEVKAAGVVVHTRRATPEVA
FT                   LAARGAVRRLGRRCGVEPLLGKDVLELSVLRTTKGEALAELVHRLGQDRWNRRSHRERT
FT                   PGYTLWFAGDDVTDETVFRAFADEAGAVLVKVGPEPTCASSRVDGIDDVARLLTELADA
FT                   REAAAAG"
FT   gene            complement(370637..372121)
FT                   /locus_tag="Ksed_03840"
FT   CDS_pept        complement(370637..372121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03840"
FT                   /product="trehalose 6-phosphate synthase"
FT                   /note="PFAM: Glycosyltransferase family 20; TIGRFAM:
FT                   alpha,alpha-trehalose-phosphate synthase [UDP-forming]"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05460"
FT                   /db_xref="GOA:C7NK73"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK73"
FT                   /protein_id="ACV05460.1"
FT                   /translation="MTQPSSSDTFDFVVVANRLPVDRVVDSDGTTQWRTSPGGLVTAME
FT                   AVMRVTDGAWVGWAGEAGEAPDPFDDDDIHLHPVPLTAEEVRDYYEGFCNDTIWPIYHD
FT                   VIVSAGFHREWWASYRRVNERFARAAAEVAAEGATVWVQDYQLQLVPQMLRDLRPDLRI
FT                   GWFNHIPFPPMELFAQLPWRREILRGLMGADFLGFQRDDDAGNFRRSAARLTGVTQEGE
FT                   VLTLTADDGRRVRAAAVPISVDSRQLDEMARTTSVQERAVELRHSLGDPECLILGIDRL
FT                   DYTKGIRHRLKAYGELLDEGKVAPPQTTFVQIATPSRERVEAYRNLREQVEGTVGHLNG
FT                   DHSPIGATAIHYIHRSHPRQDMAALFLAADVMLVTPLRDGMNLVAKEYVACQVDGGGAL
FT                   VLSEFTGAAEELHDAYLCNPHDIEGLKQTILRAMTDDEAEKRRRMESLRQVVLDSDVHT
FT                   WSRTFLLALEHAPAEPPRDEHEPAVITDAEDTQEGR"
FT   gene            372262..374217
FT                   /locus_tag="Ksed_03850"
FT   CDS_pept        372262..374217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03850"
FT                   /product="protein kinase family protein"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05461"
FT                   /db_xref="GOA:C7NK74"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK74"
FT                   /protein_id="ACV05461.1"
FT                   /translation="MEMTQVGPYRLEERLGHGGMGTVHRATDRFGRAVAVKVLHPHIAF
FT                   DVSSRTRLEREVSTLARVRHPRVASFLDADVDGQFPYIVTEFVPGMPLDERVAVDGPLD
FT                   GEALHRFVAGVHEALRAIHAVGVVHRDLKPGNVMVDRSGDPVIIDFGIAHIGEESRLTA
FT                   TGLVMGTPGYLAPELIEGGQPTVSTDWWGLGAVLAFAATGRNPYGGGPNEAILARIRRG
FT                   EHDLRSMDPQWRPLAEACLAVDPGDRPTVAEVREVIARGGGSLPERQATQPLGVQGPMG
FT                   EATVPVAGTATGATQPVGRATSRLPGEGGGPDPDATQPVDRAATRPLPRAAASRGAQPV
FT                   PPPATEGFLQPPAQHRDQPAGRLREPEAPTWGAPGAAGPPVAGQQPGPSAAGYQGGPPS
FT                   AGYQPGPPSAGYRPEGPPAGWGPAAGEPQPVPPRHQDSGAVRMPRRSQLHPYDPRTRLP
FT                   RHSWVVLMGSVLAVTATMLWPVATGVVVVAWILVARWADHVAMAHLKRLFARGRRTGDT
FT                   WRIVTGAPWHLVTAMVRGTASLIAPALLGGATVVAVNFALGYDPLRSFTASGAGTATGL
FT                   DNALAWGAGAFVTVVCLWWGIDSASLRRGTRLTLGGALRTTAAEVVVALVLGATAIACV
FT                   LWGLSQGWPTTLAPWR"
FT   gene            374549..375475
FT                   /locus_tag="Ksed_03860"
FT   CDS_pept        374549..375475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03860"
FT                   /product="transglycosylase-like protein"
FT                   /note="PFAM: Transglycosylase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05462"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK75"
FT                   /protein_id="ACV05462.1"
FT                   /translation="MSRSPLKTPRTLGAAGVSGAFIVAGFAAASPANASSYDASVWDRV
FT                   AQCESNGNWSINTGNGYYGGVQFSNTSWQGVGGLEFAPRADLATKAEQIAAAQRLLAIQ
FT                   GPGAWPLCSVKAGLTSANGGADRNAMPGDSAPAPKPEPKPEPKPEPKPEPKPEPKPEPK
FT                   PEPKPEPKPEPKPEPAPKAEPAPEATTWTIERGVNLRPAAGMDNTPKDVLTAGTTVEGV
FT                   KLDSGWVKTDEGYFWHTFGTTGDLEVVESGTYTIHHGVNVRPAVGMDNSPLGMYLKGST
FT                   VEGEKLANGWVKTDRGYFWHTFGTFNG"
FT   gene            375897..376721
FT                   /locus_tag="Ksed_03870"
FT   CDS_pept        375897..376721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03870"
FT                   /product="transglycosylase family protein"
FT                   /note="PFAM: Bacterial SH3 domain; Transglycosylase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05463"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK76"
FT                   /protein_id="ACV05463.1"
FT                   /translation="MSQIPSTVKARGTAAAGMAGAFVVAGFATAAPASAAYDATVWDRV
FT                   AHCESRGNWSINTGNGYYGGLQFHQISWKGVGGLDFAPRADLATKSEQIAAARRLLSLQ
FT                   GPGAWPMCSKYAGLTRDNGGADRWAMPGDPTPPTPPEPPTPPTPDPTPDTDTWTITDRV
FT                   NYRSGPGMSHAVTGKLLPGTTIEGTKLASGWVKTTEGKYFWHSFGTTDSVDTPDPGTYT
FT                   IKRGVNVRSGPGMSYSILGQYSAGATVAGEKLSSGWVKTDRGYFWHTFGTAN"
FT   gene            376813..376888
FT                   /locus_tag="Ksed_03880"
FT   tRNA            376813..376888
FT                   /locus_tag="Ksed_03880"
FT                   /product="tRNA-Thr"
FT   gene            complement(376984..378015)
FT                   /locus_tag="Ksed_03890"
FT   CDS_pept        complement(376984..378015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03890"
FT                   /product="flavin-dependent oxidoreductase, F420-dependent
FT                   methylene-tetrahydromethanopterin reductase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05464"
FT                   /db_xref="GOA:C7NK77"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK77"
FT                   /protein_id="ACV05464.1"
FT                   /translation="MTAPASRVRLSVLDLVPRSEGMTPAEAIAASRTYAERLDELGYHR
FT                   LWIAEHHNTGTFMSSATALLIAHLGHDTRRIRLGSGGVMLPNHSPLMVAEYYGTLATLF
FT                   PDRIDLGLGRAPGTDPMTASALARRSAELDDVASDVAMLSRWLGDEPENAVGSVRAVPG
FT                   GGTGVPLWMLGSSTGGAAVAAALGLPFSFASHFAPAQLRQALDLYRQNFTADAPTAQVD
FT                   APYVMAGVNALVAPTTEEAEHLFTTSQQMAAAIRSGRPQALQPPVEDITRVVPEELLRM
FT                   ADGHGVRMVGDPAQVTDQLQAFVDEYALDEVITTTYTFDPAMRVRSAELLADAWGLTPA
FT                   AEG"
FT   gene            complement(378012..378659)
FT                   /locus_tag="Ksed_03900"
FT   CDS_pept        complement(378012..378659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03900"
FT                   /product="putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05465"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK78"
FT                   /protein_id="ACV05465.1"
FT                   /translation="MTDILIIGGHGKIALQAARLLAERGDRVTSVIRKPEQQDDVAATG
FT                   ATPLVLDVEHAQHADLVQAMRGKDAVVWSAGAGGGDLARTYGVDQKAAIASMKAARDAG
FT                   VPRYVMVSFFGAQLDHPLPFDMGFFHYTQAKAVADAYLRESSLAWTILAPSKLTEDAGT
FT                   GRVDTTAAEATEVPRADVAAAIAHVLGEGAHASLRRTITLNTGGTPLAEAIA"
FT   gene            378707..379351
FT                   /locus_tag="Ksed_03910"
FT   CDS_pept        378707..379351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03910"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05466"
FT                   /db_xref="GOA:C7NK79"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK79"
FT                   /protein_id="ACV05466.1"
FT                   /translation="MLIAELSAVTVHRTSVSEMDNRCYVITSRGTGAQVLVDAAADAPA
FT                   LQGLLAEAAVGEPDLRAIVTTHRHWDHVRALAELATDGVELLGGEADAAAIEEEAGLAA
FT                   GSVRPLEHGEAVQVEDIELQVISLRGHTPGSVALALVDGGEVHLFTGDSLFPGGVGKTS
FT                   GRADFEQLLGDVRSQLFDAFDDEAHVHPGHGDPTTLGQERPQLDEWAERGW"
FT   gene            379330..379743
FT                   /locus_tag="Ksed_03920"
FT   CDS_pept        379330..379743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03920"
FT                   /product="Thioredoxin"
FT                   /note="PFAM: Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05467"
FT                   /db_xref="GOA:C7NK80"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK80"
FT                   /protein_id="ACV05467.1"
FT                   /translation="MGRARVVSTSGTADPPGVAEPLARVRRVEDLSGLMGERGRTVVVC
FT                   FSGSWCGSCSLFEPTFEAVAGELADPERAFALVDTQELPALATAYAIQTVPTVVVLRDG
FT                   VVVDRINGVVTARELRRRVSAGGTAGAGPTVAQ"
FT   gene            379749..381149
FT                   /locus_tag="Ksed_03930"
FT   CDS_pept        379749..381149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03930"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /note="PFAM: Glucose-6-phosphate dehydrogenase, C-terminal
FT                   domain; Glucose-6-phosphate dehydrogenase, NAD binding
FT                   domain; TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05468"
FT                   /db_xref="GOA:C7NK81"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK81"
FT                   /protein_id="ACV05468.1"
FT                   /translation="MSAPSSPAHPTLVILGASGDLTQRLLLPGIGTLLATQPERGLTLI
FT                   GVDREDRGAEWAELVRTRLEEQEVPAATVERVLADLRFEQVDLLQGTQLADLVGGLEGP
FT                   VVLYFALPPAVTMAACEQLRGADLPSDLRLALEKPFAEGAESAAEFNAQLLQLVPENQI
FT                   FRVDHFLGVATLLNFIGMRFSNRILEKVWNAEDIAMVEITYDEDLALEGRAGYYDTAGA
FT                   LRDMLQSHLLQVLAIVAMEPPARIDADELRDLKAHVLNATRLWGDDPVVASRRARYTAG
FT                   VIGDREVPDYTAEEGVDPSRGTETLAQVVVEVQTNRWTGVPFVLRSGKALGEKAKEVRI
FT                   TFRDVRHLPAGLTGQQGPDQLVVSLKPGPVELHLTMNATDPTRIEQKVLTTTVGEPELL
FT                   PYGEVLAGILDGDPLLTVRGDNAVQSWRIIEQVLGAWECDEVPLEEYAAGSAGPAGWDV
FT                   GPEGPARR"
FT   gene            complement(381154..381450)
FT                   /locus_tag="Ksed_03940"
FT   CDS_pept        complement(381154..381450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03940"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: IclR helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05469"
FT                   /db_xref="GOA:C7NK82"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NK82"
FT                   /protein_id="ACV05469.1"
FT                   /translation="MATDRHNQWAQRFDLLGDTTRLRLLDRMHHHPGSSVAELAEAAGI
FT                   SQATASQALRTLRSQGWVEATRDGRSMRYRLVDETAHRLLHVMGADHEPGDAG"
FT   gene            381449..382741
FT                   /locus_tag="Ksed_03950"
FT   CDS_pept        381449..382741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03950"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05470"
FT                   /db_xref="GOA:C7NKI4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI4"
FT                   /protein_id="ACV05470.1"
FT                   /translation="MPRESHTGPRAKYPRGVPHSTDRQSPRAPGLFSRSYVLMLVGIVG
FT                   AFLNFALLLPVVPAWAERLGASSTGVGATTTVMMAACVLGQVGMPWLLRRFGFVKPYVA
FT                   GLVFMGAPALLLPWASALEAVYAIQAVRGLGFGAVVVAGSALAASLAPPRLRGRAVGMY
FT                   GVAIAAAQIPALPAGIPLTHSVGWTSVFLLAGAVAVLVAPVAAGIREAAGDADGAPAEG
FT                   AGAPVTDRSRPWPTPALVLLATSLAYGAVGTFLGIGLQDAAAVFWALLVVSAGQMVGRA
FT                   WAGAFSDRRGVGALLAPMTALSAAGIAAMATAMTEPADLPGWLPEVLAADQTAVLGAAL
FT                   FGIGFGALQNDTFVLMIERAGAARLGTASTVWNVGYDAGTGLGPIVVGTMAGATGLAGG
FT                   FGVLGGVALVTLPVALALGVSEARARRTAAG"
FT   gene            382764..383060
FT                   /locus_tag="Ksed_03960"
FT   CDS_pept        382764..383060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03960"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05471"
FT                   /db_xref="GOA:C7NKI5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI5"
FT                   /protein_id="ACV05471.1"
FT                   /translation="MTPAPDDHRPAPTGESADVLVVGHGLAGLVTAAELLAAGRHVTLL
FT                   DAEGPQDLGGQAWWSFGGLFLVDSPEQRRLRVRDSLELAWADWQRTAGVVTGG"
FT   gene            complement(383097..383783)
FT                   /locus_tag="Ksed_03970"
FT   CDS_pept        complement(383097..383783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03970"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05472"
FT                   /db_xref="GOA:C7NKI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI6"
FT                   /protein_id="ACV05472.1"
FT                   /translation="MMQPMVRLDGVTAAPERGAPPVLRDLSLALEAGTTTAVTGPNGAG
FT                   KSTLCRVVAGLVAPARGTVEVAGRPVVPGHPAHGVAMLFQSPRRSVSPRMTLRQAIAEP
FT                   LELRRRPAARTRRTVDAMADAVGLTPDLLRRRPAAVSDGQLQRAALGRALIGEPQVLLA
FT                   DEVTAMLDPATTASVVALLRERVEEGLTVLTISHDAELLARWCDRPSDRVLALADLTGD
FT                   AGDGAA"
FT   gene            complement(383780..384766)
FT                   /locus_tag="Ksed_03980"
FT   CDS_pept        complement(383780..384766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03980"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05473"
FT                   /db_xref="GOA:C7NKI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI7"
FT                   /protein_id="ACV05473.1"
FT                   /translation="MSAAARVAGLSVRLPVSGGRSWVHAAHAVDLELHTGRVHALVGES
FT                   GCGKSILASVLIGLLPAGTQVAGALEIAGHTLDPTDEAPWQHLRGHHVGLVPQSAATLL
FT                   TPTRRVGPQVAETLRALSPEAHGLRGRSLDALVARHLKRVGLTARVARLYPHQLSGGMA
FT                   ARVAYVLATAGRPAVLLADEPTASLDAESREAVLDLLRSAADGGAAVLLITHDLASLGA
FT                   RTGRVDEVSVMYAGQVVDHGPAERLLAPPGPPQAPDDTTGPDPVARHAYTRALVSALPR
FT                   YGLHPLGGAPPSLLDAVTPPSVDDRLAAGMGPHPGTTGTTDRPGGAR"
FT   gene            complement(384763..385596)
FT                   /locus_tag="Ksed_03990"
FT   CDS_pept        complement(384763..385596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_03990"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05474"
FT                   /db_xref="GOA:C7NKI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI8"
FT                   /protein_id="ACV05474.1"
FT                   /translation="MRELTRTTAGRLAVGTLAALVLFAVAGPWVIGSGVDLSRALQAPS
FT                   GAHWAGTDHAGRDLLVRVAQGLRVSLAIAVLAALGSVLIGVLVGAAAASLGGWADALLM
FT                   RSGDAVAALPHLVLGLVVVAMYPGSVVAIVASIALTHWPTVARLVRAEALAVRRSQYVD
FT                   AARLAGATRWQVLRRHLVPAALPQALVAVMLLLPHAVFHESTLSFFGVGLQPTEASLGT
FT                   LLAQARSDVLLGAWWSLVAPGAALALTTLAVGGVGRALTDAMRSVDAPERAEVPA"
FT   gene            complement(385589..386566)
FT                   /locus_tag="Ksed_04000"
FT   CDS_pept        complement(385589..386566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04000"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05475"
FT                   /db_xref="GOA:C7NKI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKI9"
FT                   /protein_id="ACV05475.1"
FT                   /translation="MELTRIGRMTVRRLAWAVPVTLVVSLAVFALASASPLDPLEAMLG
FT                   DRYQRLTPEQRAVIGRAAGTDAPWWQAWWWWLTDLLRGDLGFSRVFRQPVAEVLLERVG
FT                   WTVLLTLPAMALALVLGLAGGVAAGLRPRSWWGRLVTGTALVLQALPPYVLAMVAILLF
FT                   AVAWGLLPSGGLGRPGEEVTASGLLRHATLPVVVLALSQLPWLVLAARESVAETMTSDA
FT                   VRGARARGLSARTIRRGHVVPPALVPVATLVGLRLPELVVGAVIVEEVFAWPGVASAMV
FT                   DAALELDFPLLAALTTLTTVLVLVGSWLADVVHLALDPRVEIDA"
FT   gene            complement(386571..388217)
FT                   /locus_tag="Ksed_04010"
FT   CDS_pept        complement(386571..388217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04010"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05476"
FT                   /db_xref="GOA:C7NKJ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ0"
FT                   /protein_id="ACV05476.1"
FT                   /translation="MTSTPIPRRRLIATSLAITATALAGCGLTTPGGGGGTSAGEEGGS
FT                   GEGNEHPALVVAGTEELGAFNPVSGYGEQGGTPVYEGLLRLRSTDPEQLPELEPALAAE
FT                   APTASEDLTTWRVPVRDGVSFHDGSQLGPEDVVATYEAVLDPASASEVAWAYDMVESVE
FT                   AEGDEVVFHLTDAYADFPSRLLLGIAPQEKLTGGPATESSLNREPVGTGPMRLTSLEPT
FT                   EATFERFDDYWGEPGAVPKLTITRVPDEGTRAQQARTGEVDGTILPPKLAESTAEASEH
FT                   LELVTASTADWRGVSFPATAAIAQDAATRIAMNHAVDRQAMIDTVLGGHGTPAATPVSS
FT                   IYGEAYADLTFEHDPDRAEQMLDEAGWTTGEDGIRTKDGERAEFTVAYDPKDSVRRDLA
FT                   TAFAEDLKDVGIDVSTRAMTWDEIEPQYQDLAILLGGGDKPYSIDSQVFSAVHTPLEGA
FT                   AFYYNPGGQGSEELDRLLEQTRTETDPAARNALYRQVQEQVVQDPNGVYLAFLEHTYVH
FT                   DAHGYSTGNLVVEPHAHGVAWGPWWNVGAWE"
FT   gene            complement(388272..390101)
FT                   /locus_tag="Ksed_04020"
FT   CDS_pept        complement(388272..390101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04020"
FT                   /product="choline/carnitine/betaine transport"
FT                   /note="PFAM: BCCT family transporter; TIGRFAM:
FT                   choline/carnitine/betaine transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05477"
FT                   /db_xref="GOA:C7NKJ1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ1"
FT                   /protein_id="ACV05477.1"
FT                   /translation="MTTHTDHDRGTHMLQKLHDAMGLRTSPTIFFGSFAVAIVFIVITL
FT                   SFPGTMANTFESGSDWLLGNLGWFYILGVTVFLIYLIVTAMSRFGRIRLSPHDEAPDHS
FT                   FPAWFAMLFAAGIGTILMFWGVAEPVNHFANPPMADVEPESVDAAREAMSFTLYHFGLH
FT                   TWTIFALPSLAFAYFIYQRNLPPRVSSLFHPLLGDKGIHGPIGKTIDIVAIVGTLFGVA
FT                   VSIALGTLQINAGLSAVLGIDQSTLSILLIVGVVTVLALCSVIAGLDKGIKVLSNANIL
FT                   AAVGLMVFVLISGPTLHLLRGTIEGVGLYAQNLPYLAFWNDSFDDNPGWQDGWTIFYWA
FT                   WTITWSPFVGIFIARISRGRTIRQFIVGVLAAPVSFSIIWYGIFGFASFDIIRNQEGGG
FT                   QLVDSVLNDGAEVALFEFLEHFPFTTFMSVFSIAIVAIFFVTSMDSASLVMDSMARGHD
FT                   EDERVPVLQRIIWAITVGAIAAVLLTFSPDAGISALEDVITIVGLPFFVMGYLMIWALN
FT                   RAMKEDAGELLPLATRRYRKVLPPEEVERRRAEGDEAWSDTALEQDPHYMDSEGHVIAA
FT                   PETAAYEQHELYEAGEDRPSEEVTGSSRLNGTA"
FT   gene            complement(390305..390976)
FT                   /locus_tag="Ksed_04030"
FT   CDS_pept        complement(390305..390976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04030"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05478"
FT                   /db_xref="GOA:C7NKJ2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ2"
FT                   /protein_id="ACV05478.1"
FT                   /translation="MSTRDAPLQVVLVDDHPVVRAGLTAVLSATGDIEVAAQAGSHGEA
FT                   LALLTGAGGPLGGVAVDVVVVDLHLGSGPDGAALIQDLRGLGVATPMLVLTAHDDGDDV
FT                   LQAVEAGASGYLLKDAPPTSLRDGVARAAAGETVLAPAAAAHLVTGARATTAEAAPRVT
FT                   DRELQVLRGVARGQTNRQVARELGIGEATVKTHLVHVFTTLGVTNRTAAVGRARELGLL
FT                   D"
FT   gene            complement(390973..392178)
FT                   /locus_tag="Ksed_04040"
FT   CDS_pept        complement(390973..392178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04040"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05479"
FT                   /db_xref="GOA:C7NKJ3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ3"
FT                   /protein_id="ACV05479.1"
FT                   /translation="MAMDRLARLLAGALLLSLLALATWRSGAQAGDGSNPDLPGWTFLV
FT                   ASSVWWLAFAGLLTPRLRNSTPRRPYTGAAVWLVALSVGWAALMTTHEAFAWVAFPLFL
FT                   LWLMHLPLVAAVPAVLALTAVVGVVELAQEDGRWGGVLGPALAAAACILGAWTMTRLRQ
FT                   ESEARARLVAELRSTRQELAAAHTEAGALAERHRIARDLHDTVVQSFTSVLLLARAGGR
FT                   PEEVLPRIEEVAADGLAESRRVVQTLRREPGRTLADALRRAAAGVVDPPTSFTLTGTPR
FT                   ELPTATEVGLLRIAQGALGNVTEHAGASQAWVELAFTPDAVRLEVRDDGRGGARVGAGP
FT                   EAAVAPVAPGAAPGAAPGAAPGANRGTGLAGARDRAEDLGGSFALRSPAGRGTHVVVEV
FT                   PA"
FT   gene            392346..393332
FT                   /locus_tag="Ksed_04050"
FT   CDS_pept        392346..393332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04050"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05480"
FT                   /db_xref="GOA:C7NKJ4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ4"
FT                   /protein_id="ACV05480.1"
FT                   /translation="MFVALRDAWFARGRFAVMGLVVALVALLVVALSGLTAGLGAQSVS
FT                   ALRALPGEAVVVAAPAEGESPELARSQLTEEQVAGHEGEALGIATARIELDEGTETVTV
FT                   FGVDPDGALAPEQLVAGATVGESGTLEGVSPDDAHLSFNHLPVVWVPLEVWRELPMATG
FT                   SRASALVLPDEPGEAQVAGGQALTRSEALDAVGSYSSEQGSLQLIQGLLLVVSAVVVSA
FT                   FLTVWTIQRTGDLAVMRALGATRRTLVGDVLTQGLLLLLVGGGVGALAATGLGAWVLST
FT                   DAVPWALTPMTTVVPWLLLVAAGLVGAALAVRRVLTIDPALALEGAR"
FT   gene            393329..394108
FT                   /locus_tag="Ksed_04060"
FT   CDS_pept        393329..394108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04060"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05481"
FT                   /db_xref="GOA:C7NKJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ5"
FT                   /protein_id="ACV05481.1"
FT                   /translation="MSLELTDVTVTFPDGEGVRHVLDGLDLSVAAGEAVALTGPSGSGK
FT                   STLLAVAGLLRRPDAGSVRLGGRECGDLSSSRRDAVRRELVGLVFQQAKLLSALTAQEQ
FT                   LELVARLRGARGGALRQAQDKARSLLAELGMEEAAGHRPHQLSGGQQQRVALARALMSD
FT                   PAVLLVDEPTSALDPARAGEVFARLARIAREHDVAILVVTHDERHLGLMDRVLTMDLGR
FT                   AVLADAVGEWRREETADSHEPVAAGTARPRGASLLTV"
FT   gene            394325..395059
FT                   /locus_tag="Ksed_04070"
FT   CDS_pept        394325..395059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04070"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05482"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ6"
FT                   /protein_id="ACV05482.1"
FT                   /translation="MALFATCFNDTMWPEAPKATVRLLERLGVQVDFPMEQTCCGQMFT
FT                   NTGYGPRAAGLVRSFIDTFGDYDAVVAPSGSCVGSVRHQHTGIARAVGDTGLERDAAAL
FT                   APRVHELSEFLVDVLGVTDVGAFFPHSVTYHPTCHSLRMLRVGDRPLQLLRAVRGIDLR
FT                   ELPGAQECCGFGGTFAVKNSDVSVAMGAEKARQVTATGAEVVVAGDNSCLAQIGGVLGR
FT                   QRSGVRTLHLAEVLASTQEDPA"
FT   gene            395056..396537
FT                   /locus_tag="Ksed_04080"
FT   CDS_pept        395056..396537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04080"
FT                   /product="(4Fe-4S) cluster-containing protein"
FT                   /note="PFAM: Uncharacterised ACR, YkgG family COG1556;
FT                   TIGRFAM: 2[4Fe-4S] protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05483"
FT                   /db_xref="GOA:C7NKJ7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ7"
FT                   /protein_id="ACV05483.1"
FT                   /translation="MTTIPGPVQQTSPTFLGMPPFPEAAREALGKSTQRRNLHHATHTI
FT                   RAKRAAVVGEVDQWEQLRLAGEATKDEALRHLPHYLEQLEERLTARGATVHWARDAAEA
FT                   NRIVIDIARAKGAEEVVKVKSMATQEIELNEALEGAGIHAWETDLAELIVQLGGDLPSH
FT                   ILVPAIHRNRSEVRDIFRAEMGRVGRPAPADLTDEPARLAEAARLHLREKFLRAKVAVS
FT                   GANFAVAETGSLVVVESEGNGRMCLTLPETLVSVVGIEKVLPRWEDLESMLQLLPRSST
FT                   GERMNPYTTVWSGVHPGDGPQEVHVVLLDNGRSHALADTTGRQALRCIRCSACLNVCPV
FT                   YERTGGHAYGSVYPGPIGAVLNPLLRGVSSEVDASLPYASSLCGACFDACPVRIDIPTL
FT                   LVEGRERSVEAGGHRVEAAAMKAATWVMSDHRRLEAAQRAATTVGRLRGDRPFRALPGL
FT                   GAWTGARDLPAPPAETFRQWWAREHGDDTTEKGER"
FT   gene            396534..397193
FT                   /locus_tag="Ksed_04090"
FT   CDS_pept        396534..397193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04090"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterised ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05484"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ8"
FT                   /protein_id="ACV05484.1"
FT                   /translation="MSARSEILDRLRGALADVDGAPDPQVGHRTMPTTMQGAGLPAEGV
FT                   LERFTEMVRDYRATVQSVTSADLPRAVAGALQVAGCSSVVVPTGLDDRWLSEVRHGPMR
FT                   VVAEQEVDTAGLDGVDAVVTAAAVGIATTGTIVLDHGPDQGRRALSLVPDTHVCVVRAE
FT                   QVVADVPQAVARLHPEAEAAQPQTWISGPSATSDIELERVEGVHGPRTLMVLLVTD"
FT   gene            complement(397196..398242)
FT                   /locus_tag="Ksed_04100"
FT   CDS_pept        complement(397196..398242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04100"
FT                   /product="L-aminopeptidase/D-esterase"
FT                   /note="PFAM: Peptidase family S58"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05485"
FT                   /db_xref="GOA:C7NKJ9"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKJ9"
FT                   /protein_id="ACV05485.1"
FT                   /translation="MGQRTDAPPEVQDTPPPTLRPMTSPGSITDVPGLRVGHAQRTDDG
FT                   WCTGTTVVLPPPGTVGAVDVRGGGPATHETDALAPASLVPTVDAVVLTGGSAFGLASVT
FT                   GVQLWCEEAGRGFPTPGGLVPIVPGAALYDLARGGGNRDDAGHPTRPDAAMGRAAAEAA
FT                   AASAEHADVARGRVGAGTGARVMGATRPGGVGTASARLDGAVVGALAVVNAHGTPLGID
FT                   PAELCDPVEATGVIGSAPTAPGAPAQGAPGTGTPGTNTTLAVVATDLALTVAQTEALCR
FT                   AAHAGMARALDPVHSLVDGDVVFGLATGERPLPDDPAAATGVLLAAQQAAATALAAAIA
FT                   DGVSRRHG"
FT   gene            398310..398513
FT                   /locus_tag="Ksed_04110"
FT   CDS_pept        398310..398513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05486"
FT                   /db_xref="GOA:C7NKK0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK0"
FT                   /protein_id="ACV05486.1"
FT                   /translation="MAMRPHTRRHHTHGENIVAAWLFAYVGGTADYTQQNYVEVTVVSL
FT                   LTAGLCVAVMMGTLLWQRRRAD"
FT   gene            complement(398554..399534)
FT                   /locus_tag="Ksed_04120"
FT   CDS_pept        complement(398554..399534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04120"
FT                   /product="putative NAD(P)H quinone oxidoreductase, PIG3
FT                   family"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase; TIGRFAM: putative NAD(P)H
FT                   quinone oxidoreductase, PIG3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05487"
FT                   /db_xref="GOA:C7NKK1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK1"
FT                   /protein_id="ACV05487.1"
FT                   /translation="MRAIVIDNSGEKPVLTLSEVEDPTPGEGEVLVEVAAAGVNRADLV
FT                   QASGKYPPPPGESELIGLEVSGRIAALGAGDTGDWQVGDEVCALLAGGGYAEKVAVSAG
FT                   QLLPVPAGVDLQTAASLPEVACTVWSNLVDAGHLAAGETVLLHGGSSGIGTMGIQVAKA
FT                   LGARVIVTAGSQEKLQRCAELGADVLVNYQETDFLEAVGENTEDGVDVILDLIGADYLD
FT                   RNLQALAKDGRLVIIGLMGGREGEINLGLMLQRRLSVQATALRGRDRADKARIVAAVRE
FT                   NVWPRVESGEIRPVVQEVLPWEKAQEAHQLLKESQHVGKVVLRVG"
FT   gene            399694..400275
FT                   /locus_tag="Ksed_04130"
FT   CDS_pept        399694..400275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04130"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF461)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05488"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK2"
FT                   /protein_id="ACV05488.1"
FT                   /translation="MYRRLIALAATGLLFVTACSQDGASDGEGSSSDAVTSSDAATSSG
FT                   PASGSQDPSTQSPPPPGAVGLYDGWVKATEKDMTAVFGRLQNPLPVDVTFVSGSTDVAE
FT                   SVELHEVAGGSMQPVEGGMTVPRGEVLELEPGGLHIMLMGVKKPIVAGDEVVITLEDAD
FT                   GKTYALTAQARTFDGGDEDYAGGDGHSHSH"
FT   gene            400275..401597
FT                   /locus_tag="Ksed_04140"
FT   CDS_pept        400275..401597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04140"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="PFAM: Dyp-type peroxidase family; TIGRFAM: Dyp-type
FT                   peroxidase family; Tat-translocated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05489"
FT                   /db_xref="GOA:C7NKK3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK3"
FT                   /protein_id="ACV05489.1"
FT                   /translation="MAPVDDAPQGPGATSRQLLGGAAIAAGGGLLGVLGARATAGPVPT
FT                   AAGGGTASGPGAGATGIAQLDELVEPGRRSVLPADPDAPSPEAGATEVGRTVIDPRGHT
FT                   QAGVLTTPPAHGLWVALDLVDGGRETLRRVMRLWTDSIDRLTSGRGTLTDTEPELAALP
FT                   ASLTVTVGWGLGAYLAAGLDAERPAWLRPLPPMSFDELDPAWGDGELLLQVWADDPLTV
FT                   RHAARQLTEDVRDLAMVRWRQAGYRHAVGTSRPGAPMRNLFGQVDGTGNPPPLDAQQLV
FT                   HREDGSAAMVVRRVRFSMGGWEQAARAQREAAIGRQLRSGAPLTGQQESDPVDLGATDA
FT                   SGQPVVAADAHVRRAQDGHARHRFLRRPYNYDDAPGDAGQVFVAFCQDVDEQFLPILRR
FT                   LSESDAMNEWLTHVGSAVFHVLPGVPSGAGRAYLGSHLLER"
FT   gene            401844..403022
FT                   /locus_tag="Ksed_04150"
FT   CDS_pept        401844..403022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04150"
FT                   /product="Trypsin"
FT                   /note="PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05490"
FT                   /db_xref="GOA:C7NKK4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK4"
FT                   /protein_id="ACV05490.1"
FT                   /translation="MKRTSMMTALAGVAALSLGTGMAAGAAPAGSSGEAAVTQHDALTA
FT                   YVTQSQDLSWDEAEKYLEAKAEKAAVLDELDAQGKAIEGAYFDGAELTVITNDAATATA
FT                   AKARGITVKQGAGQAELTQVADRAAALMEADGGIQSVGPDLKSGTVKVRVGADAEQATL
FT                   DKLAAMDGVQVVRGDAQGLTTHADVIPGQIMDLEPGTNCSLGFPGMKGSDNVMLTAGHC
FT                   VEGMPDVLNAQGEHLGKGVESEFATGQPSVDMGLMDIDEANTGQPFVDTRGHSGSIDVT
FT                   GASKAPVGTEICKAGNTTGWTCGEIQGYDQTVDYGGTVTSGLAEATVCTEGGDSGGAYI
FT                   SGTVAQGMTSGGPISAECGWNQGEAAGSYSFYQPVVDAAEHYGVTLTTVNNW"
FT   gene            complement(403121..403870)
FT                   /locus_tag="Ksed_04160"
FT   CDS_pept        complement(403121..403870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04160"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: IclR helix-turn-helix domain; Bacterial
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05491"
FT                   /db_xref="GOA:C7NKK5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK5"
FT                   /protein_id="ACV05491.1"
FT                   /translation="MPHPTLLVLRALARHRGPVAAGHLARETGIPRASLYRALADLRET
FT                   GFVTHLPEEQQWMLGLAAFELGFAYSRQESLQRLGRPVVRRLVDEVQQNAHLAVLHGTD
FT                   VLYLAEERAPRRPSLVTDVGVRIPAPWTASGLAVLAALPREQVRALFPDAGSFVASRGD
FT                   HPHRAPDTPQALRRALVAVRADGIARERDTVTAGLASVSVAVADASGHPVAAVAVTFEH
FT                   ARTEPAEVTALEAAVRAAAEDVERRLR"
FT   gene            403939..405438
FT                   /locus_tag="Ksed_04170"
FT   CDS_pept        403939..405438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04170"
FT                   /product="sodium/proline symporter"
FT                   /note="PFAM: Sodium:solute symporter family; TIGRFAM: SSS
FT                   sodium solute transporter superfamily; sodium/proline
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05492"
FT                   /db_xref="GOA:C7NKK6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK6"
FT                   /protein_id="ACV05492.1"
FT                   /translation="MSDPTWQLIAIVLYFAAMVGIGVWSFTRTGDKGDYMLGGRGLGPV
FT                   ASALSAGASDMSGWLLMGLPGALYLSGLVELWIAIGLTAGAWLNWKFIAPRLRTYTEVA
FT                   DDAITVPSFFSNRTDDHAGLLRITAGVIILVFFTFYVSSGMVAGGRFFQASFDTSYTTG
FT                   MLVVSGIVILYTLIGGFLAVSYTDVVQGLMMLAALILVPIAGVVHLGGLGDTVDAIRSV
FT                   DAHALSLFGGGLTTMAFISAVAWGLGYPGQPHIITRFMALRSPRQARSARRIGVGWMAL
FT                   ACLGAAATALVGIGVFQRESEQLTDPETVFIDLGVLLFHPFVAGLMLAAILAAIMSTIS
FT                   SQLIVSSSALVEDIYLGITGKELRGNIGAHLGRVAVLVIALVAGALSLNPSDTILDLVA
FT                   FAWAGFGASFGPIVILALYWRRLTTLGALAGMVTGAVVSFGWGQLEGGLFDLYEIVPGF
FT                   ALNLLVTVVVSLLTRQPGPEVRAEFDEAVRRAEAQEETVPA"
FT   gene            405542..407176
FT                   /locus_tag="Ksed_04180"
FT   CDS_pept        405542..407176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04180"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: Phenylalanine and histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05493"
FT                   /db_xref="GOA:C7NKK7"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK7"
FT                   /protein_id="ACV05493.1"
FT                   /translation="MTPIANPAPSVPETVVVTPAPLTPAEVIAVARHDATVELGDEALA
FT                   AIRTARERVDALADDSTPHYGISTGFGALANTSIPTEKRSRLQVGLVRSHAASSGPEVE
FT                   REVVRATMLLRLHTLATGHTGVAEETARTYAALLNAGITPAVREYGSLGCSGDLAPLAH
FT                   CALAAMGEGEVHVGTAAEVDASGVASTPLVRAGEALAAAGIEPVVLREKEGLALINGTD
FT                   GMLGMLLMGLADLRHLSRVADLTAAMSIEGLLGTDAVFAPELHALRPQAGQADSAANLR
FT                   TLLAGSGIVASHKEDCSLVQDAYSLRCTPQVLGGLRDTLAHAEQVAAAELASAVDNPAV
FT                   LDDGRVESNGNFHGAPLAYVLDFLAIPAADAASMAERRTDRFCDPARNNGLKAFLADDP
FT                   GTDSGHMIAQYTQAAIVSEMKRLAVPASVDSIPSSAMQEDHVSMGWSAARKLRRSVDGL
FT                   RRVLAIELLTAARGIDLRCAGEGDQGGAGEALTPSPATGAVIAALRETVQGPGEDRYLS
FT                   PEIEATVDLIASGRALAAAEGVTGPLR"
FT   gene            407324..407887
FT                   /locus_tag="Ksed_04190"
FT   CDS_pept        407324..407887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04190"
FT                   /product="uncharacterized anaerobic dehydrogenase"
FT                   /note="PFAM: Molybdopterin oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05494"
FT                   /db_xref="GOA:C7NKK8"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK8"
FT                   /protein_id="ACV05494.1"
FT                   /translation="MGITPLNWPVVRQLRQGDLLGRGRSVTSKATREVTARTTTADRVV
FT                   QSVCPYCAVGCGQKVFVKDEQVVQIEGDPDSPISRGRLCPKGAASEQLVNSPTRITEVM
FT                   YRRPGGTEWESLDRDTALQMIADRFLETRAKHWQEFDEKGNRLRRTMGIAALGGATLDN
FT                   EENYLIKKLFTAAGAVQIENQARI"
FT   gene            407957..410719
FT                   /locus_tag="Ksed_04200"
FT   CDS_pept        407957..410719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04200"
FT                   /product="uncharacterized anaerobic dehydrogenase"
FT                   /note="PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit, proteobacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05495"
FT                   /db_xref="GOA:C7NKK9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKK9"
FT                   /protein_id="ACV05495.1"
FT                   /translation="MANADCIIIQGSNMAECHPVGFQWVGEAKKRGARVIHVDPRFTRT
FT                   SAIADTHVPIRVGTDVVFLGALINHVLSNDLYFHEYVVNYTNAATLVDEDFQDTEDLDG
FT                   LFSGYDPESGSYDMTSWAYDARAGDDEVDAPEGERGDSGEHATETAEGDTLGSGGAPME
FT                   HAKVRTDETLQHPRTVFQVLKRHYARYTPELVEEVCGISPEQFAEVADALVSNSGRERT
FT                   TCFAYAVGWTQHSLGAQFIRTGSILQLLMGNMGRPGGGIMALRGHASIQGCTDIPTLFN
FT                   LLPGYLPMPSAGRHESLQDYLGSIASPRQKGYWTSADAYTVNLLKAWWGDAATPENDFA
FT                   YEYLPKINGSHGTYQTVVSQIAGDVEGYFVVGQNPAIGSANGRMQRHGLANLKWLVVRD
FT                   FQLIETATFWKDGPEIASGEWQTEDIDTEVFFLPAATHVEKAGTFTQTQRLLQWRHQAV
FT                   RPPGQCQSELDFFHELGVVLRERLADSTDERDRPLLDLTWDYPRDEHGEVDGEAVLAEI
FT                   NGRHLTGEKAGQPLDSYLEMQADGSTEGGCWIYTGVMAGGVNHSANRVPGDQQDEIAAD
FT                   WGWAWPLNRRILYNRASADPEGRPWSERKKLIWWDAEAGRWTGPDVPDFPVDRDPAFRP
FT                   SADDVGAAAIAGNDPFVMQADGKGWLYAPKGMVDGPLPSHYEAQESPVVNPVYGQQRNP
FT                   TRVVLPREDNLFAPSGDAAGSDVYPCVFTTYRLTEHHTAGGMSRWLPYLSELQPSMFCE
FT                   ISPELAAERGLENGGWATIISPRSAIEARVLVTERVSALRSGGKRIHQIGLPYHWGVGD
FT                   EAVVEGDAANDLLGVALDPNVQIQESKVGSCEIVPGRRPRGAALARLVDEYRKRAGAEM
FT                   GVGVTSATIITEQSDDVHTEAYDEDPTAGQGASGLGGPAEDETAAEGDR"
FT   gene            410716..411891
FT                   /locus_tag="Ksed_04210"
FT   CDS_pept        410716..411891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04210"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05496"
FT                   /db_xref="GOA:C7NKL0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL0"
FT                   /protein_id="ACV05496.1"
FT                   /translation="MTSLRDQFSGPTDPAADAGWEPQPRKGFFTDTSICIGCKACEVAC
FT                   KEWNALPLDSMEFTGNSYDNTNSLGASTWRHVAFIEQGADEVAAARESGRRLVDLGLPG
FT                   VGSGQDVGAGQAPSVPADGAAGCGAGGGCGCASGGQAGQGGQGGQGGVTPSGGTGPSGE
FT                   SMNPITDLLTAQTEAEKARAMGTVPDFRWLMSSDVCKHCTHAGCLDVCPTGALFRSEFG
FT                   TVVVQADICNGCGYCVGACPFGVIERRTDATGDRGHVDGGEVPRIGVAQKCTLCYDRLS
FT                   HDQTPACAQTCPTTSIQFGDHDEMVRRAHERVDLLRGNGFPEARLYGANEFDGVGGTGS
FT                   VFLLLDEPEVYGLPPDPIVPTAELPAMFRSAVTAAVGLVGVAALSFLGGRR"
FT   gene            411888..413126
FT                   /locus_tag="Ksed_04220"
FT   CDS_pept        411888..413126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04220"
FT                   /product="formate-dependent nitrite reductase, membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05497"
FT                   /db_xref="GOA:C7NKL1"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL1"
FT                   /protein_id="ACV05497.1"
FT                   /translation="MSTSEFDAYFPQEYAGPRRRRSGGRRGEGRDGGDVRDGSGDRSGR
FT                   GTGDPGGRGSRASDWLTGRGRGRGEQPVVPEPEFTSYYGHAVVKPVPWKHEISIYLFTG
FT                   GVAGGSGLLAAGAHAAGLDGLRRNARLTAIVAAGVSGVALIADLGRPERFLNMLRTVKL
FT                   TSPMSVGTWIFSGYSSFAGLAAAIEADRLLGGRPAPAPRGASPTSGGLPVLGPVLRPFD
FT                   AVASAGLALFSAPLAAYTAVLLSDTATPVWFESRRHLPFVFVSSAGMASGGVQQVLAGM
FT                   LGGESLAEAGPARRLAVAGALGDYLAVDALEKQLDEVGVLEPLHHGAEGRKMRLSKALT
FT                   VAGGVVTLVAGRSRAGAVVGGLALAAASALTRFAVVEAGIESAKDPRWTVEPQRRRLEA
FT                   RRAAGQTGDSITT"
FT   gene            complement(413167..414240)
FT                   /locus_tag="Ksed_04230"
FT   CDS_pept        complement(413167..414240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04230"
FT                   /product="selenophosphate synthase"
FT                   /note="PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: selenium donor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05498"
FT                   /db_xref="GOA:C7NKL2"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL2"
FT                   /protein_id="ACV05498.1"
FT                   /translation="MGWAGAHRGGWADGHSFAYRDAMTDSLRLTQFAAGGGCACKIPAE
FT                   ELEQVVAGLRGQVPATDAAVLVGLDDGDDAAVVQVAPGVASVSTADFFTPVVDDPRTWG
FT                   RIAAANALSDVYAMGGTPVMAINLVGWPRAALPMELLTEVLAGGLEIATQAGCPVIGGH
FT                   SIDSPEPIYGMAVTGTADPDRLLRNDAAEPGLPISLTKPVGLGILNNHHKTTGALHPHA
FT                   IEVMTQLNAAASRAALQAGVRAATDVTGFGLLGHLFKMCRASAVAACIDAGAVPCVDGA
FT                   REALAAGHVPGGSRRNLDWVRPHLSAEGVAEDELLLLADAQTSGGLLVIGEVPGAPVIG
FT                   ETVPAGSLGEGVMVQVR"
FT   gene            414274..414369
FT                   /locus_tag="Ksed_04240"
FT   tRNA            414274..414369
FT                   /locus_tag="Ksed_04240"
FT                   /product="tRNA-Sec"
FT   gene            414500..415876
FT                   /locus_tag="Ksed_04250"
FT   CDS_pept        414500..415876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04250"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; TIGRFAM:
FT                   seryl-tRNA(sec) selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05499"
FT                   /db_xref="GOA:C7NKL3"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL3"
FT                   /protein_id="ACV05499.1"
FT                   /translation="MTAGQPADPDPRRRIPRTDAVLADPRIAATLARLDRRTVLDAVRH
FT                   AQEQARAGEIAPGQVVDTALATLPQRASSLTPVLNATGIVVHTNLGRAPLAPTARQALQ
FT                   DAAGTVDIELDLATGERGPRAAGLREALHRAVPTAEDTLAVNNGAAALVLATTALAAGR
FT                   EVVVSRGQMVEIGDGFRLPDLIASTGARLREVGTTNRTHLADYADAVGPDTGCILAVHP
FT                   SNFRVDGFTRTVSTTELATLGVPVVHDIGSGLLAPDPALPDEPDAATALAAGAHLVTAS
FT                   GDKLLGGPQAGLVLGRADLVHRLRRHPLARALRIDKLTAAALEATLRSPSTPVSDALHA
FT                   TAAELEPRTRRLARELGLEVTPIEGRVGGGGAPGVPLPGWALVLPPDAVSRLRRPPAGT
FT                   AVVLARIEGGRGLVDLRCIAPADEPALADAVRVALGATPAPAGPATPAPIPPDGSEPTP
FT                   "
FT   gene            415873..417765
FT                   /locus_tag="Ksed_04260"
FT   CDS_pept        415873..417765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04260"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="PFAM: Elongation factor SelB, winged helix;
FT                   Elongation factor Tu GTP binding domain; Elongation factor
FT                   Tu domain 2; TIGRFAM: selenocysteine-specific elongation
FT                   factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05500"
FT                   /db_xref="GOA:C7NKL4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL4"
FT                   /protein_id="ACV05500.1"
FT                   /translation="MRRVLATAGHVDHGKSTLVRALTGRDPDRLAQEKERGLTIELGFA
FT                   WTTLPDGAEVAFVDVPGHRRFIGTMLSGLGPAPAVVFVVAADQGWQAQSSEHLAAVQAL
FT                   GLRRLLLVVTRADLADPAPTLAAARERLAAAGIEPLGEVAVSAVTGQGMDDLRAALDGL
FT                   VASLPEPDATAPVRLWADRAFTVGGSGTVVTGTLGAGTLRVGDELELLDEQGHRASVQV
FT                   RGLHSQDVERAEVGPVSRAAVNLRRVQRDAVGRGAVLLTPGAWEAARVVDVTLGPAGDG
FT                   GATTGAGVGAASAGAPSAGAAVPPERVTLHVGTADLEVHCRALGAGHARLTLPVDLPWR
FT                   VGDRVILRDPGSRHLWAAVVLDADPLPLRRRGAARERGEALTAAGTDGVRLRRVRLAGR
FT                   RVEPAARLERLGLGAASPDPSGSTDPPGGPAEGSERRIADLVVDPAAWQSWRDALAATV
FT                   RTHHQDQPLSAGLTPAEAAHAIDLPSQHAATLLPALAAAAGLTLQDGRVRDLQAGGLGP
FT                   AEPGIAQVEAWLREDPFAAPEARDLDDLGVGARELAAAVRLGRVLRLPGEVVLLPDAPA
FT                   RAMRELVGLPQPFTTSQARQALGTTRRVAIPLLEHLDARGWTRRVDAQTREVVR"
FT   gene            complement(417773..418918)
FT                   /locus_tag="Ksed_04270"
FT   CDS_pept        complement(417773..418918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04270"
FT                   /product="threonine aldolase"
FT                   /note="PFAM: Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05501"
FT                   /db_xref="GOA:C7NKL5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL5"
FT                   /protein_id="ACV05501.1"
FT                   /translation="MATDPAEMDLTARRRAAAAAATRHLTGGRPSPAQELRSLADHLDG
FT                   LTASGALEEGSAGWDSYGEHGTVALLERRVAELLGTDDAVFFPSGVMAQEVALRVHCDA
FT                   AGTSRVAMPNLSHLLVHEEDGPRRLHGFEVEHLTTGPRVATAEDLAAIPGRLGAVLAEL
FT                   PLRDGSYLLPTWDELTGLASACRERGVALHLDGARLWESQPWFDRPLAEIAGLADSVYV
FT                   SFYKGLAGLAGAALAGTEELCREARVWRRRQGGTLFTLMPYAAAALRGLDEHLPQMAQR
FT                   HEYAVAWARALAERGLRTVPSEPHAVAFRVYAPDDADAVSERALQAVERDRIGLPMVWQ
FT                   PANVPGWAWCELTVTAPTLEFGVAEAADLIAGLVEPGSTDR"
FT   gene            419116..420828
FT                   /locus_tag="Ksed_04280"
FT   CDS_pept        419116..420828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04280"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="PFAM: Urocanase; TIGRFAM: urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05502"
FT                   /db_xref="GOA:C7NKL6"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL6"
FT                   /protein_id="ACV05502.1"
FT                   /translation="MEGARPVRAPRGTELSCKSWQTEAPLRMLMNNLDPEVAERPDDLV
FT                   VYGGTGRAARSWEAFDAIVASLKELEDDETLLVQSGKPVGILRTHEWAPRVLIANSNLV
FT                   GDWATWEHFRELEAEGLMMYGQMTAGSWIYIATQGILQGTYETFAAVGAKRFGGTLAGT
FT                   ITLTGGCGGMGGAQPLAVTLNDGVCLVVDVDRTRLERRVGKRYLHEIAEDLDDAIARAN
FT                   QAKEERRGLSVGIVGNAAEVFPALLERHKAGDLQVDVVTDQTSAHDPLSYLPVGVDVAD
FT                   WQAEAERDPVEFTRRAQESMAAHVKAMVEFQDAGAEVFDYGNSIRDEARKGGYERAFEF
FT                   PGFVPAYIRPLFCEGLGPFRWVALSGDPEDIKVTDAALKELFPENEHLHRWLDAADEFV
FT                   EFEGLPARICWLGYGERHKAGMLFNQLVREGKVSAPIVIGRDHLDSGSVASPYRETEAM
FT                   KDGTDAVADWPLLNALTSASSGASWTSIHHGGGVGIGRSIHAGQVGLADGTDLAEQKLE
FT                   RLLTNDPGLGVLRHVDAGYDRAIEVADERGVRVPMMDAARRKAASYTDEVAEG"
FT   gene            complement(420903..421568)
FT                   /locus_tag="Ksed_04290"
FT   CDS_pept        complement(420903..421568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05503"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL7"
FT                   /protein_id="ACV05503.1"
FT                   /translation="MRTRTEPHFFLQDKYMGNGLVYRNGHLETTDRRTLKGDLTNANGL
FT                   HELGIPLDIIGTVVHNSFKDTIEALGATGVRFHELPPPSEKMQALKPGAWWALEITGTS
FT                   PTYSDTFHDEHVRTVKLPAVWTLESYCTDPAPDGWDGSDFYHPGDTGYKYVTQRVAHAL
FT                   TAAGIDVLLEEVGRHPHPVWDTEECDNQAEAWRHRMGVDFADWPDPGCCPDLLRPTTT"
FT   gene            complement(421593..422174)
FT                   /locus_tag="Ksed_04300"
FT   CDS_pept        complement(421593..422174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05504"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL8"
FT                   /protein_id="ACV05504.1"
FT                   /translation="MKTMSRSTLPSVLMAVLIGGGLLAGCGDEGTGNNKSPSNSAEVSS
FT                   PSGQPPSSTSSQQSSTSTEHACWPATEGQDLCGTLTSIEGKTGDGKTVDLKDALEVSVT
FT                   PGLVEDGYSMVASADGCQLWTTPLTGDVEKWVPHPDRRTDSAMGCDTPPNQPDWMIRVL
FT                   DEPFRVKVTDAGVIFQGKKDRITFATPAKK"
FT   gene            complement(422171..422896)
FT                   /locus_tag="Ksed_04310"
FT   CDS_pept        complement(422171..422896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05505"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKL9"
FT                   /protein_id="ACV05505.1"
FT                   /translation="MSTFLLFKKFFLWGAPALAVAAAPTASTLPAGGVADSPATVTTVT
FT                   PHSTDEAGPLEAQHRLATFKTWIIEHPEFAAAGYMEQINWANESRVTALWDADRWADST
FT                   TVREELTQEALRHSIELDFQQRTHGLNDLREISGEILDQTESLSLIGFDLEAVSTLRVD
FT                   NGPVELIGSFVEPAPAAQRGDLASLAGANGAQSVEDVERIVREAVGVEVKVVEGGATPA
FT                   RSRAADTIGRSFNATLVTS"
FT   gene            423180..426149
FT                   /locus_tag="Ksed_04320"
FT   CDS_pept        423180..426149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04320"
FT                   /product="FAD/FMN-dependent dehydrogenase"
FT                   /note="PFAM: FAD linked oxidases, C-terminal domain; FAD
FT                   binding domain; Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05506"
FT                   /db_xref="GOA:C7NKM0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM0"
FT                   /protein_id="ACV05506.1"
FT                   /translation="MAARSTGAVDRLSQHLRAAGLTDVRDDPGTLGTHSSDASLYRVPP
FT                   RVVVMPHDAEEVARALQVARAEGVPVTSRGAGTSIAGNAIGPGIVLDFSRHMNQVLAVD
FT                   PEARTATVQPGVVQARLQDAARPHGLLFGPDPSTSTRCTIGGMIGNNACGTKSLAYGRT
FT                   SDNTLAVAGYLADGTELRTGPRAGHAPTEELRDRLRRLAARDLATLRTEFARFGRQASG
FT                   YALEHLLPENGTDDGTDLARLLVGSEGTLAVLTQATVRLVGKPAHARLVVLGFATQYDA
FT                   ADAVPALLEHAPTACEGLDARLVDVLRDRRGPDAVPPLPRGAAWLFVELSGETTAEVQA
FT                   AAERLVRAAPSDLQALDARAVPDPAEATALWRIRSDGAGLAGRSAANEPAHAGWEDAAV
FT                   PPDQLGGYLRRFDALLDHHGLTAAPYGHFGEGCMHVRLDLPLEAADGVARSRAFLEDAA
FT                   RLVAEFGGSMSGEHGDGRARSELLPYMYSPAALRLFRAVKHTFDPTGLLNPGVLVDPEP
FT                   LDANLRITGVRHDLPLPAFMYPEDDGRFSRAVHRCTGVGKCVADGVLDKTPTVMCPSYL
FT                   ATREETHSTRGRARLLQEVVNGNSPLDFDSPEVHESLDLCLSCKGCASDCPTGVDMATY
FT                   KSEVLHQTYRGRLRPITHYSLGWLPRWVALASRVPGLANRMMRLARVVPALVRVAGIDP
FT                   RRGLPTFAPRTFRREVGSVPRDAESVPRGDASPGATPGRGRAGSGGGAPASGRVVLFVD
FT                   TFSNAFTPEAARATVTVLEAAGYGVELVPRQSCCGLTWITTGQLDAARRMVATTVEQLL
FT                   PFARAGVPIIGIEPSCTGVLRKDAPELLGTPEAELVAEHTLTLAELLARTDWTPPGLDG
FT                   LRVLAQPHCHHHAVMGWGADQRLLERAGAKVEALAGCCGLAGNFGVEQGHYEVSVAVAE
FT                   QHLLPALRRGEHDVVLTDGFSCRLQASDLGGAQGQHLAELLASRIDPTDRTTTPDQEDA
FT                   "
FT   gene            426146..427132
FT                   /locus_tag="Ksed_04330"
FT   CDS_pept        426146..427132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04330"
FT                   /product="predicted ornithine cyclodeaminase,
FT                   mu-crystallin"
FT                   /note="PFAM: Shikimate / quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05507"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM1"
FT                   /protein_id="ACV05507.1"
FT                   /translation="MTTELLVLTAAEIEGLLDLDAVFASQVRAFEGLGSGRAELAPKVS
FT                   VPGREGASLLTYTARSTTEAPGVVKVIGFQPQNPANGLDPVQGVVLVVDPDTGQPVALL
FT                   DGPALTTPRTAAGSAVAMDLLARADAAVLTIVGTGVQARAHLRALSRVRELERIHLIGR
FT                   RAEAAEELAAELADELGVPIVPGTDLPAVAGESDVIALCTTSHTPLLDAGNVRPGALVI
FT                   SVGSFAPDRSEVGADLLGRAELLVVDEVATASAQAGCIIDAVAAGVLAESALVPLGSIA
FT                   TGAHPGRASDEDVVFYNSVGIAVQDATIAEEVLDRARAAGVGTTVTL"
FT   gene            complement(427153..428313)
FT                   /locus_tag="Ksed_04340"
FT   CDS_pept        complement(427153..428313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04340"
FT                   /product="glycine/D-amino acid oxidase, deaminating"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05508"
FT                   /db_xref="GOA:C7NKM2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM2"
FT                   /protein_id="ACV05508.1"
FT                   /translation="MSDQNFPTRARVVVIGGGVMGLSTAYHLAKQGVQDVVLVERGELG
FT                   AGSTCKAAGGVRAQFSDAVNIELGMRSLEVFRNFPELFDQDIDLDECGYLFLLEREEDL
FT                   RTFERNVELQRSMGLESRITSVEEAKELSPLISTEGLIAGVWSPEAGHCTPESVVQGYA
FT                   RAARALGVRIIRHCEVTDVVREGDTITSVETAQGSIATDTVVCCAGAWSRALGDMVGVD
FT                   LPVDPVRRELLVTEPMPDLPANVPFTIDFSTTMYFHREGPGLLVGMSNQDEEPGFSLEH
FT                   TDEWLEQVVEAAGRRVPVLEEVGMASRWAGLYEVTPDHNALIGEAEGVSRFLYATGFSG
FT                   HGFLQGPAVGQVMAELYLGQTPSVDVTALHGRRFEGAGLRPEFNIV"
FT   gene            complement(428381..429922)
FT                   /locus_tag="Ksed_04350"
FT   CDS_pept        complement(428381..429922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04350"
FT                   /product="amino acid carrier protein"
FT                   /note="PFAM: Sodium:alanine symporter family; TIGRFAM:
FT                   amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05509"
FT                   /db_xref="GOA:C7NKM3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM3"
FT                   /protein_id="ACV05509.1"
FT                   /translation="MLTQAEKSGIDGAIESWFGPVVEWLSGIVFATFPLGSAEMPFLIV
FT                   WLLLGGFVLSALIGPQIVYGMRQVPGIVKGRFNRRTDPGEITSYQALATELSGTVGLGN
FT                   VAGVAVAITVGGPGATLWIILAGFLGMSIKAAEATLGAKYRRINDDGTVSGGPMYYLQH
FT                   GLAERGMRPLGVFLAGFYAFAMMIGALGAGNIFQANQVAVQLTNLTGGEESILAGRGWM
FT                   IGLALAVLAAVVIFGGIRSIARWTSRLTPIMAILYVLCVLVILGANVGSLPSAVGAIFD
FT                   GAFTGEGVQGGVVGVAIIGVQRALFSNAAGVGSAAIAHSPVRTRRPAQEGLVASLEPFI
FT                   DSVVICTMTALAIVVTGLHTSSSADGVALTSEAFGTVHALFPWLLTAIVLLLAFSTLLS
FT                   YSYYGKKSAGYLFGNSRAVELSYDALWIVMIVVGAAVSLDTVVGFSDAMFFLVTLPNFI
FT                   GLYLLSGVLRRELSKHTRDYANGDVPEVPEAERSQPNQGSTVVPGRATATNTPAR"
FT   gene            complement(429922..431067)
FT                   /locus_tag="Ksed_04360"
FT   CDS_pept        complement(429922..431067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04360"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   domain; Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05510"
FT                   /db_xref="GOA:C7NKM4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM4"
FT                   /protein_id="ACV05510.1"
FT                   /translation="MFELMDEWGPEKVVTVNHQRSGMQGVLVIDNTSRGPGKGGTRMRA
FT                   DLTVAEVASLARVMTWKWAAVDLYQGGAKAGIRFDPTSPRKEEALRAFARMLRNEVPSE
FT                   YVFGLDMGLNEADAAILCDELGDRGAATGTPAALGGVAYDALGITGHGVAEAVDASVAH
FT                   CGIDDDRVVVQGFGAVGHATVRRLSELGYRIVAVSTAVGAVHDPDGLDVTELLLLREAH
FT                   GDALVDHASGQRLAAGRELTLDAGILVPAAQQGVLDATNAGDVRARLVVEGANLPTDAA
FT                   AQELLAARGVTLVPDFIANAGGIIAAAFGMRDRYSPFGVATDQIVPTVTERMRANTLTV
FT                   LEAATTTDTTPHAAAGQLARDRVRQAMELRGQVPPTRQEIR"
FT   gene            complement(431096..432604)
FT                   /locus_tag="Ksed_04370"
FT   CDS_pept        complement(431096..432604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04370"
FT                   /product="delta-1-piperideine-6-carboxylate dehydrogenase"
FT                   /note="PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05511"
FT                   /db_xref="GOA:C7NKM5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM5"
FT                   /protein_id="ACV05511.1"
FT                   /translation="MTHPIHDQVRSALEACGVTVPEGADLHARTPITGEQLMGLRATTD
FT                   AEYETALTTAGEAFTAWRDTPAPVRGNLVKRWGELLTEYKDDLAALVTAEAGKIPSEAA
FT                   GEVQEMIDICDLAVGLSRQLFGRTMPSERPGHRMMETWHPLGPCGIITAFNFPVAPYAW
FT                   NTAVALVCGNTIVWKPSEATMLSALATDALLGRAAKDVGAPEGLHHVVIGDRTLGEKMS
FT                   DDERLPLISATGSTRMGSEVGPRVAARFGRTVLELGGNNAAIVAPSADLDLALRGVAFA
FT                   AVGTAGQRCTTMRRLIIHEDIAEEFTERLVQAYGTLTIGDPSTGESLVGPLVHGGAYEG
FT                   MTAALAAATADGGELLCGGERVHAEEYPEAYYVQPAIVRMPGQTEIVRTETFAPILYVM
FT                   TYRELDEAIAMHNDVPQGLSSAIFTTDVREAERFVSDAGSDCGIANVNIGTSGAEIGGA
FT                   FGGEKHTGGGRESGSDAWRAYMRRATNTVNYSNELPLAQGVEFL"
FT   gene            complement(432682..434061)
FT                   /locus_tag="Ksed_04380"
FT   CDS_pept        complement(432682..434061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04380"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF1338);
FT                   TIGRFAM: phage virion morphogenesis (putative tail
FT                   completion) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05512"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM6"
FT                   /protein_id="ACV05512.1"
FT                   /translation="MSVAQHELRAAFAAHMSRMYGQEVPAYTTLVEVSESVNRDHLEQL
FT                   GDAAERLGSIERVTAERHGAIRVGTPEELGHVARVFAAFGMEPVGFYDLRDSASAVPVV
FT                   STAFRPIDRDELARNPFRVFTSMLVAEDPRFFDADLRRDLADFLAARRLFDDELLELAD
FT                   RAARDKGLPKAEADELVARATAVFELSAEPVDEAWYRRLEEVSSVAADIGGVPTTHINH
FT                   LTPRVLDIEELYRRMEARGIEMIDEIQGPPSWEGPDVLLRQTSFRALDEQRTFRKPDGT
FT                   LGEGTLRVRFGEVEQRGIALTEKGREIYDAMLAEVDEILQRDGGDRPTVARTVWAEHLP
FT                   VDELGLAERELAYFTYELAAGVSELPTGQRACELVASGHLVATPVVYEDFLPRSAAGIF
FT                   QSNLTSAGSKDEAQSGVDFDMSRLAEICGVRIHDPYALYAAEQQDSLDAVERATGVAVR
FT                   P"
FT   gene            434241..435107
FT                   /locus_tag="Ksed_04390"
FT   CDS_pept        434241..435107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04390"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix protein,
FT                   lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05513"
FT                   /db_xref="GOA:C7NKM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM7"
FT                   /protein_id="ACV05513.1"
FT                   /translation="MSWTLTQLETFCAVADAGSMHAASVERGYTPGAVSQQMAALARTV
FT                   GAELFIRDGRGVVLSDAGRGFLPYARRLLQEDAAARRALAELHSGRATVRVGIFETAGS
FT                   VACRPALRRAAAAQPPVDLVFEEVDVEHGVDAVRSGVVDIALSVHYELVPVQLPPGVVA
FT                   VELHAEPFVEARSAEPGGASTWIAPPTSESFGLAVKAALGRAGEDQDVAHVVTDTALMV
FT                   ALVEAGVGRALVNPLMLRVHPRELDVRPAPQSGSRSIVALTTEAQGRRASVQTALGALE
FT                   DVFAEIH"
FT   gene            435218..436243
FT                   /locus_tag="Ksed_04400"
FT   CDS_pept        435218..436243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04400"
FT                   /product="glutamate dehydrogenase/leucine dehydrogenase"
FT                   /note="PFAM: Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase; Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05514"
FT                   /db_xref="GOA:C7NKM8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM8"
FT                   /protein_id="ACV05514.1"
FT                   /translation="MSTQEFGEYTVSTYRFTDQHTLTVAHETRASRELPGNGGTRWLQY
FT                   GSTEQAEAEALVLAQCMTRKHALYDTGFCGTKLVIDGPVDLADRSVVHDAIADVLRRHD
FT                   GALYTGCDLNTTSADMREVAARYNCVLDSLGNPAVDTSTSTGSGVFAAMMTTVQPGERP
FT                   SVAVHGLGKVGGQVARLARNAGFEVSGFDVRREAVENVGATYVTEGQLFGGGHDIVVLC
FT                   SLSGVLTEELAQSLQARWIVASANSPFRTPEAQRIVEERGIHYLPDYIANSGAVLCDAL
FT                   EWRDPDFYAGLDQATIDGYVMRTIQSRALGVLAEAVLREVTPETVASRVWSENIRPVVP
FT                   A"
FT   gene            complement(436295..437176)
FT                   /locus_tag="Ksed_04410"
FT   CDS_pept        complement(436295..437176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04410"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Putative peptidoglycan binding domain; Family
FT                   of unknown function (DUF1028)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05515"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR014927"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKM9"
FT                   /protein_id="ACV05515.1"
FT                   /translation="MTDHTVDMTFSVVARSGETFGVAVASKFPAVGALVPAARVGVGAA
FT                   ATQAMARVAYRDELLDLVADGVTPAEAVARATARDTAASHRQLGVVSATGQATFTGADC
FT                   IPWCGGRSGGDADSGYAIQGNILASEEVVADMEAAWHAHAELPLPRRLVRVLLAGDAAG
FT                   GDSRGRQGAALYVVRAGGGYDAYGVVADLRVDDHPQAPTELARLMEVDELVTGVPAEVL
FT                   PLAGDAAAEARAHEVAAGLGRWGVAVDGGGLEALHDALERWAAVENLEMRMTREGIDPR
FT                   VLQHLGAGPAQG"
FT   gene            437301..438437
FT                   /locus_tag="Ksed_04420"
FT   CDS_pept        437301..438437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05516"
FT                   /db_xref="GOA:C7NKN0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN0"
FT                   /protein_id="ACV05516.1"
FT                   /translation="MTPDDPPELSVLLIADPGLPTRRAHAVRDRLEQELADTYKQDVSV
FT                   QVQSDLLRVDQAHALDLETAAELSTRHGTVDVLLLLTEMPRYVDGRPLVAGAFPGYGVG
FT                   VLSLPTLGMRMGTQRLLRVLTACAVRIAQVPGGESEEVRYPPHLGGARWSRRDDGSYAL
FT                   TFNRWTGATRMVMGMVLSNEPWRVVPRLSSAFAAAMATGAFGVFYSSIWQMSDALSVFR
FT                   LALTAVVAVIMMVLWLVLRHRLWDSPRGGRPPGLVLLYNLSTGVTLTLAVVALYALLVL
FT                   VILAASLIVIAPGFMGDVLGYPADFANYLKIAWFAAAMGVVAGALGTSFDDETAVRSLT
FT                   HGQRERQRLAALEEAGDDAHRGAHPATPPEDDGERPAT"
FT   gene            438451..439701
FT                   /locus_tag="Ksed_04430"
FT   CDS_pept        438451..439701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04430"
FT                   /product="imidazolonepropionase"
FT                   /note="PFAM: Amidohydrolase family; Amidohydrolase family;
FT                   TIGRFAM: imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05517"
FT                   /db_xref="GOA:C7NKN1"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN1"
FT                   /protein_id="ACV05517.1"
FT                   /translation="MAMLITDIAELVTHDPMHPDSLDAVGGATGADALHAGLGLIRDAA
FT                   MVVGSKAPDEPSTIQWIGRAADAPQADWAVSVEGSAVIPGFVDSHSHLWFAGDRSAEFA
FT                   ARMAGQAYDGGGIATTIEATRAARPVDIAGLVRTRIAEMRAQGTTTVEVKTGYGLDVAT
FT                   EAEAARRLREVTDEVTFLGAHVVPPEYRDGPAGTRGDYVELVCGEMLRAVAPHVRWVDV
FT                   FCEPNSPYAFTGEESRRVLEAGRDAGLALRVHGNQLGEGPGAQLAVELGAAAVDHCTYL
FT                   SEADVEALAGSWADGGQGTVAGLLPGVEFSTKHPYPDARRLIDAGAVVALASDCNPGTC
FT                   YSSSMPFMIAMAVREMGMTPAEALQAATVGGARSLRRDDVGVLRVGARADLARVDGPSW
FT                   LHIPYRPGVPVVRALEV"
FT   gene            439704..439949
FT                   /locus_tag="Ksed_04440"
FT   CDS_pept        439704..439949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05518"
FT                   /db_xref="GOA:C7NKN2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN2"
FT                   /protein_id="ACV05518.1"
FT                   /translation="MARSASVWRLPWTPVTGSWLKNMADVMGHAPVGSDPLSGFFAFLL
FT                   FIPLLVVFVFWLVEIAVELVLWPFFLLVRAFARGVT"
FT   gene            complement(440022..440189)
FT                   /pseudo
FT                   /locus_tag="Ksed_04450"
FT   gene            440246..440641
FT                   /locus_tag="Ksed_04460"
FT   CDS_pept        440246..440641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05519"
FT                   /db_xref="GOA:C7NKN3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN3"
FT                   /protein_id="ACV05519.1"
FT                   /translation="MTTVASAIIVLAILAIIVQAVLFAVRHNGTERALIIGSLGTWPLL
FT                   VIWAEAALVMLIVRSFSNDRSLWDLATDGGAWVSALGIGFALSAGCLVAVRWLRTVSDG
FT                   EPTWNVPGSSLLAIITAAVVGLSDLPL"
FT   gene            440747..441946
FT                   /locus_tag="Ksed_04470"
FT   CDS_pept        440747..441946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04470"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Peptidase family M20/M25/M40; TIGRFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05520"
FT                   /db_xref="GOA:C7NKN4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN4"
FT                   /protein_id="ACV05520.1"
FT                   /translation="MAALPLADLAALREAWLSHLTAELTVARAVREEVHADPRLSGDEE
FT                   STADLVADALEIPMQRIAGTGRIGRIGPQTGPAVMLRAEMDALPIEEATGAPFASTNGA
FT                   MHACGHDVHMAALVAVVRAARGLDLPVGLVPLLQPREESAPHGGFDVVSSGLLDDHQVG
FT                   VSVGAHVHADVPLGSVATGAGVVNAAADSFRLSFEGAGGHGAYPHHGNDVMAATATTAL
FT                   GLQDVVRKTVDPMHPVTLTVGHLSAGPPADNVLPETGLILGTLRTVNAEDRQRVQDAVR
FT                   LHATRTAEAFGVTCEVVHTRGMPVLANDEALVGFTDRWLLESGIRAAEPMRSMGADDFS
FT                   FYTDRMPGLMAFVGTRREGEAGTVGLHDARFLPPAEVVGTMARVMVSGYLAGAQLLSDG
FT                   "
FT   gene            complement(441978..443246)
FT                   /locus_tag="Ksed_04480"
FT   CDS_pept        complement(441978..443246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04480"
FT                   /product="cell wall-associated hydrolase,
FT                   invasion-associated protein"
FT                   /note="PFAM: Putative peptidoglycan binding domain;
FT                   Predicted Peptidoglycan domain; NlpC/P60 family; Bacterial
FT                   SH3 domain; TIGRFAM: Tat (twin-arginine translocation)
FT                   pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05521"
FT                   /db_xref="GOA:C7NKN5"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN5"
FT                   /protein_id="ACV05521.1"
FT                   /translation="MEQITRRTLLVGTGVLAAAGAAGLATPAQAWDISRLGPYPLRPGH
FT                   RGGYVQRLQWALNKVGNVTPKVALDGVYGAITTRAVRAFQTRQGLLVDGIAGTGTKRRL
FT                   DALLDAYYDGGGNSGTRYRSRGVNLRSGPGMSHAVVGWLAAGEVVSGTRLSSGWVKVGS
FT                   RGYAWHTYLVPLSGGGDDPTPGYLTPVTSIPSPGSGQPIKLGWTGTRVKLVLRRLGIDQ
FT                   GQLLHRMTPAAVDAVKRFQRAHGLTADGVVGPRTWAAMGFARSTYYIDGWVQQPKLGLS
FT                   ATRAQRVEQMIAFARAQQGADYTWGGAGPYRYGYDCSGLVLQSMYSAGVHPSPITVRLH
FT                   ASPGHRTSRALYNHDKLPRFAFSQRRRGDLIWYTNSSGWIQHVAIYLGNGYVVDSMYSV
FT                   KVRRDSSRLHGFHRKGTVSRVFG"
FT   gene            443364..444773
FT                   /locus_tag="Ksed_04490"
FT   CDS_pept        443364..444773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04490"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05522"
FT                   /db_xref="GOA:C7NKN6"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN6"
FT                   /protein_id="ACV05522.1"
FT                   /translation="MMPESTRARAEDLELLKWAYTLTDAARRHPVMGDAAMAIVIVTVF
FT                   TLATAWTLPWWALLWSGAYVLAYVLRTVSLPLMLGALTALGVAQVAFTEIVVAGNFLIP
FT                   LAVYQAAANGRRRTRLAALALLLGASVLAAVDFAPTAVAAVAMVFIYSTGLLVPWVLGD
FT                   LVRHRRGVLARESAQKAAIARDREQRAQIAVRSERAAIAREMHDIIAHSLSVVIVQADG
FT                   GRYAARAGTTAADHGLEGEDLQRAQEGALKGAQDALEQIATTAREALGETRRLVGVLRD
FT                   PGKGAEYTPGQGLGDLPALLSRLEDSHLPVQAILDPGLAEAMGMAHEDGVPQVQVNPSL
FT                   SAAAYRVVQEATTNVIKHAGPITVLRIRVRLEGGYLSVSVADDGAGPTSRQAAGGHGIL
FT                   GMHERVAALDGELLTGMRSGGGFLVRARFPLAAGDPRRRRSRQTEATTPGPPPRRGPGG
FT                   PASTHQPLEIP"
FT   gene            444770..445504
FT                   /locus_tag="Ksed_04500"
FT   CDS_pept        444770..445504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04500"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05523"
FT                   /db_xref="GOA:C7NKN7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN7"
FT                   /protein_id="ACV05523.1"
FT                   /translation="MTSRIFLVDDQSLVRAGFRMVLDAQPDMSVVGEAPDGQSAVDQLK
FT                   TIAADVVLMDIRMPRLDGIEATRVLLGRDKHPGGAEPKVVVLTTFDMDEYAYAALEAGA
FT                   SGFLLKDAGPEELLAAIRAVASGDAVVAPSTTKRLLERFVPTLTPEVADVASPAEQQEY
FT                   LREVLTEREYEVFEAVAAGLSNTEIAKELFVAEATIKTHIGRLLFKLGCRDRVQLVITA
FT                   YEAGIAGAAGGQRPSGGGASRA"
FT   gene            445577..445789
FT                   /locus_tag="Ksed_04510"
FT   CDS_pept        445577..445789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05524"
FT                   /db_xref="GOA:C7NKN8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN8"
FT                   /protein_id="ACV05524.1"
FT                   /translation="MQSVLSWIISIVLAVLVFTGLRYALIEFFTMDPDIARWVSLVLGL
FT                   IILIPGRQALRGMLRGSGTSEDARR"
FT   gene            complement(445985..447604)
FT                   /locus_tag="Ksed_04520"
FT   CDS_pept        complement(445985..447604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04520"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase component"
FT                   /note="PFAM: 2-oxoacid dehydrogenases acyltransferase
FT                   (catalytic domain); Biotin-requiring enzyme; e3 binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05525"
FT                   /db_xref="GOA:C7NKN9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKN9"
FT                   /protein_id="ACV05525.1"
FT                   /translation="MSENQQVFMLPDLGEGLTEAEVVEWLVAEGDEVVIDQNVVTVETA
FT                   KATVEVPIPFAGTVSVLHGQVGDVMEVGRPLISVGGASGGAAGSGAASGADGGASGTQG
FT                   ADADPGHSASDPRAEHEQYRREERAGAEVPQGDGETTDEGSGAVLIGFGTGHGGGSRRR
FT                   RTPRGAARSTGAPAGTPQGTSDSAPSRSPEATSPQAGASATTAHGTGQPTIAPRVISPL
FT                   VRRLAAERGVDLASLTPSQSDGVIRRADVEAASPSTPGAGESSQQGADSPETGTSRAHT
FT                   ATGAGTGAGTGAGASGTSVAEQPQLTDERIPLTGLMRMMSERLTTSRSEIPDATTWVDV
FT                   DATELLRTKDALKAARPDAGIGVLPLMARIVVAGLTRFPALNAGIEMQDGTAVAIQRHA
FT                   RVNLGFAAQSPRGLVVPVVHDAQDLSTAELALALRELTALARDGRLTPAQLTGGTFTLN
FT                   NYGVFGVDGSTPIINHPEAAMLGVGRIIDRPWAVDGKVKVRKVTQLGLTFDHRVCDGGT
FT                   AGGLLRFVADCVENPAVLLSEL"
FT   gene            complement(447601..448635)
FT                   /locus_tag="Ksed_04530"
FT   CDS_pept        complement(447601..448635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04530"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit"
FT                   /note="PFAM: Transketolase, pyrimidine binding domain;
FT                   Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05526"
FT                   /db_xref="GOA:C7NKP0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP0"
FT                   /protein_id="ACV05526.1"
FT                   /translation="MSVTMAQALNQALRDAMTADEKVLVFGEDVGTLGGVFRITDGLTG
FT                   DFGEDRCFDTPLAEAGIMGFAIGLAMEGFRPVVEMQFDAFGYPAFEQVVSHVAKMRNRT
FT                   RGSVSLPMVIRVPYAGGIGGVEHHCDSSEGYYAHTPGLKVVAPATPADAYSLLREAIAE
FT                   DDPVVFMEPKVSYWAKEEVELPVQREPFGTAAVRRQGSDVTLVTYGPQLKTCLQAAEAA
FT                   SELGYDVEVVDLRTIVPFDDAGVVESVRRTGRCVVVSEAQGFAGVAAEVAARVQERCFH
FT                   SLAAPVLRVTGFDIPFPPPKLEHTQLPSVDRVLDAIERLQWDDQPDLTHAGPTAGAATT
FT                   GGAR"
FT   gene            complement(448632..449747)
FT                   /locus_tag="Ksed_04540"
FT   CDS_pept        complement(448632..449747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04540"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component alpha subunit"
FT                   /note="PFAM: Dehydrogenase E1 component; TIGRFAM: pyruvate
FT                   dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05527"
FT                   /db_xref="GOA:C7NKP1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP1"
FT                   /protein_id="ACV05527.1"
FT                   /translation="MPSPQDLLPSEEPVQFIAPGGELTASDHPRGYTLPEPGRLLALYR
FT                   GMVLGRRFDKQATALTKQGRLAVYPSSYGQDACQVATVQALREDDWFFPTYRDSMALVT
FT                   RGIDPVQVLTLLKGDWHAGYDVAATRTAPQCTPLATQLIHAAGAGAGAARKGSDAAVLA
FT                   FIGDGATSEGDFHEGLNFAAVFNAPVVFVVQNNTYAISVPLSKQTKAPSLAYKGIGYGI
FT                   PSEQVDGNDAAAVAAVMDSALARARSGGGPTLVELHTYRLDAHTNADDATRYRASDEVE
FT                   GWLTKDPIVRLEQYLLATGALDEARIEEIRAEGEEQSAALRDRMNADVEHQPLDLFDHV
FT                   FTNPTAQLTEQRAQVAAEMAASAENDQEAAR"
FT   gene            449945..450817
FT                   /locus_tag="Ksed_04550"
FT   CDS_pept        449945..450817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04550"
FT                   /product="lysophospholipase"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05528"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP2"
FT                   /protein_id="ACV05528.1"
FT                   /translation="MPRRTSLIALAGTAAMGVTAGALAGARKISGPQRPPLDYAFTPFE
FT                   VQVPSEDVTLTASDGTRLAGWWLDQPASERVAVVCHGHRGSKADMLGIGPGLWREGWSV
FT                   LLFDFRGNGESADGPQSLAHYEQRDLEVALDHVAARRPEAEVDLIGFSMGAAVVLQVAA
FT                   RDPRVRRVVADSSFADMRGVIAAAARGMRLPPVPMVQLVDQATRLRYGYRFAEVQPVEV
FT                   VADIAPRPLLLLHGDQDSVIPVEHAHRLAAVAGEGSRLDVVAGVDHCGAYFADRPGYIA
FT                   RVADFLRSA"
FT   gene            complement(450985..451335)
FT                   /locus_tag="Ksed_04560"
FT   CDS_pept        complement(450985..451335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05529"
FT                   /db_xref="GOA:C7NKP3"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP3"
FT                   /protein_id="ACV05529.1"
FT                   /translation="MNLAYKALATVLPIVASVVARKISDGTWKFTTGKSAQNPDDPEVG
FT                   FKEAAAFAILSGAVVGVMRMLANRQASHVYMKQNGKLPPDLQKKLGLTDEQAREKAQAK
FT                   LKAEQDKKAAKR"
FT   misc_binding    451553..451658
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            451662..452840
FT                   /locus_tag="Ksed_04580"
FT   CDS_pept        451662..452840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04580"
FT                   /product="ABC transporter periplasmic binding protein, thiB
FT                   subfamily"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: ABC transporter periplasmic binding
FT                   protein, thiB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05530"
FT                   /db_xref="GOA:C7NKP4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP4"
FT                   /protein_id="ACV05530.1"
FT                   /translation="MRHAAQTTRPLAITVAVTASLALAGCSLSTDDAAEETGGTTEASD
FT                   STDQSSTDQASGTAASSGGASAEGEDLHGRTVQLVTHDSFNPPEGVLEEFTQRTGITVK
FT                   VQKSGDAGSLTNKLVLTKDNPIGDAVFGIDNTFGGRALTEGVVAEHGLDLPQGVADHAM
FT                   EADAGARLAPVDAGDVCVNIDDTWFEKKGINPPATLDDLTKPEYKGLFVTPGASTSSPG
FT                   LAFLLATIGAKGDDGWEQYWKDLVANDVKVTAGWEDAYTVDFTAGGGNGDRPIVLSYAS
FT                   SPPITVPEGGDEPTTSALLDTCFRQVEYAGVLEGADEPEAAAKVVEFLLGEEFQAGLPD
FT                   SMYVYPVRQGVELPEAWEQWAPPAKEPIEVDAARIQENREDWLMRWSEAAGQ"
FT   gene            452891..454546
FT                   /locus_tag="Ksed_04590"
FT   CDS_pept        452891..454546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04590"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05531"
FT                   /db_xref="GOA:C7NKP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP5"
FT                   /protein_id="ACV05531.1"
FT                   /translation="MRSRGSAWVPLVWALLPLVFFAVFFAWPVGSMVGRGLFPGGSPDL
FT                   SALPEVLGRGRTLRVLGFTVGMALAGTVVTLLLGLPTAFVLYRLAFPMRGLARSWVVMP
FT                   FVLPTVVVGVMFRSLLAPGGPLGFLGWDGTPWAIGAAFVFFNLAVVVRTVGGVWAGLDR
FT                   RPEEAAASLGAAPWQVLRDITLPRLMPAITSAAVVVFLFCSTAFGVVLTLGGLRHRTIE
FT                   TEIYLLTTQYLDLRAAAVLSVLQVLVVGLLVWVAGRLRGSARATGASSRPRPMRRGDLP
FT                   AVVVALGVLAFITAPVVALVVRSLQVPTVDGARWSLRNYRALASPEAAADAALQVTVLE
FT                   ALEQSWRTAVDATVVALVLGALVAIALTRPGRTPGAARTVRTLDLLFMLPLGVSAVTVG
FT                   FGFLIALDTPPLDLRGSPLLVPLAQALVATPLVVRTLVPALGGVDDRQRQAAASLGAPP
FT                   WRQFLTIDARLAARPAAAAAGFALAVSLGEFGATSFLARPDTPTVPVVIAELIGRPGAE
FT                   TFGMALAASVLLAAVTVAVMAVVDRLAPTTGGSW"
FT   gene            454543..455328
FT                   /locus_tag="Ksed_04600"
FT   CDS_pept        454543..455328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04600"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.25"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05532"
FT                   /db_xref="GOA:C7NKP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP6"
FT                   /protein_id="ACV05532.1"
FT                   /translation="MTERPTPTERSTPTQRPAGQQGARPASASPHAPSADAGLEVRGAT
FT                   VDFRLRRGTLRALDAVELTVPTGTLTAVLGPSGCGKSTLLRAVAGLETLTEGEIRFGDR
FT                   EVTDVPPHRRGFALVFQDGQLFDHLSVEQNVAYALRLRGVPRAKRRARTAELLEMVGLP
FT                   GTERRDPRTLSGGQRQRVALARGLAAAPRLLLLDEPLSALDRDLRTQLGADLRRIIDET
FT                   RTTAMLVTHDHEEARLADAVVRMEAGRVVGRERSDEVGR"
FT   gene            455437..456159
FT                   /locus_tag="Ksed_04610"
FT   CDS_pept        455437..456159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04610"
FT                   /product="ANTAR/GAF domain-containing protein"
FT                   /note="PFAM: GAF domain; ANTAR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05533"
FT                   /db_xref="GOA:C7NKP7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP7"
FT                   /protein_id="ACV05533.1"
FT                   /translation="MPCDLPADDVAVRLARSARRFGSADSVEELARLICEVAGDLVEVA
FT                   DDVSVSLLERGGRITTVAATDDVCFAVDRFQEEYEEGPCVSAVREASVTHLEDTSADPE
FT                   WPAFSAWAAEHGVGSMMAIQLATYEGDEIDPTSGGEGQGALNFYAREPHAFGEDAERTA
FT                   RLLGVHASVALSARQYMSQMGEAVASRDLIGQAKGILMVRLGIDDQAAFGVLRDRSRNT
FT                   NVRLVEVARAVVEGRTVA"
FT   gene            complement(456236..457702)
FT                   /locus_tag="Ksed_04620"
FT   CDS_pept        complement(456236..457702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04620"
FT                   /product="amino acid transporter"
FT                   /note="PFAM: Amino acid permease; TIGRFAM:
FT                   arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05534"
FT                   /db_xref="GOA:C7NKP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP8"
FT                   /protein_id="ACV05534.1"
FT                   /translation="MSSTLAETTDRPAPDDDGQGRKGLLGVPQLTALVVGSMVGAGIFA
FT                   LPMNMAQAAAPGPLLIGWGITGVGMLALALTFTLLARLAPNPDGGVYGYARDGFGRFLG
FT                   FSSAWGYWISAWLGNLSYLVVIFSTLGLWFPIFGEGTTWVSIACASVLLWAYTWLLMRG
FT                   VREAASLNLVVTLAKIVPIVAFVVLTAIAFDYGVFTADFWGRQTTGAPIMEQVRGMMLV
FT                   TVWVFLGIEGATVYSERAKDRASIGRATVIGFVGVLALLVAVNLLSAGIMSQAELAELQ
FT                   DPSMAGVLREAVGPWGAVLIGVGMIVSVAGALLAWMLLCAEILSVTARDGSMPKVLATE
FT                   NRHGTPTWSVLLTSIVLQLALVYAAFAGSSYYDIILMAGSMILLPYLLSAGYGVVLAVR
FT                   NRSLGKAGIGSIVLTLVATVYGLWLIYAGGLGYLLMTALFYAPGVLVYLWAQRERGEHA
FT                   MKAWEWLVWAVMAAGFVAAVVGFATGSLTL"
FT   gene            457871..458521
FT                   /locus_tag="Ksed_04630"
FT   CDS_pept        457871..458521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04630"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05535"
FT                   /db_xref="GOA:C7NKP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKP9"
FT                   /protein_id="ACV05535.1"
FT                   /translation="MSLREAHKDRTRASLVDAAFGVLEERGIEQLTAESVAERAGVSRR
FT                   TLFNYFGTVEETLLVPAHASMDTLVAEIERSEASVPPLDVLRRALPTVFDAAVFDRIAS
FT                   IRRAAVHSPALRRAETAIVTDSVGDALALLEARSRRVGVEPDRLFLAGLARSGLGVIET
FT                   AAEAWMERTGGTADEESRRTFIELAQRALDDLRSGYGSADTPDSPDTTTEGRP"
FT   gene            458521..461397
FT                   /locus_tag="Ksed_04640"
FT   CDS_pept        458521..461397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04640"
FT                   /product="predicted RND superfamily drug exporter"
FT                   /note="PFAM: MMPL family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05536"
FT                   /db_xref="GOA:C7NKQ0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ0"
FT                   /protein_id="ACV05536.1"
FT                   /translation="MAERLYALGHWASRHVWPVIIAWLMVVASFGGAAATFSKPLSTEF
FT                   TIPGTEFQEVMDQLKEGVPDAAGGVGTVVFESESGEFTADQRTAINEVVKDFATAEGVT
FT                   AAESPFALQKEIDDAPKELKQAREELESGRTQLENGREELESGKKELAQGREQLEQAQK
FT                   ELDAGKQELQSGRTELKQQREQVEQLRAQLGPDHPRVQQAEAGLQRGQQQLEQAEAEVE
FT                   AGTKRLSNEREKLEAGEQEIATNEKKLADSQKELTSGEADLERGQAQQELTDGMRFVAE
FT                   GGGVAYTQIRFADEMHNVAIEDREAVMAKAEGLSDQGITTTFSEEMSQDTSSIIGPGEI
FT                   IGVVVAAIVLLVMLRSLTAAGLPLVNALLGVAVGVAGALSLTPFISMQDITPVLAVMLG
FT                   LAVGIDYTLFIVHRHRTQMVTGMDKHESIGLAIGTAGNAVGVAGATVFIALAALTLTGI
FT                   PFLGTMGLVAAATVLIAVLVAWTLSPALLSLLGDRVLGKGGRAKRARALEQEQAGAQGR
FT                   ALANEQEQELRAGSRPRGGATSFFNPPATAQHAGTSSEPGGGTSVQHEAADEDHPFWAR
FT                   LVTRVPWLTVLAVVLGLGALAWPVTDMRLGMPDGSTAPADSQGYQTFDTIRTHFGDGVN
FT                   GPLVAMAEAPEGLSEGEAADRQIAIAQELHATEGVEYVVPAGMSEDRSMLAFQITPSTA
FT                   PGDEATLDLVHRLRDKAPGIESAQDVELGFTGLTVANIDISEALASTLPLYLAVVVGLS
FT                   LLLLVLVFRSIVVPLVATAGFLLSVGASFGAVVAVYQWGWLGSLFGVNEPGAILSFLPT
FT                   LVIGVLFGLAMDYQMFLVSGMREAWAHGASARKAVQRGFGAGASVVTAAALIMVSVFAG
FT                   FIHAELTMIRPIGLALALGVLVDAFVVRMTFTPAVLHLLGEKAWWIPRWLDRILPDLDV
FT                   EGAKLQKAHGVDAEGHHIPAEPATATAR"
FT   gene            461498..462715
FT                   /locus_tag="Ksed_04650"
FT   CDS_pept        461498..462715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04650"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05537"
FT                   /db_xref="GOA:C7NKQ1"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ1"
FT                   /protein_id="ACV05537.1"
FT                   /translation="MTTTAATDEATGFPREIWILIGAAFVVAVGFGIVAPALPQFARSF
FT                   GVGPTAAAAIISTFAAFRLFFAPVGGRLSEALGERPVYLTGLVIVALSTGAAAFATNYW
FT                   MLLIFRSLGGIGSTMFTVSAVALLVRMAPPTKRGRVSAAYGSAFLLGNVFGPVLGGLLA
FT                   GLGLRAPFLIYGVALLIAAGVVAIGIPRDVGHAARKGTGPPRMLVREAWADPVYKACLT
FT                   SGFANGWANFGVRVALVPLFVVEVLQSGPQMAGFALAAFAVGNVLVLNHSGRLSDRIGR
FT                   RPLIIGGLVVCGVFTAFSGFITDVWVYLGVMAVAGVGAGMLNPAQQAAVADVVGNERSA
FT                   GTVLAGFQMSQDVGAILGPIVVGMLAEQFGYGFAFAATGVIMAASVLVWIGRRETARVV
FT                   VEQEVT"
FT   gene            complement(462777..463958)
FT                   /locus_tag="Ksed_04660"
FT   CDS_pept        complement(462777..463958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04660"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05538"
FT                   /db_xref="GOA:C7NKQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ2"
FT                   /protein_id="ACV05538.1"
FT                   /translation="MLRPVLTSAPQVAALFVINGFMIGIWGGLLASLRDRIGIHEGDVS
FT                   ILLVTVGFSAAVTMQISGRLADRIGARRPTIVGAVVMMVAFATLAAATSWPMLLVAACL
FT                   LGLGNGAMDVSMNALAVNAERVARRRIMSTLHAFFSMGSLAGASAVLGANTVSSGPGGT
FT                   VVVATLGAIVVVSALLLTISPRTPDTPIIAHRDEAGGRTRLPAITWLLAAMAVLFGLTE
FT                   GTGWDWSTIHVTDVTGVSPGVGAAGLAVFSAAMVALRLSGDWVVDRIGARPALVGGALL
FT                   AAVGYLVAATQNSLPVVLGAWALVGIGVAVLAPMIYGMAGHLGGGRMLAVVAGAGYLTF
FT                   LAGPALIGWASTRWGMGPAMFVPLTTAALVAGLAAMLPRRAREAAVADAGAGD"
FT   gene            464116..465024
FT                   /locus_tag="Ksed_04670"
FT   CDS_pept        464116..465024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04670"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05539"
FT                   /db_xref="GOA:C7NKQ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ3"
FT                   /protein_id="ACV05539.1"
FT                   /translation="MDRRTLRTEVLLVLGLSLGASALWSLLRLVDLLSRPGGLAAATTY
FT                   MNTPADPSRPWLSVLYEVVGLGLALVPAVLALFLLGTVWPPRGPAASRAPVPTHASEAS
FT                   RAPATSGHLVAPADPTAQSGAAVPSGGRPGRRPISAGARIVGLDRTRPGPDLAGGLLLA
FT                   AVIGLPGLGLYLAATHWGLNSTVAPASEASPWWALGLLVLAALKNGVLEEVVVVGYLVT
FT                   RSRQLGVLPWTAVVLAALLRGVYHLYQGFGAGLGNVVMGLVFGAWYLRTGRVMPLVVAH
FT                   VVIDLVAFIGYATVAPRVDWI"
FT   gene            465144..466139
FT                   /locus_tag="Ksed_04680"
FT   CDS_pept        465144..466139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04680"
FT                   /product="siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein;
FT                   Siderophore-interacting FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05540"
FT                   /db_xref="GOA:C7NKQ4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ4"
FT                   /protein_id="ACV05540.1"
FT                   /translation="MSKANYRDFRATVSGMQRISPSFVRVTLADEGLRDFGDTCLDQRI
FT                   KVVFPLEGADEGADPFATFPTGDTWYLAWRELPDAERNVFRTYTPAAVRRDAGELDIDV
FT                   AVHGETGPGSVWALHVQPGDPVMVWGPDATVPGNEAVGVDWTPGAAERFLLAGDETAVP
FT                   AIVNILRALPAGATGQAFLEVPESGDAREIEAPAGIEVVWLPRDEGQAPGERLTLEVPE
FT                   RLTVQAGSREPVHLEDSVTARGESVPPTNEVPSGESAPAGDLGQPDVTDDPEAVPWEVT
FT                   RVTDAELTYAWFAAESSAVKALRRHLVRECGWDRRQVAFMGYWKQGVSQV"
FT   gene            complement(466581..467819)
FT                   /locus_tag="Ksed_04690"
FT   CDS_pept        complement(466581..467819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04690"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function DUF88; TIGRFAM:
FT                   conserved hypothetical protein TIGR00288"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05541"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ5"
FT                   /protein_id="ACV05541.1"
FT                   /translation="MEEDRIALFVDYENLALGARDHLGGMTFDLKPIADALAERGRVVV
FT                   RRAYADWSYFDEDRRMLTRSHVELIEMPQRMGASRKNAADIKMVVDAIEMAFERGYITT
FT                   FAICTGDSDFTPLVHKLRELNKNVIGVGVRNSTSAMLPPSCDEFLFYDTLDGVDPHTPA
FT                   KETKGSEGGKSGRGKKSGGSGGGAASSGGSGGGATNTASETPAKGGTGAGSDAADTKTD
FT                   AGKSGKSSRGGSRSAPKTTPEGEEVATANQSTGALAPLVAQTVAGLQRTASGPVTASAL
FT                   KRTLLRKDPTFSEADFGFRAFGELLKHLDDRGVITLSDGPSSGDPMVELPGEADREVAF
FT                   DLLRRVLDEEDPEGEGVPLSGLKDRLRHHESEFSEKSLGYSSFLQFCKAADTEDVAELW
FT                   WDDEHDGYLVAAL"
FT   gene            complement(467894..468367)
FT                   /locus_tag="Ksed_04700"
FT   CDS_pept        complement(467894..468367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05542"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ6"
FT                   /protein_id="ACV05542.1"
FT                   /translation="MDTYTTYRRLHHTRIGRALFARVYGWRVPYFRPLRMRIDHVGPHR
FT                   AELVLPKRRALENHLGTVHAIAVCNGLEAAMGLLAEATTPPSHRWIPVGMEVEYLAKST
FT                   TDLQCVAITTPDEWPTAADETLGVPVGVAATREDGTVVVAGTITIRVSPRPAR"
FT   gene            complement(468392..468940)
FT                   /locus_tag="Ksed_04710"
FT   CDS_pept        complement(468392..468940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05543"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ7"
FT                   /protein_id="ACV05543.1"
FT                   /translation="MAHDVVASAVRAEPFPAGTALALTAVAATSSALPDWVPDWRRRWP
FT                   LQLALAGVGAAVFALRPDGVAPGGLTASDRATAGGVGETGPDGGDATPIGRADESTDSL
FT                   PSTSQGLDQPDIPWSKVLLPGVLLLGAGLAGGLWLERQAIKVVSRCGASRPRTVLALVS
FT                   VPFLWWSLRQDLSEDTDHA"
FT   gene            complement(468942..469481)
FT                   /locus_tag="Ksed_04720"
FT   CDS_pept        complement(468942..469481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04720"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="PFAM: Phosphatidylethanolamine-binding protein;
FT                   TIGRFAM: conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05544"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ8"
FT                   /protein_id="ACV05544.1"
FT                   /translation="MDLQRPQAPEPYSLLPETASFEVTSKDVREGEPMDARHAADGDET
FT                   SPHLAWSGAPEGTQSFAVSCFDPDAPTPAGFWHWTVLNLPADTTELAADAGAEGGHNLP
FT                   EGAFMVSADTGAKAWAGMAPPPGDRPHRYIFAVHALDTDDLGLDQSASATVAAFTMLFQ
FT                   TIGRGTLTGTYQVQGD"
FT   gene            469652..470242
FT                   /locus_tag="Ksed_04730"
FT   CDS_pept        469652..470242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04730"
FT                   /product="conserved hypothetical protein TIGR03086"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR03086;
FT                   uncharacterized Actinobacterial protein TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05545"
FT                   /db_xref="GOA:C7NKQ9"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKQ9"
FT                   /protein_id="ACV05545.1"
FT                   /translation="MTAPAPATSRQAIDLLPESARAFGVVLERLDDGVWGRPTPCAEWS
FT                   VRDVVNHVVAEHLWVPHLLRGESLQEVGDRYDGNVLGDSPAQARRAWQMAMLGSLQAWA
FT                   QVDDAEQLVAFSGGEHPAGEYAHQMLVDLVVHAWDVAQGGGVAVPVITDAVGVAFAYEK
FT                   PRVADHRAAGIFAPPTRPRSDHPMDQLVALLGR"
FT   gene            470246..471361
FT                   /locus_tag="Ksed_04740"
FT   CDS_pept        470246..471361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04740"
FT                   /product="predicted amino acid aldolase or racemase"
FT                   /note="PFAM: Alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05546"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR0"
FT                   /protein_id="ACV05546.1"
FT                   /translation="MSTLPTSRPSTPFAVVDRDRLQANIDRVARLAADRGQALRPHAKT
FT                   HKCPQIAALQLEAGASGLTVATLGEAEVFADAGCTDLLIAYPVWWDADRAGRVAQLAAR
FT                   VRLAVGVDSVEAVQHLASLLGTAPGRPLAAPISPPTLPELVVEVDCGHHRSGCAPQDAG
FT                   AVARAGLEAGFVVRGVFAFPGHSYTPTGREEVAEQEARDLAVAADSLRGAGILEPWVSG
FT                   GSTPTVEHEGDGFDEVRPGVYVVGDAQQWELGTCSSADVALTVHATVVSHAGGRLVLDA
FT                   GSKALGADRAGWATGFGRLLDHPEARIELLSEHHAVAVLPEDTELPPLGTEVRVVPNHA
FT                   CNAVNLTDRLWVEVDGRLVESWPVAARGLNA"
FT   gene            complement(471415..471684)
FT                   /pseudo
FT                   /locus_tag="Ksed_04750"
FT   gene            complement(471797..471958)
FT                   /pseudo
FT                   /locus_tag="Ksed_04760"
FT   gene            complement(472157..472906)
FT                   /locus_tag="Ksed_04770"
FT   CDS_pept        complement(472157..472906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04770"
FT                   /product="branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /note="PFAM: Aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05547"
FT                   /db_xref="GOA:C7NKR1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR1"
FT                   /protein_id="ACV05547.1"
FT                   /translation="MTQWAATGTAAEPEVPTEAVVVTAWRHTDGRWPGRARHLARTVEG
FT                   CERLWPQWPDWQERVERATEVLPEEIDTGDWFPRLEARSDGIVVLVRPAPPRRPTTRLW
FT                   TAPGADARRHPAVKGPDLHQLSGLRDRARGAGADDAVLCTPTGTVLEAAHGTLVWWSGE
FT                   RLASPSVAGRLASVTEQRLRELAARRGVQWVVEELAPTDLAGREVWLVSALHGITQVTS
FT                   WRDGATELVLAPTARAQGWHDALASMP"
FT   gene            473163..473300
FT                   /locus_tag="Ksed_04780"
FT   CDS_pept        473163..473300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05548"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR2"
FT                   /protein_id="ACV05548.1"
FT                   /translation="MHDIRTDHTLCVTLPLGPVTPLPGFRPVVLSLVSVQRMRWAQGAA
FT                   "
FT   gene            473453..474859
FT                   /locus_tag="Ksed_04790"
FT   CDS_pept        473453..474859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04790"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PFAM: Cys/Met metabolism PLP-dependent enzyme;
FT                   TIGRFAM: OAH/OAS sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05549"
FT                   /db_xref="GOA:C7NKR3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR3"
FT                   /protein_id="ACV05549.1"
FT                   /translation="MTHPTEPTPTTDADTTTDTTADAVSTPSAAPDPSAWGLATRSIHA
FT                   GQVPDSDSGSRALPIHQTTSYVFADADQAANRFALAELGPIYTRLTNPTTEAVENRLAA
FT                   LDGGVGALLLSSGQSATTFSLLNLCRAGDHVVASAHLYGGTQNLLAVTLEKLGIHTTFV
FT                   DEPNDPAAWREATRGNTKAWFAETIANPSGLVLDIRPVADAAHEAGVPLIVDNTVATPA
FT                   LLRPLEHGADVVVYSATKFLGGHGTAIAGAIVDGGTFDYGAQPERFPNFTEPDPSYNGL
FT                   VFARDLGADGAFGVNLSYVLRARVCLLRDLGSAPAPFNAWLIAQGLETLTLRLQKHVAN
FT                   AHEVASWLDARPEVTRVQWAGLPGHPSHEVAQRYLPDGPGSVLSFELAGGADAGRAFVS
FT                   ALKLFSHVANIGDVRSLVIHPASTTHAQLSDAERLAAGVTPGLVRLSVGIEDSADLLAD
FT                   LERGLAAVAR"
FT   gene            474856..475971
FT                   /locus_tag="Ksed_04800"
FT   CDS_pept        474856..475971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04800"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="PFAM: alpha/beta hydrolase fold; TIGRFAM: homoserine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05550"
FT                   /db_xref="GOA:C7NKR4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR4"
FT                   /protein_id="ACV05550.1"
FT                   /translation="MTAVLSPVRPGAARTAEPAPLVGAGGCPAPRHDLLRLGRLVCEGG
FT                   GAVPYLQVSVRRWGAPPRADGSNVVLLLHALTGDSHVAGPGGPAHSPTGWWPGVLGVGA
FT                   PVDTERFHVIAPDVLGGCSGTSGPAGASVPNALGGADFPEVTVRDQVAAEVRAVQALGI
FT                   RRVAHVIGASAGGMRALEWAAQTAVPVDHAVVVAAPAASSADLRAGLAVQRAAVTADPA
FT                   WQGGHYAPQSGPTAGLALARQLAVLTYRSADGLEQRFGPDAGRLTAWLEHHGRSFVERF
FT                   DAVSYLRLIGAMATHDLGRGRGGVQRALRHLPARVTAVAVSSDRFTTPDEVRALARGTG
FT                   GRYAVIESVHGHDGFLIETEQTATVLRSVLA"
FT   gene            476000..477214
FT                   /locus_tag="Ksed_04810"
FT   CDS_pept        476000..477214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04810"
FT                   /product="methionine synthase II (cobalamin-independent)"
FT                   /note="PFAM: Cobalamin-independent synthase, Catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05551"
FT                   /db_xref="GOA:C7NKR5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR5"
FT                   /protein_id="ACV05551.1"
FT                   /translation="MTPVLTSHAGSLPRPDSLREANARRAAGEIDAAAFDEQLSTAVQQ
FT                   VVARQRDLGLDIVNDGEYGHAMTASQDFGAWWTYSFDRTSGLELVEPTQSPQELEAQEE
FT                   RLGNTPADPADGVRLTTFGRRRDWLRFRDVYGDPTSGTGIDARRPLPLPTATGTIGYAG
FT                   QDAVARDTRALTAALAATGGGRGYLCALSPGSAARIGNAHYTSETEWLHAWAGVLRQEY
FT                   AAILDAGLELQIDDPSLAESWDQVNPEPSVADYQRFVARRIEALNLALEGLDTSRVRLH
FT                   LCWGSWHGPHTTDVPLADILGEVLQANVGGLSLEAGNVRHEHEWTVWRDVEVPAGLTLL
FT                   PGVVSHATNVVEHPDLVAQRIGRFAEAVGSDRVIASSDCGFGGRVHPDIAWAKLESLVA
FT                   GAQRA"
FT   gene            477590..478267
FT                   /locus_tag="Ksed_04820"
FT   CDS_pept        477590..478267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04820"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /note="PFAM: Phosphorylase superfamily; TIGRFAM:
FT                   5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05552"
FT                   /db_xref="GOA:C7NKR6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR6"
FT                   /protein_id="ACV05552.1"
FT                   /translation="MGAIEAEVVSLRAALADPRPETVLGQEVTTGQLEGVDVAVLRSGV
FT                   GKVNAALGAVALRTVGADRIVFTGVAGGLAPEVGVGDLVVANDVVQHDVDVTALGRAPG
FT                   ELLGEPAVWRSDDRLRAACEHAAREVSGGAGVHTGRIASGDQFIASVAQRVRIVEQFGA
FT                   LAAEMEGAAMAQACARMGVPWAVVRSISDSADAGAVADFPAFLGMAAERGVALARELVR
FT                   GGA"
FT   gene            478376..478840
FT                   /locus_tag="Ksed_04830"
FT   CDS_pept        478376..478840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05553"
FT                   /db_xref="GOA:C7NKR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR7"
FT                   /protein_id="ACV05553.1"
FT                   /translation="MGTGDGRLEQMGRLEAMLLLVIVGGVLLPTPWISRLLTHARTMPW
FT                   VNLPHKEFWVRTPRRLARAERLTWEVLAVLTLWAGTLTAVPLIGTAWAAQGGALPPEWV
FT                   VPAALGADLVLVPVLLVWIEAPWVSFRGQDATGATSREGVYAASTSAGVR"
FT   gene            complement(479376..479849)
FT                   /locus_tag="Ksed_04840"
FT   CDS_pept        complement(479376..479849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04840"
FT                   /product="DNA-binding protein, excisionase family"
FT                   /note="PFAM: MerR family regulatory protein; TIGRFAM: DNA
FT                   binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05554"
FT                   /db_xref="GOA:C7NKR8"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR8"
FT                   /protein_id="ACV05554.1"
FT                   /translation="MTKTAAGPDVRTYVPEGAVDPALKAILGEGSTQRPELVGANGERL
FT                   LLPEAMYDVLRQVAEALDKGMGVTVAPKNARLTTQEAADFLGISRPTLVRMLERGEIPM
FT                   EKPGRHRFVRLADLVDYQQHQRNQRREALERMALESERDGLYEATDGPPRRTR"
FT   gene            complement(479965..480180)
FT                   /locus_tag="Ksed_04850"
FT   CDS_pept        complement(479965..480180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05555"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKR9"
FT                   /protein_id="ACV05555.1"
FT                   /translation="MDTAHLEADETFGPCLVRDCPNYIGRHPAYREATDPRLESLHAAH
FT                   QHQGRYASLRDGLRPPLTLVRDAEEG"
FT   gene            complement(480652..481566)
FT                   /locus_tag="Ksed_04860"
FT   CDS_pept        complement(480652..481566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04860"
FT                   /product="Integral membrane protein DUF6"
FT                   /note="PFAM: Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05556"
FT                   /db_xref="GOA:C7NKS0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS0"
FT                   /protein_id="ACV05556.1"
FT                   /translation="MRTLLLLALITFSEATIGVFVKLTDGRIPIQTLTFYAMAFAATFL
FT                   FIARALATRQWPRFPAGNVKDTAIIGVLIAAQGSAFNFAMSLVPIANAVIFWSIAPFFV
FT                   FIFSAIFLGEKARKSYILIFAIALVGIALANPLGGGHMLGNFVALATGAIYAAMVTYMR
FT                   YEGKTETGNDIAWSLLVAALSLSPFLLIVGPGQVATTIAHPALGVELPVMLWAAGLGIV
FT                   STGFAYFGISIVLKSIDANVYALVDIIVSPVIASIFGYLIFAEVPGRGIIYGGALLLAA
FT                   GFWLSREMSRGRENQAVHPCQCV"
FT   gene            complement(481563..482504)
FT                   /locus_tag="Ksed_04870"
FT   CDS_pept        complement(481563..482504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04870"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="PFAM: Cation efflux family; TIGRFAM: cation
FT                   diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05557"
FT                   /db_xref="GOA:C7NKS1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS1"
FT                   /protein_id="ACV05557.1"
FT                   /translation="MAHGNGGRSHAGHLPSSGAALAISAWLTGIYFVIELGIGLWTGSV
FT                   AVISDAFHTFSAVGGVLVAIIAARLARRPADKDRSFGWYRAEVVGALVNGGFLLGMALV
FT                   VIVMAGMRMTDPVDLPTTPMLWAAAGGLLTEFISLGLIWKQSRSDLNVRGALWHILQTF
FT                   VGSLLIIVTALVIRFTGFLLIDPLLGMAFGFVLIWASWGILRDATHLLMEGTPAEIRLG
FT                   EVTEALEALDGVEGAHHVHAWALTSGRYVFSGHLRIADGADPQAVLQAASSMLKDQYGF
FT                   FFATLQVEAAYLDESDAEAIDVMRETRKKGQA"
FT   gene            482724..484031
FT                   /locus_tag="Ksed_04880"
FT   CDS_pept        482724..484031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04880"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05558"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS2"
FT                   /protein_id="ACV05558.1"
FT                   /translation="MPDATFTRPDLTTFAGLDDLGLEVTGQRLEPDRAVLACRVVEPGD
FT                   WCRRCGCQGVARDTVTRELAHEPFGWRPTTLLLTVRRYRCPECGHVWRQDTTAAAEPRA
FT                   KISRAGLRWGLVAIVIGHLSMARVAEGLAVSWNTANDAVLAEGQRLLIDRPSRLDGVNA
FT                   VGVDEHVWRHTRKGDKYVTVIIDLTPVRDGTGPSRLLDVVEGRSKKAFKDWLAQRDQAW
FT                   RDGIEVVAMDGFAGFKTATTEELPGAVTVMDPFHVIRLAGDALDECRRRVQQELHGHRG
FT                   RKDDPLYSARRTLHTGADLLTDRQHERLDKLFTGDRHVQVECTWGIYQRMISAYRDPNR
FT                   VTGRVEMSSVIDALADGVPRPLVELRKLGRTLARRVCDVLAYFERPRTSNGPTEAVNGR
FT                   LEHLRGLALGFRNLTHYIARALLEAGGFRPRLHPRL"
FT   gene            complement(484140..484247)
FT                   /locus_tag="Ksed_04890"
FT   CDS_pept        complement(484140..484247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05559"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS3"
FT                   /protein_id="ACV05559.1"
FT                   /translation="MGEYFAQTVQSGALLLAIPPSTYEAHRAATLPNAA"
FT   gene            complement(484404..485969)
FT                   /locus_tag="Ksed_04900"
FT   CDS_pept        complement(484404..485969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04900"
FT                   /product="predicted multicopper oxidase"
FT                   /note="PFAM: Multicopper oxidase; Multicopper oxidase;
FT                   Multicopper oxidase; TIGRFAM: copper-resistance protein,
FT                   CopA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05560"
FT                   /db_xref="GOA:C7NKS4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS4"
FT                   /protein_id="ACV05560.1"
FT                   /translation="MTSSLTTRRTFLGASVGSLALAGLAACADPATSPQPSGRILPTDP
FT                   LVAEYEKRRAASGTTVTHRLSAAPLETSLQGRGLTTWGYNDGLNGPLLRAQTGDLLKVS
FT                   VANDLPEDTSVHWHGLALRNDADGVQGVTQDPIAAGGRYTYGFRLSHPGTYWYHSHFDT
FT                   QRERALYGALIVEDPNEPLSYDQEWVVILDDWLDGITGTPQDVVEELSAGMDMSGDMEG
FT                   MAGMAGMDHGSMSQDSSPGMPMKHMLTGAESDYLGGDAGDVKIPVHLFNGRPPSDPDTF
FT                   SSTPGNRIRLRLINAAGDTAYRVGIPGQELTITHTDGFPVQPRQADAVVLGMGERLDVL
FT                   ITLGDQAVPVLALPEGKTGHAYGIIAAGPKTTLSGRLPQTLGGTVLDGSRLKAHESVLL
FT                   PPKDPTRTHEVRLTGSMMEYDWGINGRRFDPANPFEGAFELRLDERVRVTMTNDTDMWH
FT                   PMHLHGHTFQLADHGARKDTVIIKPRQTIVFDFEADNPGQWLTHCHNAYHAEAGMMGVF
FT                   SYIH"
FT   gene            complement(486582..487448)
FT                   /locus_tag="Ksed_04910"
FT   CDS_pept        complement(486582..487448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05561"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS5"
FT                   /protein_id="ACV05561.1"
FT                   /translation="MTPLTRRTLIAGGLTLLGAGTLTACAAPNPATSPAAGTGTQGTGT
FT                   AITHVHALTRDPESGEVLLATHQGLFRLQDGELTQVGPVVDFMGFTLTPEGRYLASGHP
FT                   APGTDLPEPLGLAESTDRGQSWTVLSRGGASDFHALAAGPNGVLGFDGQLRASTDGLTW
FT                   QSLEIPVAPASLAISPQTGTVLATTETGMLRSTDHGATWTTLDTPQLMHLVAWADDTTA
FT                   VGAGIEGHLLTSTDAGDTWTASDRPVGTATALGTGITDDGQTEALLVVGSTVLSTTDGG
FT                   NTTESLL"
FT   gene            487668..488336
FT                   /locus_tag="Ksed_04920"
FT   CDS_pept        487668..488336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04920"
FT                   /product="response regulator with CheY-like receiver domain
FT                   and winged-helix DNA-binding domain"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05562"
FT                   /db_xref="GOA:C7NKS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS6"
FT                   /protein_id="ACV05562.1"
FT                   /translation="MLVVDDEKPLARMVATYLERAGYEVALTHTGPAAVQAARVHEPDV
FT                   MVLDLGLPGMDGIEVCRRVRAFSECYVLMLTARGDERHRLEGLAVGADDYITKPFSVRE
FT                   LVARVGAVMRRPRTTVSAPEPERVCGDLVIDLAAHGARVSGQVVQLTRTEFDLLAALSG
FT                   RPHQAFSRRQLIDIVWDPAWVGDERLVDVHIKNLRRKLDADPARYIDTVRGVGYRMAEQ
FT                   "
FT   gene            488333..489502
FT                   /locus_tag="Ksed_04930"
FT   CDS_pept        488333..489502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04930"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05563"
FT                   /db_xref="GOA:C7NKS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS7"
FT                   /protein_id="ACV05563.1"
FT                   /translation="MTGRRRYQGLAARFFLAQLLVVGASVLAAVVVASLAGPPLFHEHL
FT                   EQAGAGHDAAQVLHVEQAYRDANFWTLAVALATALICCLALTWHVARRIQSPINALTQA
FT                   VKAMAGGRYDTRVPAMGAGTEVEDLAGFFNTMAARLQRTEDTRRRMLSDLAHELRTPVS
FT                   VLTVYHEALQDGVSHWDEPTGELMGEQLARLTRLVEDINDVSRAEEGRIELDRSPQGVS
FT                   GLLHAATEAHKEAYATKGVALTMDADPGLAVDVDRQRMGQVLGNLLTNALRHTPAGGRV
FT                   TLEARQSPSGVTLSVTDTGEGISPEHLPHVFERFYRGDTARDRDHGGSGVGLAISRALI
FT                   QAHGGTLSATSTTAGATFTIDLPTKQPPDQPTYRRTRLSTVNTGAPPLE"
FT   gene            489574..489903
FT                   /locus_tag="Ksed_04940"
FT   CDS_pept        489574..489903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04940"
FT                   /product="copper chaperone"
FT                   /note="PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05564"
FT                   /db_xref="GOA:C7NKS8"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS8"
FT                   /protein_id="ACV05564.1"
FT                   /translation="MTESARTPLPGATNGCSCCAPAADATAPAGRQSADPTGTSAGDAT
FT                   YQVEGMTCGHCVGSVTEAVSALDGVDDVRVELVAGGASPVTVTGPASADSVRTAIEAAG
FT                   YRVRI"
FT   gene            489979..492219
FT                   /locus_tag="Ksed_04950"
FT   CDS_pept        489979..492219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04950"
FT                   /product="copper/silver-translocating P-type ATPase"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; E1-E2
FT                   ATPase; TIGRFAM: copper-(or silver)-translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05565"
FT                   /db_xref="GOA:C7NKS9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS9"
FT                   /protein_id="ACV05565.1"
FT                   /translation="MSTPHHHDHPTDQTAEHPDPNPHAGHANHTDHAAHHPADAATHGQ
FT                   AVPQGHAHSALDEEHQVHDHGKHAGHSTAMFKNRFWVSLVLSLPVVFFSHMVGQLLGYH
FT                   VPEFPGSAWIAPVLGTVIYLYGGAPFLKGGLTEVRSRQPGMMLLIAMAITVAFVASWIT
FT                   SLGIGDLILDFWWELALLVTIMLLGHWMEMRALGAASSALDALAALLPEEAEKIVDGDT
FT                   VTVPVGELAVGDTVLVRSGARVPADGTILEGAAEFDESMITGESRAVARTVGERVVAGT
FT                   VATDNTVRVRIEAVGADTALAGIQRMVADAQESSSRAQALADRAAALLFWFALGAAIIT
FT                   AIVWTVIGQPTDAVTRTVTVLVIACPHALGLAIPLVIAISTERAAKAGLLIKDRMALEQ
FT                   MRTIDVVLFDKTGTLTEGAHAVTGVAAAPGISEAELLAYAAAAEADSEHPVARAIVTAA
FT                   TSHAEAARLGLRGTGFQAATGRGVTATVAGAEVLVGGPNMLRELTLDTPEALAADVRAW
FT                   TDRGAGVLHVVRDGSVIGAVAVEDKIRPESRAAVAALHARGVKVAMITGDARQVAEAVA
FT                   RDLGIDEVFAEVLPQDKDTKVTELQARGLSVAMVGDGVNDAPALARAEVGIAIGAGTDV
FT                   AMESAGVVLAGNDPRAVLSMIHLSKASYTKMIQNLVWATGYNVLAVPLAAGVLAPIGFV
FT                   LSPAVGAILMSVSTIVVALNAQLLRRTDLDPEHLAPLERPRSQAALQPAAVS"
FT   gene            492291..492989
FT                   /locus_tag="Ksed_04960"
FT   CDS_pept        492291..492989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04960"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF305)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05566"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKT0"
FT                   /protein_id="ACV05566.1"
FT                   /translation="MTLTALTLASALTLTACGTGAQDENAGAEASATATGSAPAATPAA
FT                   TDTATPSATESATSSATGSAEEVSAEHNDADVMFAQMMIPHHQQAVEMSEMLLAKDEIP
FT                   AEVAEFAQKVIDAQGPEIERMNAMLTAWGEDPVDMGDMGGMEGMDHGGMSGMMSEEDMA
FT                   ALEQAQGTEAARLYLEQMTAHHQGAIEMAQDEVEGGQTPQAVALAEKVVADQQAEITEM
FT                   EQMLQELPAT"
FT   gene            493190..493315
FT                   /locus_tag="Ksed_04970"
FT   CDS_pept        493190..493315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05567"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL25"
FT                   /protein_id="ACV05567.1"
FT                   /translation="MKPRALQIMRVLDPERAAADLPAEEPLGAVLLSGPDDAPGR"
FT   gene            493342..494127
FT                   /locus_tag="Ksed_04980"
FT   CDS_pept        493342..494127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04980"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05568"
FT                   /db_xref="GOA:C7NL26"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL26"
FT                   /protein_id="ACV05568.1"
FT                   /translation="MSTSPTDDDFDRLLNQARDTPADAPADAPTDPADGGPLEGTDPRA
FT                   DAGEPAQPTPLALIHGIGSNPIDWQDVVSRIGAGRPMAAPWVDGLKPTQKGGFDLQQCA
FT                   SAVLYNSDVMTWRAFDAVGQDIGGMVAATLAAEHPEKVRRLVLSGVFVQMPKMAVRMQK
FT                   LALQAQPRNNLVAQGIDRGRTLAALDSLAGIDMRETLAAVQQPTLVLVGANDRAGSIMA
FT                   KQVVELMPDARIEQVPGAGRRASIDAPEAFADAVIAFTA"
FT   gene            494124..494810
FT                   /locus_tag="Ksed_04990"
FT   CDS_pept        494124..494810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_04990"
FT                   /product="predicted membrane protein, hemolysin III"
FT                   /note="PFAM: Haemolysin-III related; TIGRFAM: channel
FT                   protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05569"
FT                   /db_xref="GOA:C7NL27"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL27"
FT                   /protein_id="ACV05569.1"
FT                   /translation="MSGTTAPARSKDGSVHVTDERINTLSHLAATCFALLSAAVLITQA
FT                   ATTGDPWRIVGASIYSASLVTLFACSTLHHGLDLGERGDSVLRTLDYTAVFGLIAGTVT
FT                   PLVLVQVRTPFGWAVLGAVWAIAIGGIVARSVRRDLPKEITNTLYIVLGWLPVALLAAG
FT                   VTFEPGMVALLAAGGLVYSAGFVVFILERPNPWPGVLGFHEIWHVLVAIAAALHWFMVA
FT                   VYVIPQ"
FT   gene            complement(494868..495518)
FT                   /locus_tag="Ksed_05000"
FT   CDS_pept        complement(494868..495518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05570"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL28"
FT                   /protein_id="ACV05570.1"
FT                   /translation="MAKRRRTTRRNGLDPRAWIAIALVVALVIAYGVFTLNPANERVDD
FT                   IPEQALEAYRGAAEGAEDFEHSCHHLDWRVLAGIGRVESKHAEGGELTDAGVADPPIYG
FT                   PRLDGSGAGGNTTGISDTDGGEVDGDTEYDRAVGPMQFIPTTWEIHGKDGDGDGEADPQ
FT                   NIHDAALSAASLLCANQEIDLSDEDTLRRAIKRYNNSDAYVEKVLTWAERYGR"
FT   gene            complement(495613..498240)
FT                   /locus_tag="Ksed_05010"
FT   CDS_pept        complement(495613..498240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05010"
FT                   /product="Excinuclease ATPase subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: excinuclease ABC, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05571"
FT                   /db_xref="GOA:C7NL29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL29"
FT                   /protein_id="ACV05571.1"
FT                   /translation="MTSGSPSIPTAPTLPASSDGHITVTGARLHNLRDVTVSIPRDRLV
FT                   AVTGVSGSGKSSLAFGTVHAEAQRRYFETVAPFARRLIHAAVDPQVRSITGLPPAVALG
FT                   QQATTSGTSSRSTVGTVTHTGNTLRMVFSRCGDYPTGAAHLDSDAFSVNTAVGACPECS
FT                   GLGVVHEPTEASMVPDPDLSIAEGAIAAWPGAWQGKNYRDITATLGYDITSSWRDLPAA
FT                   DRQWILFTDDQPVVQVVPERDPERIQRPYSGTFSSARRYLMRTLSETKSATQWARALRF
FT                   VETTPCPACDGHGLRADALAVTWQGRSLPDAAALPLAELADLARRRRHALPDEGGSARE
FT                   GAERLLLGDLLARLDVLLELGLGHLSLGRRSTTVSPGEMQRLRLATLLHTGLFGVVYVL
FT                   DEPSAGLHPRDTEALLRVLRRLVDAGNTVLVVEHDMAVVAACDWVVDVGPGAGEGGGRV
FT                   LHSGPVDELAGVAESVTGRYLAQPIHPAEVLGADATGGSTSAGTPGDDLAAEPLPAPRT
FT                   GSGQLVASGLRRHTVRGVDLTLPLGAVSVVTGVSGSGKSSLLDALADVVAMHAQEVSTE
FT                   AAEEHGEPGTQDVGHPGEGHPGEDAAGAALTASGTGTGQGTPPAPARVVLTGGRVERLV
FT                   RITQKPIGRSPRSTLATYTGAMDRIRSLFAATDDAQERGYGAGRFSFNTTPGRCPTCEG
FT                   QGSVSVELLFMPGTYSTCPECHGARYDAETLQVHWEGHRIDEVLGWTVAEARERFAEHP
FT                   QLARTFGALADLGLDYLTLGHPATDLSGGEAQRIKLATELRVQRRTPTLYLFDEPTTGL
FT                   HPADVHRLLRQLHGLAGASHTVVLAEHDAVAVATADHVVEMGPGAGGAGGRVVAAGIRS
FT                   SFVA"
FT   gene            complement(498503..500065)
FT                   /locus_tag="Ksed_05020"
FT   CDS_pept        complement(498503..500065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05020"
FT                   /product="sulfate permease-like transporter, MFS
FT                   superfamily"
FT                   /note="PFAM: STAS domain; Sulfate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05572"
FT                   /db_xref="GOA:C7NL30"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL30"
FT                   /protein_id="ACV05572.1"
FT                   /translation="MTSPTPAPAFPATDDYPLVPEAGERETSTWAALRNPARLRTEVLA
FT                   GLVVALALIPEAISFSIIAGVDPRLGLFASFTMAVSIAILGGRPAMISAATGAVALVIA
FT                   PVAREYGMNYFIATVILAGVLQVVLAVLGVARLMRFIPRMVMVGFVNALAILIFVAQLP
FT                   HLTDVPVLVYPLVVAGLAIIFLLPRLTTVVPPPLVAIVLLTAVVLLAGWQVPTVGDMGE
FT                   LPDSLPTLLVPDVPLTAETLRIIGPFALAMALVGLLESLMTAKLVDDITDTHSNKTRES
FT                   WGQGAANVITGFFGGMGGCAMIGQTMINVKASGARTRISTFLAGVFLLVLVVVLGDTVA
FT                   LIPMAALVAVMVFVSWATFDWHSIAPSTLKRMPWSELAVMVVTVVVTVVSHNLAYGVIL
FT                   GVLTAFVVFARRVAHFTTVERVATLDTTEDGEVDTATYRVRGELFFASSNDLVYQFDYS
FT                   GDPQRIVIDLSESHIWDVSTVAALDGIQTKYAARGKRVQIVGLNEASAARHGQLSGHLG
FT                   EGH"
FT   gene            500258..501502
FT                   /locus_tag="Ksed_05030"
FT   CDS_pept        500258..501502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05030"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05573"
FT                   /db_xref="GOA:C7NL31"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL31"
FT                   /protein_id="ACV05573.1"
FT                   /translation="MGSSFRWLMGSAYSSNLADGVVLAAGPLLVASQTSSALLISAAPM
FT                   LNRLPWLVLGLGAGAIADRVDRRRMAMLANLLRAAVLMVLVAILVTGQVSIAAVLVVML
FT                   LLGTAEVLCDSATNTLLPSVVARKDLVTGNARLMSAFLVANQLVGPAFGAFLFALGSAW
FT                   PFGVSALAIVLAAVLVSRMVVPPVAGADSETATRTTSGVRGLHADVVSGLRWLRDAPAV
FT                   RTLVLTILTFNITWAMGWGILVLWAQERVGLGPVGFGLLTSATAVGGVISVLAYDRIAA
FT                   RWSLAGIMKVCLTLEVLMHLVLATTTAASVAYATMFGFGLYTFVWSATSSAVRQRATPQ
FT                   HMMGRISSINMVGLTGGMVIGMPIGGAVADAFGVTAPFWVAFAGSGLTLVLIWRSLSHI
FT                   AHVAEVGPEAAAAAH"
FT   gene            501507..502082
FT                   /locus_tag="Ksed_05040"
FT   CDS_pept        501507..502082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05040"
FT                   /product="acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05574"
FT                   /db_xref="GOA:C7NL32"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL32"
FT                   /protein_id="ACV05574.1"
FT                   /translation="MSQSIRPRRDADLPGLAAALLEQQAHSGYPHRDPLPAPPEQFIQR
FT                   PAEEAAWVAEVGGEVVGHVAVGRTASDGSGGDAPFVEAWSAASGRPAEDLRVVGVLFTA
FT                   TSARGTGAGVALLRHATGYVLDAGCVPCLDVLPTHERALSLYRHLGWREVTRQRPEWLD
FT                   AGAPDVIGMVFDPRDGYGSASSPPMHRG"
FT   gene            complement(502111..502713)
FT                   /locus_tag="Ksed_05050"
FT   CDS_pept        complement(502111..502713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05050"
FT                   /product="protein of unknown function (DUF1992)"
FT                   /note="PFAM: Domain of unknown function (DUF1992)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05575"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL33"
FT                   /protein_id="ACV05575.1"
FT                   /translation="MSDPDRPAEHPGGTEPEPRSRPLQAHHVQTVVDKAIEQAQREGAF
FT                   DNLPGAGKPLHLSSSDDPEWWVKGFIEREGLDFSEAQPGPLQLRRERAGFPESLLHLAD
FT                   ESAVREHLEDFNARVLADRRRPVAGTSSPPVVGRVDVEEVVGRWREAAAAREQCGRGDH
FT                   DVAPATTTDHADDDASPEGGNRAHGKSTRRWWAPWRR"
FT   gene            complement(502731..503117)
FT                   /locus_tag="Ksed_05060"
FT   CDS_pept        complement(502731..503117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05060"
FT                   /product="Protein of unknown function, DUF393"
FT                   /note="PFAM: Protein of unknown function, DUF393"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05576"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL34"
FT                   /protein_id="ACV05576.1"
FT                   /translation="MSALLYDPDCGFCTRAAQVLARWPVTCEVAPMTPDRLTAAGVDAQ
FT                   RADREIPFVDDAGQVSYGAAAIAAALRTADRSTSLGRLVWAAGAALGAPPLAWVAPPVY
FT                   RLVAEHRHELPGGTPACALPPRAG"
FT   gene            complement(503122..504432)
FT                   /locus_tag="Ksed_05070"
FT   CDS_pept        complement(503122..504432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05070"
FT                   /product="conserved hypothetical protein TIGR00341"
FT                   /note="PFAM: Domain of unknown function (DUF389); TIGRFAM:
FT                   conserved hypothetical protein TIGR00341; uncharacterized
FT                   hydrophobic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05577"
FT                   /db_xref="GOA:C7NL35"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL35"
FT                   /protein_id="ACV05577.1"
FT                   /translation="MQHTQDSRVAPQWHPGAVVAVVELAALGLALGALASVPDQWGPVV
FT                   HRIGAGVGAVWAVWLAVRATRRGASPLWMGGLGLAAAGLAVTALGEAGWWGWSVRAYAA
FT                   GLVLLIAAEVRWRRHEEAITGPGLNELLFAGLATVTMVAPVLGLRVSLFAGLALAVLHV
FT                   GIDAAHRAGFTDVSPTGEADDGRLERWLRSNAASGVDRGEVVDTLFFEAEQGRGRTVQF
FT                   LVQMVLATVIATLGVLTDSTAVVIGAMVVAPLMLPLLAAGLSLGMGWPRRLVRSLVLAA
FT                   LGIVLAVGVAFVLVRALGMGIDLQANSQVSSRIAPTVPDLLIAVASGAAGAFALSRRNL
FT                   GTALPGVAIAIALVPPLAVLATCLEQGAWSAAAGAGLLFLTNIVCMVAAAGLTFVLTGV
FT                   VPLSSLETNQERVGAWGVGVGVAAGLVVCALALHAGR"
FT   gene            504521..505195
FT                   /locus_tag="Ksed_05080"
FT   CDS_pept        504521..505195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05080"
FT                   /product="putative threonine efflux protein"
FT                   /note="PFAM: LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05578"
FT                   /db_xref="GOA:C7NL36"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL36"
FT                   /protein_id="ACV05578.1"
FT                   /translation="MDLLLPLAIVWTLGVMSPGPDFVAILRTAMRHGHRAATSTALGVV
FT                   TGISVWIVLALVGLTALVQAIPAVGVVMKVAGAVFLIGYGVFILWSLWRARRAARAAPL
FT                   GPAAADEASGVAEPAAAPSPAHPITAGAAFRLGLATNVANPKALVFFGALFSTLLPPTL
FT                   SWAVRGAVLLMMLAIALVWFLALARAASRPPLVRLYERAGHLIDAAAGVAFVVLGVVLL
FT                   LE"
FT   gene            complement(505260..505718)
FT                   /locus_tag="Ksed_05090"
FT   CDS_pept        complement(505260..505718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05090"
FT                   /product="ferredoxin subunit of nitrite reductase and
FT                   ring-hydroxylating dioxygenase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05579"
FT                   /db_xref="GOA:C7NL37"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL37"
FT                   /protein_id="ACV05579.1"
FT                   /translation="MTHLPSPCSTCPGHPARPGPSRRQVVTGATAVAAFGVPTLAACSD
FT                   DPGTSGRPGVNTVSVAADDVPVGGGVIQEGWVVTQPTEGDFKAFSAECTHQGCAVSEVA
FT                   DGQIICSCHGSYFAIADGAPTAGPATRPLAGAAVEEADGQLTISPQQG"
FT   gene            complement(505753..506493)
FT                   /locus_tag="Ksed_05100"
FT   CDS_pept        complement(505753..506493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05100"
FT                   /product="pterin-4a-carbinolamine dehydratase"
FT                   /note="PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport; Pterin 4 alpha carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05580"
FT                   /db_xref="GOA:C7NL38"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL38"
FT                   /protein_id="ACV05580.1"
FT                   /translation="MDADLPALLTPEWRELEGRLTTAFVPRDYATATAFVAAIAAAAEE
FT                   ADHHPEVTLAPGRVVVATHSHDAGAVTERDHRLARRIDEIAAARGVAGDPERFHRASVW
FT                   VPVTPDEAYALVSDVTRTGQWSPTCRACRWTDPDHRGVGATFEGDNQTPERQWTTTSTV
FT                   VTADPGRRFAWQVNQGFVEWGFTLTPAAQDGTLLTQTWHFTRTGRAGFDEKWGVDAVAQ
FT                   ADQRERQAHADMPVTLARIAAALS"
FT   gene            506501..506635
FT                   /locus_tag="Ksed_05110"
FT   CDS_pept        506501..506635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL39"
FT                   /protein_id="ACV05581.1"
FT                   /translation="MCRPGPGPGPGTSCTNPNPNVQEIAQVEANASYDAAGAQDAVTR"
FT   gene            complement(506655..507698)
FT                   /locus_tag="Ksed_05120"
FT   CDS_pept        complement(506655..507698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05120"
FT                   /product="glutathione synthase"
FT                   /note="PFAM: RimK-like ATP-grasp domain; TIGRFAM:
FT                   glutathione synthetase, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05582"
FT                   /db_xref="GOA:C7NL40"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL40"
FT                   /protein_id="ACV05582.1"
FT                   /translation="MKIAYVVNDVMTEKPVYTTTRLAMTSTSMGHDSYVLGMGDFGYEP
FT                   DGTLVARARCGKDKSYRSLERYLADVQKPAEEEQIALSDFDVVMLRADPADESDGSAWA
FT                   NNAGVAFGELMAQSGVLVVNDPSSLSKALSKAYFQHFPEAVRPRTLISRDEERIEEFVK
FT                   ELGGKAVLKPLQGSGGSGVFVVNSDESPNLNQIIEAIARDGYVVVQEFLKEAKNGDVRM
FT                   FLMNGQPLTVDGHVAAFRRRSQGEDIRSNMSAGGKAEKVEVTDEMLELAEAVRPKLVAD
FT                   GMFLVGLDIVGDKLMEVNVFSPGGLGSCQALYETDFAPAIIENLEHKVTMRGHYGRQLR
FT                   NAALATL"
FT   gene            complement(507695..508885)
FT                   /locus_tag="Ksed_05130"
FT   CDS_pept        complement(507695..508885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05130"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Domain of unknown function (DUF1704); TIGRFAM:
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05583"
FT                   /db_xref="InterPro:IPR012548"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL41"
FT                   /protein_id="ACV05583.1"
FT                   /translation="MSDTPSAPEGREALSPADLAVDHTLAMLSDSMRFLLDITPVNSDE
FT                   EKERFISGTHEEPTFVYRDLETDPAIQSAQIAQVALGEVEDPTVGKLLQSKRRELSLQI
FT                   DMLRARGTDDFRQLSAELYGAVGPSLRDTAEDLVARLEVPSRNSHMVDAKGFLVAAQEE
FT                   IDAYRELDPDVSIHAEVRSDVAGVLVEGDTLLISNHANIPAPRVQALLMHEVGTHLVTQ
FT                   VNGVGQQMKTLGSGLAGYDETQEGLAVLAEIAVGGLTSFRLRQLALRVLTVHRMLNGAT
FT                   FREAYQAMLDVGVPPGSAFTTTMRAYRSGGHTKDAMYLRGLVDLLAHLREGGRLDLLFL
FT                   GKFALRDLPLVQDLDDRGHLRPSRITSRWLLDPGTRERLDQAAAADDLTTLTKDPT"
FT   gene            complement(508882..509676)
FT                   /locus_tag="Ksed_05140"
FT   CDS_pept        complement(508882..509676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05140"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05584"
FT                   /db_xref="GOA:C7NL42"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL42"
FT                   /protein_id="ACV05584.1"
FT                   /translation="MTQPLTHEFSGDWSGQLVATSIHGGHGLREDTAAAMRLDEDTRLR
FT                   EEDPFTDRIGSGAAAQVVVHHSRFEVDLNRPREEAVYLRPEDAWGLDIWTDGELDATAT
FT                   ENSLAQYDRFYAELGERLDELAARGPFVVYDVHSYNHRRDGEDDPGADVADNPEVNLGT
FT                   GTVDEHWRPVVEAFTRSLEAQEVAGHRLDVRENVKFEGRALAWFVHERYPDTGVCLALE
FT                   FKKTFMDEWTGVPDEAHLDALREALAATHAPVLEALREVGPR"
FT   gene            509915..512851
FT                   /locus_tag="Ksed_05150"
FT   CDS_pept        509915..512851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05150"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 5 (chain
FT                   L)/multisubunit Na+/H+ antiporter, MnhA subunit"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains; NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus; Domain related to MnhB subunit of
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05585"
FT                   /db_xref="GOA:C7NL43"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL43"
FT                   /protein_id="ACV05585.1"
FT                   /translation="MLIAVALHFLAALAAPLLAPRLGRWIFPLLAVVPAGTAVWALAQS
FT                   TAARSVAPPSERLEWVPSLSLALAFRLDPLAWLMTLVIGVVGALVLLYCTGYFSDDDEG
FT                   LGRFAACLTAFAGAMVGLVTADDVLLLYIFWEITTVLSYLLIGHTSRLKASRVAASQAL
FT                   VVTTFGGLAMLVGLVMLAEHVGSYRLSVIVAEPPAATTTVAVAVGLVLVGAMSKSALVP
FT                   FQFWLPGAMAAPTPVSAFLHAAAMVKAGIYLMARMAPGFSDLAVWRWMLVVGGGATMLL
FT                   GAWRALRQTDLKLLLAHGTVSQLGFLALLLGIGNGDAALAGVALIVAHALFKSSLFLSV
FT                   GVIDHATGTRDVRLLSGLRRSMPWTYWSCVLALASMAGLPPLYGFVAKEAAIGALQHGG
FT                   PAPGDAVSTAALVVVVLGSALTFAYSARFLLVGLGDHAPGIPGKKAATVPTPVTRQPVW
FT                   AVAVPAVLAAAGLVLAPLATRLEPWLAAAGGPWPKTPEPAHLLFVPHPGIPLLLTGVVI
FT                   VLGVLLVVARRPVAVAQRSMPELVSSERGYRWAMRMLERSANETTGFIQRGSLELNLAL
FT                   IFSMVVLLPGAALVTGVTWPAEVRVFDSAAQLAVALIVGGAAIAAARSRRRLRGVFLVG
FT                   VTGYGVAMLFLLHGAPDLALTQVLVETVSIAVFVLVLRRLPVKFRDFSTRLDRRLRWAL
FT                   GIAVGLVMFLLALTAAAVRQAPPASGILADRAKSYGGGENIVNVILVDIRAWDTMGELS
FT                   VVLVAATGVASLVFLRSERASTSWERIRNARGRRRSHAAASSDGRRWIPDAGSLPWGGR
FT                   SLMLEVATRVIFHAIIVWSLYLLLAGHNHPGGGFAAGLVAGLALLLRYLAGGRAELGAA
FT                   LPVVPGWLLGTGLFLSAGTGLLSMLVGGHVLQTWVFDLHLGPLGDLHLVTSTAFDVGVY
FT                   LVVVGLLLDIFSSLGSALDRDIHHEDQPADRSARLLDAEYADHEEASR"
FT   gene            512848..513330
FT                   /locus_tag="Ksed_05160"
FT   CDS_pept        512848..513330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05160"
FT                   /product="multisubunit Na+/H+ antiporter, MnhC subunit"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05586"
FT                   /db_xref="GOA:C7NL44"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL44"
FT                   /protein_id="ACV05586.1"
FT                   /translation="MIPSLTLCLLVGVLSACGVYLFLSRSLVRILFGMLLMGNAINLLF
FT                   MVSSGEPGRAPITRLYQASEMSDPLPQAMVLTAIVISLAMSAFVMALAHRSWQLSHTDL
FT                   VQADTESARISRRAEANTYTDEVFSEASTDDGEGDEDDDAEDDTRTHRDQEQGGVA"
FT   gene            513327..514892
FT                   /locus_tag="Ksed_05170"
FT   CDS_pept        513327..514892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05170"
FT                   /product="formate hydrogenlyase subunit 3/multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /note="PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05587"
FT                   /db_xref="GOA:C7NL45"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL45"
FT                   /protein_id="ACV05587.1"
FT                   /translation="MNLTPDMLVPLPVVVPLTAAGMTLVATRRTRTQRLITVSALTLTV
FT                   AVSAALVYLSDTRGPQVVNVGGWSPLEGIVLIADRLASLMLLVSVVVTLAVVLFSIGEG
FT                   RSSFDEESDGQAPLAIFHPTLLVLSAGVSTTFLSGDLFHMYVGFEMLLAASFVLLTLGG
FT                   TRERVRAGVNYVAVSLVSSLVFLSAIALVYAAAGTVNLAHLAYRLSSVDADTRLALELM
FT                   LLLGFGIKAAVFPMSGWLPDSYPTAPASVTAVFAGLLTKVGVYAVIRTEVLLFPDDRVS
FT                   PMLLVAAALTMVVGILGAVVQDDIKRMLSFTLVSHIGFMIFGIALGGELGLSAAIFYMV
FT                   HHILIQSSLFLVAGLIERRGGTTSTMRLDRLATTSPLVAILFFVPAMNLGGIPPFSGFV
FT                   AKVGLIEAGVADGGWLAYTLVAASVVTSLLTLYALSRTWARAFWRPPFSEDGRPLRDLP
FT                   DPDRDVSQALVPGVVTPTILLIVVGLALSVGAGPLFALTDRAAYDLLETVVYTQAIFPE
FT                   GVPQ"
FT   gene            514889..515509
FT                   /locus_tag="Ksed_05180"
FT   CDS_pept        514889..515509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05180"
FT                   /product="multisubunit Na+/H+ antiporter, MnhE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05588"
FT                   /db_xref="GOA:C7NL46"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL46"
FT                   /protein_id="ACV05588.1"
FT                   /translation="MSSASLGRAWRDRVDLRAVVLLTSLWLLLWGSLGWLDLIGGVVVA
FT                   VLVCLFFPLPRLEVPLAFRPVALARLGAHFVGDLTVASASVAWTVFTARRPPSGTLFEV
FT                   PLRSTDELFVATTAGMTTLVPGSVVLDIDRSVGTLLVHGFAVYTPEEQQAFRHRVWRQE
FT                   ELLLKALDPKCEQVLVCEPGEPIAGQSALTGRVRRGASEEGEE"
FT   gene            515509..515799
FT                   /locus_tag="Ksed_05190"
FT   CDS_pept        515509..515799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05190"
FT                   /product="multisubunit Na+/H+ antiporter, MnhF subunit"
FT                   /note="PFAM: Multiple resistance and pH regulation protein
FT                   F (MrpF / PhaF)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05589"
FT                   /db_xref="GOA:C7NL47"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL47"
FT                   /protein_id="ACV05589.1"
FT                   /translation="MAETILIWGVGIVLAVSGVLTLARVVTGPTMLDRVVALEVLMGIL
FT                   ICSLGVEAAVHRHTTTLPVLVSLSLIGFLGSVSVARFVRKQDAPVSQEVDR"
FT   gene            515796..516287
FT                   /locus_tag="Ksed_05200"
FT   CDS_pept        515796..516287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05200"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="PFAM: Na+/H+ antiporter subunit; TIGRFAM: monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05590"
FT                   /db_xref="GOA:C7NL48"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL48"
FT                   /protein_id="ACV05590.1"
FT                   /translation="MSLLDLADVVGLLCLLGGAVLCLSAAVGLWRFNDLFSRMHAGSKP
FT                   QVLGVLLVALGIGLRTRELGDVGMLLVMAACHLITVPVAAQMTGRAALRIGQADSEGPV
FT                   VRAWEERMAMLESLEEQESRLQEEDADAGQDPWEAWREPERESGAAEQDEPAPQDGPRA
FT                   "
FT   gene            complement(516309..516992)
FT                   /locus_tag="Ksed_05210"
FT   CDS_pept        complement(516309..516992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05210"
FT                   /product="uncharacterized conserved protein"
FT                   /note="TIGRFAM: uncharacterized Actinobacterial protein
FT                   TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05591"
FT                   /db_xref="GOA:C7NL49"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL49"
FT                   /protein_id="ACV05591.1"
FT                   /translation="MQLPHRRRSHLRADSPRPADHDVWRLVHAERRALIDDLAGLTPEQ
FT                   WETPSLADGWTVHDVAAHLIDNARATPWRFTVGMVRARGDLDRQNRAGVEAERRPTPAA
FT                   TLDALRSVAGRTSGPPTWMAPVASRLVEEIAHGEDIRRPLGIRHFYPIPAVQQALAYQL
FT                   RAPVSMGGAPAEMRRVRLVATDAAITVGEGPEVHGRLLELLMAATGRPWHQGALTGDGV
FT                   GLLGG"
FT   gene            complement(517137..517658)
FT                   /locus_tag="Ksed_05220"
FT   CDS_pept        complement(517137..517658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05592"
FT                   /db_xref="GOA:C7NL50"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL50"
FT                   /protein_id="ACV05592.1"
FT                   /translation="MVTLLVGGLAIPGLLTLAHTTTRLDIWQFLTLALPVALAWSLASR
FT                   DDPREVRAQRPSGVLDAAWVAAVTGLSIGMTATLIFALGGEGSLRGALFLLWNLAFSAG
FT                   LASVLMRWVSPATSALITVVCSLALYTARFVFSPTAALIHAETPVALAVAASAIVFAAG
FT                   LVAVAVRRRS"
FT   gene            complement(517685..518884)
FT                   /locus_tag="Ksed_05230"
FT   CDS_pept        complement(517685..518884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05593"
FT                   /db_xref="GOA:C7NL51"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL51"
FT                   /protein_id="ACV05593.1"
FT                   /translation="MKALTTLRWSRAPWLALLAVGGTVLFIAGTRFPHSYTADVFSRID
FT                   FTLRALAPLTAAGAAYLTAEIAEYVSRHRAGRSWWAGVLRAVWPAVAIPAVVYSSALAW
FT                   GLIVKAGALPSPATWAMAGLNLAALVTWGLVGVLVGSTGQRLAAPVLAVAVHLFYAFLP
FT                   AMTTPWLRQLPGVQTGCCATDTAPGWGFMATGALFYGLLAVGCVAAGLLSARRWAGLLA
FT                   SLAVAGGAASALAINSTGSDEYVMSVPRTDPLVCQEGHPTVCLWPEHQDRLPQVSQALA
FT                   QAQQTLTEHGAPALSDRISEHEGDGAGPLGYRRDLSEAPMVTNAAYISLAQQAGREKCG
FT                   KTGLRSAAVAMALAAGHELKDIYPYEKPPQSMRELSRQPVDQLIARAQRDLLTVAECAR
FT                   "
FT   gene            complement(518881..519600)
FT                   /locus_tag="Ksed_05240"
FT   CDS_pept        complement(518881..519600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05240"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05594"
FT                   /db_xref="GOA:C7NL52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL52"
FT                   /protein_id="ACV05594.1"
FT                   /translation="MTLRAENISVGYRRKVVFEELDWTLRPGDRVVLLGPNGAGKTSLM
FT                   KTCAGLLRPRGGRVATHEHEAATPQELAEAVALMPQQITAVPRLSCREQVAYAGWLAGL
FT                   PTSEAEQRADGALVAVGLTDQAATRSKALSGGQLRRLGLAESLVRRTGVLLLDEPTAGL
FT                   DPAQRARFRRVLADLPPENTVVVSTHETHDIAEAFTRVCILDSGRFVFDGSPEELLERT
FT                   GAHTIELAYAQIMENAA"
FT   gene            complement(519664..520032)
FT                   /locus_tag="Ksed_05250"
FT   CDS_pept        complement(519664..520032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05595"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL53"
FT                   /protein_id="ACV05595.1"
FT                   /translation="MKSPMRAGAAALALTTLAIAPAAAEAGGFTSFIQGAQAGFLSQVW
FT                   HDYDHDNVDTKIYFGSCDRSRQEVGVYRQQFGIDPNYGTRVLCGGRTGMWGDMPADDYR
FT                   FKLESGSYIDVGIVRVSW"
FT   gene            complement(520188..520991)
FT                   /locus_tag="Ksed_05260"
FT   CDS_pept        complement(520188..520991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05260"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05596"
FT                   /db_xref="GOA:C7NL54"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL54"
FT                   /protein_id="ACV05596.1"
FT                   /translation="MSTPSRGILVTGSSRGVGAATARAFAERGDRVVVHCHRNQDAARA
FT                   VCEALPGTGHTVLSADVADPDAVEQLARDAIAHLGRIDVLVNNAALATPPDEGRGRRGD
FT                   HPLEDTDYDDWVAIWQQTLATNLIGPAALTHQVARHMIDTPPADGLPTGRIVNIGSRGA
FT                   VRGEPDIPAYGASKAGLHAFGQSMAVRLGRHGIAVTTLAPGFIETDMTRDLLATEAGEG
FT                   LRTQSPFGRVARAQEVAAAVVALADPGAEWASGTVVDFNGASHLR"
FT   gene            521294..522052
FT                   /locus_tag="Ksed_05270"
FT   CDS_pept        521294..522052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05597"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL55"
FT                   /protein_id="ACV05597.1"
FT                   /translation="MEVMNQEQHRVLGSVAAANAGGYRPVESEVKLWLASPVPAEASLV
FT                   SVLPTGWNKQWMRVDEGIVKHLIRIQWLQKVGGGVEVTPLGKSLLRWAEAASSDAGQVV
FT                   TLDHRDPLSYAVLIGELAAAGRATLVDPYLDLNGLVDVARNTSIDRVLVGEKDSRKKAA
FT                   LTTLVDSNQGLQVDVRSQPDLHDRLLVADDGRVWTIGASLNTVSRRTAFTIMTPLPQKA
FT                   AQVIGDEVRSWWGKGTPLVREGDPNESSDG"
FT   gene            complement(522214..523510)
FT                   /pseudo
FT                   /locus_tag="Ksed_05280"
FT   gene            complement(523889..524479)
FT                   /locus_tag="Ksed_05290"
FT   CDS_pept        complement(523889..524479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05290"
FT                   /product="dihydrofolate reductase"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05598"
FT                   /db_xref="GOA:C7NL56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL56"
FT                   /protein_id="ACV05598.1"
FT                   /translation="MTHQRRNWTGRVFIGASLDGFIARRDGEIDWLTDPPPGPQHATVT
FT                   SSTEVAGWDTFFPSIDHLVMGRGTYEKVLTFDGWPYGGKKVIVMSTTLESDDDRITIAR
FT                   SLDNAQRTLAASGARQVYVDGGMVVQEFLRADLIDEISIGWAPVLIGSGRPLFGHLDHD
FT                   LQLSLVATNASASGMVHVTYAVHPHQAQTDGGK"
FT   gene            complement(524476..525024)
FT                   /locus_tag="Ksed_05300"
FT   CDS_pept        complement(524476..525024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05300"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05599"
FT                   /db_xref="GOA:C7NL57"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL57"
FT                   /protein_id="ACV05599.1"
FT                   /translation="MARPRRHDQQVLLERIGIALEERRSLEPWTLADIAPSAGLSPAGL
FT                   LKRFGSRQGILLALSRRWAESIPEAPLGKNPPEVELRTWVEFRFSADGSGGVAQGLVNL
FT                   LDDLMDDELRALLAEGWAKEIRYLAALLSQMNRPRDGDANRCAALLFDALNGAMLRRAT
FT                   EPTAPGPEQVLDHLLEVWT"
FT   gene            complement(525237..525389)
FT                   /pseudo
FT                   /locus_tag="Ksed_05310"
FT   gene            525540..525884
FT                   /locus_tag="Ksed_05320"
FT   CDS_pept        525540..525884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05320"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05600"
FT                   /db_xref="GOA:C7NL58"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL58"
FT                   /protein_id="ACV05600.1"
FT                   /translation="MTPDDHADSKHPATADLSLTRVLSALSDPLRLGIVCLLSDGHERQ
FT                   WGELDAPVSKSTLSHHMKTLRSAGITRTRDEGTRCYVHLRADDLEARFPGLVSSLLSAA
FT                   PGEATKVGLK"
FT   gene            complement(526009..526410)
FT                   /locus_tag="Ksed_05330"
FT   CDS_pept        complement(526009..526410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05601"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL59"
FT                   /protein_id="ACV05601.1"
FT                   /translation="MTRSPQTAQAIPFSTTCDQIAWEQTNPDGTRSATLVGTRQPGVTF
FT                   TYAFFIPAGVWDQPHSHLSDARLVVARGELRLGYGHRLDRDAATQHPVGSFLHVPGGAT
FT                   HFDGAEVDTILIGTAVGPWSTDYANIRPR"
FT   gene            526636..527902
FT                   /pseudo
FT                   /locus_tag="Ksed_05340"
FT   gene            527928..528353
FT                   /locus_tag="Ksed_05350"
FT   CDS_pept        527928..528353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05602"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL60"
FT                   /protein_id="ACV05602.1"
FT                   /translation="MWASYKTTQVNHIDDVFAIAAQANTLLKLLNHHYEKAGITQLSIG
FT                   IGVEYGRVLMIKAGYSGSTINDVVYMGDVVNRAAHLAHLAGRGWGSSPIVVGDVFYSNL
FT                   NENNKSLLRPQWTSSIGTVYQGNPIIPPMDDWISSLS"
FT   gene            complement(528529..529893)
FT                   /locus_tag="Ksed_05360"
FT   CDS_pept        complement(528529..529893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05360"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05603"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C7NF70"
FT                   /protein_id="ACV05603.1"
FT                   /translation="MMSGLLPPLISRTSTMPNHSCVCPDALDRCDRCDLLLDFPSLHLV
FT                   AVTKARAGLVLEVESCDPVAGCPGCGVVATGHGRITIEMIDAPWAGRPVRIRWRKRRWI
FT                   CLESVCAVTTFVEQDPEVCAPRGLLSTRAIRWAIGQLRRVGATIQGLARQLGTTWNTLW
FT                   SQVQPVLAQAAGDPSRFEGVQVLGVDEHIWHHRDPRRRGPKELTGMVDLTRGTHPTARL
FT                   LDLVPGRSGKAYRDWLDERGEEFRKRVEIATLDPFQGYKNAIDDQLEDATCVLDAFHIV
FT                   KLAGAAVDDVRRRIQQETLGHRGRKGDPLYGIRHVLRAGRERLTPRQQTRLASAFAAHP
FT                   DHVAVEVAYQCAQDLRDVFHQPTHAQGRRLAEQLIEKLPSCPIPEIARLGKTLRRWKTA
FT                   FLAYFDTDGASNGGTEAVNGIIELGRRIARGFRNFEHYRLRMLLIAGGLDASPHT"
FT   gene            complement(529919..530512)
FT                   /locus_tag="Ksed_05370"
FT   CDS_pept        complement(529919..530512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05604"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL62"
FT                   /protein_id="ACV05604.1"
FT                   /translation="MSLKDELDAYVQKTVDEQWERRAGQKVPDADDLPLKNLAVELDAT
FT                   VLYADLASSTKMVKGHNDWFATEVYKSYLYCAAKIIRARGGIITAYDGDRVMGVFIGDS
FT                   KNTDAAKCGLQINWASKKIVAAKIAEKYPKSTFVLKQRVGIDTSKLFVARTGIRGSNDL
FT                   VWVGNAANNAAKLAALDPRYRLFRVECGRAAGAG"
FT   gene            complement(530760..532046)
FT                   /locus_tag="Ksed_05380"
FT   CDS_pept        complement(530760..532046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05605"
FT                   /db_xref="GOA:C7NL63"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL63"
FT                   /protein_id="ACV05605.1"
FT                   /translation="MILIASLVVLAMVLPKWRGVALPALRTFASSLFKWAVLRVFGLLI
FT                   VWVALWVVLAWLLGIWQMKLLKDTVVIVVGVGFPLLFKSIGAKSGVEILDHVRRETLTL
FT                   STLFLFYLNLESLPLWGELIAQPVIFLLAAMTAFAQHDEKGQRVLGCFSIPLVLIGLGL
FT                   LAWTTAQTLNKWDELVWPDLLAPLALSVWLPFAMFPYLYAVAFYAATEVILKRLLWTNE
FT                   ELPVRARLGVYAGLHGSVRWAKELTGRYNDVARATTFRGALSEMRDFRHDVTRREQLEA
FT                   DRLSDLETFSGQAGVDETGAQLDRREFYGTKRALQFIHTAQALRYERRGETFWDDLTDM
FT                   VISPVSKWGLPDQHGIVVQTTNDKKKWRAWRRLPSGWVLGIGATGRFGEYRYAGAEPPT
FT                   TWPGASDEWTDSAIALGPVDWDRNDGPRL"
FT   gene            532624..533517
FT                   /locus_tag="Ksed_05390"
FT   CDS_pept        532624..533517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05606"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL64"
FT                   /protein_id="ACV05606.1"
FT                   /translation="MTAYDQVATRTAEEVHVRTVLAVGNRHSVLRREDGTVIATGNNQA
FT                   GECDVLPWSDVIAVAAGSVHTARNTGKSHTMGLRADGTALATGWSDAGQTAVTQWREIT
FT                   AIAAGWRTTVGLRADGSVVATGRTAEGQCDVQLWSGIVAIACGDWHTVAVRRDGTALAT
FT                   GNNQRGQTDVARWTHVSGVSAGYLHTVGLHEDGTVVAVGDDSRGQCEVSSWRSITSVAA
FT                   GSVHTLALSQTGRVFGTGDNQFGQCDVQSWTGITAIAAGARHSLGLRADGTVVAAGDHT
FT                   EQQCNVNAWATRPQMN"
FT   gene            complement(533666..534490)
FT                   /locus_tag="Ksed_05400"
FT   CDS_pept        complement(533666..534490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05400"
FT                   /product="short-chain dehydrogenase of unknown substrate
FT                   specificity"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05607"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL65"
FT                   /protein_id="ACV05607.1"
FT                   /translation="MRTIVITGASDGIGAAASRQLAETGARLILVGRSPEKTSAVAAAT
FT                   GAEHYVADFARLDDVRRLAGELNEVCERIDVLANNAGGMFSGPTVTQDGFEKTFQINHL
FT                   APYLLTHLLIDKLLDSRAAVVNTSSIGARLFGHIDLEDLNNWEGFSPNKAYGDAKLANI
FT                   LFTKELHERFHGRGLSSVAFHPGNVATNFASDTDSYFQRVYHGALRAFLISPEQGGARL
FT                   RHFIEGQPGRAWTSGEYYGAPGRIGRTNRQAYDAGIAVEHWRRSAAMLSIDW"
FT   gene            complement(534487..535449)
FT                   /locus_tag="Ksed_05410"
FT   CDS_pept        complement(534487..535449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05410"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05608"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL66"
FT                   /protein_id="ACV05608.1"
FT                   /translation="MTMEQTVVMTGASRGIGRTAARRLLAGRPQAHLVLLSRTVPQALV
FT                   DELRAAGGSVTVIRADLSSLRSVSEAADEVVELVHPGRLPPIGALVCNAGVQLTNALTE
FT                   TVDGFEATFAVNVLANHVLLRRLQGHLPPSARVVVTVSDTHFGDLRHNLGMVPGPLWHP
FT                   VETLARVAAFPDPSGSTAGRAAYSTSKLAAIYLVHEYARRLPTGLTITSFNPGFVPGTD
FT                   LARDADAISRFAMRRVMPLLTLTPLATSPSLAGRFLADAVLGTVSAPTGAYIDRDRVAA
FT                   SSPASYDRQREREAWEAVEALTARFLPSDADPNPGRENR"
FT   gene            complement(535446..536012)
FT                   /locus_tag="Ksed_05420"
FT   CDS_pept        complement(535446..536012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05420"
FT                   /product="transcriptional regulator, tetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05609"
FT                   /db_xref="GOA:C7NL67"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL67"
FT                   /protein_id="ACV05609.1"
FT                   /translation="MEAVLSLLADEGYARLTTAAVAKRAGVSTATLYRRWPSKRELLLA
FT                   AAGQIGEAEADDVDTGTVEGDLRALLAHKRAVLSGRIGATLVALVGESAHDRELAAIVR
FT                   TSILEPTREHLEAIFDRAAARGEAVGADAASAAHLVVGTVLARVAFAEGAGHDDLLPGS
FT                   DVTLLIQAIAGDTAQPGPGGRARRR"
FT   gene            complement(536702..537952)
FT                   /locus_tag="Ksed_05430"
FT   CDS_pept        complement(536702..537952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05430"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05610"
FT                   /db_xref="GOA:C7NGD4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7NGD4"
FT                   /protein_id="ACV05610.1"
FT                   /translation="MTAPHIVDPAGLLSEALAEASPDLMRHLLQQTINALLSADADAVV
FT                   GAEYGRPSTTRTAQRNGYRHRDLDTRVGTIDVAVPKLRTGTYFPEWLLERRKRAETALI
FT                   TVVADCYLAGVSTRRMDKLVKTLGIDGLSKSQVSRMAAELDEHVEEFRHRPLDTAGPWT
FT                   FIAADALTMKVREGGRVINTVALIATGVNNDGHREVLGLRVATGETGAAWNEFFADLVA
FT                   RGLTGVQLVTSDAHTGLVEALRANLPGATWQRCRTHYAANLMSVTPKSMWPAVKAMLHS
FT                   VYDQPDAPAVDAQFDRLLDYVQTKLPEVHAHLDAAEADILAFTNFPKDVWSQIWSNNPA
FT                   ERLNREIRRRTDSVGIFPTRQAVVRLVGAVLAEQTDEWAEGRRYLGLDLLARCRMHLIP
FT                   TPQEDTTTTTELPALTA"
FT   gene            complement(538064..538252)
FT                   /locus_tag="Ksed_05440"
FT   CDS_pept        complement(538064..538252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05611"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL69"
FT                   /protein_id="ACV05611.1"
FT                   /translation="MTSAGMHVTEQMGSVDDLVVALAKPVRRIRSHRGQKHRPGLFWSA
FT                   TTGDHVPYESWLELDRS"
FT   gene            538776..539216
FT                   /locus_tag="Ksed_05450"
FT   CDS_pept        538776..539216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05450"
FT                   /product="ketosteroid isomerase-like enzyme"
FT                   /note="TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05612"
FT                   /db_xref="GOA:C7NL70"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL70"
FT                   /protein_id="ACV05612.1"
FT                   /translation="MNTRDSQAEREIRELHEEWFAASARKDLDATMTPIAPSIISYEHS
FT                   PPLQHTDVTEIREECRQGFDYQGDDFSWTVPDLQVMVREDLAVAWGLNRMASTNADGTI
FT                   MVSWSRGTRVFRRTENGWRMVHQHVSFPVDPETGIAAMELTP"
FT   gene            539213..539602
FT                   /locus_tag="Ksed_05460"
FT   CDS_pept        539213..539602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05460"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05613"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL71"
FT                   /protein_id="ACV05613.1"
FT                   /translation="MNEPDIRTLITEWARAVQEEDLDGTLAHHSDDIVMFDVPGPEQGR
FT                   RGLDDYTASWYPFFEWVRTGARFEITELHVEHGDDHGFAWALLRCGTPDDLAQNPSRRL
FT                   RLSFGLRRREGTWQISHEHHSFTHP"
FT   gene            539599..540546
FT                   /locus_tag="Ksed_05470"
FT   CDS_pept        539599..540546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05470"
FT                   /product="RNA polymerase sigma-70 factor, TIGR02960 family"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4; Nuclear
FT                   transport factor 2 (NTF2) domain; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family; RNA polymerase sigma-70
FT                   factor, TIGR02960 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05614"
FT                   /db_xref="GOA:C7NL72"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL72"
FT                   /protein_id="ACV05614.1"
FT                   /translation="MSAGQSEKASVEAEYGALFDAHRREIVAHCYRMTGSFTDAEELAQ
FT                   ETYLRAWRSRAQFDGRASGRTWLYRIATNACLDFLKSHERRTGPHASVAEILETEGGIS
FT                   PHPDHVDPAELVARKESTSLEVMAALLDLPVRQRAVLIARDLLEFDTAETAKLLDCPPT
FT                   AVNSLLQRARARTRRLGADFAPHLEADDAPAVAQLVRAYLEAHGRGDITAVVELFTADA
FT                   RLSMPPEDPCVGRPEIHEFYAYLLDPANIGYWHLMETRANGAPAIANYIAPSPAGPFTA
FT                   LSIDVLRVDNRKISAMHSFLDASHFPTFGLPLTA"
FT   gene            540673..541815
FT                   /locus_tag="Ksed_05480"
FT   CDS_pept        540673..541815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05480"
FT                   /product="penicillin-binding protein, beta-lactamase class
FT                   C"
FT                   /note="PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05615"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL73"
FT                   /protein_id="ACV05615.1"
FT                   /translation="MEQIRRMLQEQVDAGILPGAVALRSRHGHTDIAAVGVQDLEFRIP
FT                   MSSQTLFHWDSLGKPFTAALTLSFVADGSLDLDSPIESWLPELSGQRVLINPGGPLSET
FT                   EPAHRPVNVQDLLTMRGGLGFTTDFESPFTEALMTELQEGPEPRSLDRESFLKAAGRLP
FT                   LAHQPGVGWTYNTGSTLLGLLLERVGDQSLDVLMAERLLEPLEMQDARWWVPPAELPRF
FT                   ASRYGRTDDARLPLQLIDPPEGLYSRPPSFPDGAGGLIGTADDWRAFGQMLLDGGQRRG
FT                   HQVLPEHLVTLLLTDHLTASQRRWAGFFLDGGEGWGFGGSVRSDGSYGWSGGAGTFGRV
FT                   NPDRGEVSILLTQVALEGPQGSLVISEFEELLNREQGDRQ"
FT   gene            542202..544097
FT                   /locus_tag="Ksed_05490"
FT   CDS_pept        542202..544097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05490"
FT                   /product="chaperone protein DnaK"
FT                   /note="PFAM: Hsp70 protein; TIGRFAM: chaperone protein
FT                   DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05616"
FT                   /db_xref="GOA:C7NL74"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL74"
FT                   /protein_id="ACV05616.1"
FT                   /translation="MGRAIGIDLGTTNSAMAILDGGEPEIIANAEGGRTTPSVVSFSKN
FT                   GEVLVGEVAKRQAVTNVDRTIRSVKRHMGTDWTTEIDGKKYTAQEISARTLQKLKRDAE
FT                   AYLGEDVTDAVITVPAYFDDAERQATKEAGEIAGLNVLRIINEPTAAALAYGLDKGKED
FT                   ELILVFDLGGGTFDVSLLEVGKDPEDGFSTIQVRATSGDNKLGGDDWDDAVVQHLLTSV
FT                   KNTTGVDLSNDKIAMQRLRDAAEQAKKELSSSTSTSINLQYLSMGENGPIHLDESLSRT
FT                   QFEQMTEKLLDRTKQPFEAVMKDAGVTIDEISHVVLVGGSTRMPAVTELVKKLTGKEPN
FT                   KGVNPDEVVAAGAAIQAGVLKGDRKDVLLIDVTPLSLGIETKGGLMTKLIERNTAIPTK
FT                   RSEVFTTAEDNQPAVGIQVFQGERELARDNKPLGNFELTGIAPAPRGVPQIEVTFDIDA
FT                   NGIVHVSAKDRGTGQEQSMTISGGSALDKDEIDRMVKDAEAHAAEDAKRREAAEARNQA
FT                   EQVVYSTEKFIADNGDKLPEAEKSEVDTALSDLKAVVAQEDADPEDLKAKTTAVSEASQ
FT                   KMGAAMYAAQSEAGDAGAQGAPGAEGAGDEQAADEDVVDAEVVEDDDQGTTDQSK"
FT   gene            544205..544831
FT                   /locus_tag="Ksed_05500"
FT   CDS_pept        544205..544831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05500"
FT                   /product="molecular chaperone GrpE (heat shock protein)"
FT                   /note="PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05617"
FT                   /db_xref="GOA:C7NL75"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL75"
FT                   /protein_id="ACV05617.1"
FT                   /translation="MTDQTDRPEEPQDDLDAEAQRLVEESRPEQVGDQAEMPEVTAEGA
FT                   PAFVDEAEPASGGEAAPEPHPDTLLAAERLEDLRRAQADHVNYRNRMERERAKDKDATI
FT                   GTVVEALLPVLDDVHMAREHGELTDGPFAAIATKLETTLERFGVRRVGAVGEVFDPTLH
FT                   EALMHTQAELPEGTTETTIVQVLQPGFVVGERVVRAARVAVADPA"
FT   gene            544908..545993
FT                   /locus_tag="Ksed_05510"
FT   CDS_pept        544908..545993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05510"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /note="PFAM: DnaJ domain; DnaJ C terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05618"
FT                   /db_xref="GOA:C7NL76"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL76"
FT                   /protein_id="ACV05618.1"
FT                   /translation="MASQDWFEKDFYKTLGVSPDADDAEIKKAYRKLARKNHPDQHPGD
FT                   EAAEQRFKEIGEAYQVLSDAEDREQYDAIRQMAAGGARFSAGGGPGGGGADGFEDVFSS
FT                   MFGGGGGGGQRVRFTTGGPGGAGMGGMGGRGGQSVDPEDLEDILRMFGGGGGAGFGAPG
FT                   GGAGFGPGGAGPRSAPTKGQDVESSVTVDLRQAMTGDKATVRQPDGSSTTIRIPAGVKD
FT                   GQKIRLKGKGHPSRTGGPPGDLMITVHVRPHPVFRREGDNLVLDLPVTFAEAALGATVA
FT                   VPTLDGQSVKVKLAPGTPSGRRLRIRGRGMPTKNGNGDLIAVVQVEVPAELSDAQREAI
FT                   EALRAADDSDPRAGLATRAAS"
FT   gene            545990..546424
FT                   /locus_tag="Ksed_05520"
FT   CDS_pept        545990..546424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05520"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05619"
FT                   /db_xref="GOA:C7NL77"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL77"
FT                   /protein_id="ACV05619.1"
FT                   /translation="MSRSPDTRPVYVISVAAELTGMHAQTLRQYDRMGLVSPSRARGGG
FT                   RRYSEADVERLREVQRLSSSEGVSLEGIRRILELTRANENLEARLAELDAEVQRLRTVL
FT                   EAGQRVFAASRRGGVEAVRQGQRPTRPASAGELVLWSPLR"
FT   gene            complement(546599..550537)
FT                   /locus_tag="Ksed_05530"
FT   CDS_pept        complement(546599..550537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05530"
FT                   /product="cell wall-binding protein"
FT                   /note="PFAM: Putative cell wall binding repeat 2; PA
FT                   domain; Subtilase family; Peptidase inhibitor I9"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05620"
FT                   /db_xref="GOA:C7NL78"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL78"
FT                   /protein_id="ACV05620.1"
FT                   /translation="MVTHRSLPRHATASAIAIAMAGVIAPATTAAPATQDASSAGTFAV
FT                   AHGEARDAAAKQEFTDGQYIVTFRDQPTVAYDGHLKGLAATSPAKGEKFDVQSAAVQKY
FT                   ESHLVQRQDAVLATVGAKNPVVRYTTALSGVGVTLTAEQAAELARSSEVISVAPEEMLE
FT                   LHTDTSPEFLGLTGENGVWNTGNGLKGEGMVVGVIDSGISHHNPSFAEGDMAPAPADWK
FT                   GVCATEAPQDFPSDACNNKLIGARFYVEGFGKSRIADHESLSPLDVGGHGSHTASTAAG
FT                   NEGVTATVNGEEHGVISGMAPMAHVAAYKVCWDEKGGDGGCSSLDSVKAIDDAVADGVD
FT                   VLNYSISGTSSNYIDPVEIAFMNAAANGIFVAASSGNSGPKASTTNHPSPWLTTVAAST
FT                   HRIAENTLVTGDGERYIGSSVTGGLPEAPMILAQDAKAASATAEDANLCKIGSLDPALV
FT                   AGKIVVCDRGVTARTEKSDVVAEAGGVGMVLINPTESSLDTDAHVVPTVHLSHTHRDVV
FT                   RAYASGEGATASILETNEGSTTEVPEIAGFSSRGPSLGGEGDILKPDVSAPGVGVLAAY
FT                   ATPERGADAFGYSSGTSMSSPHIAGLAALVKQANPEWSPMAVKSALMTTTRDHMSAASN
FT                   DPFATGAGFVEPRRMLSPGLVYDAGEQDWWDFLAGQGVTRGGKPVSENPIDASDLNQAS
FT                   IALGQLLGQQTITRTITNTTDATATWTGTIAGLEGVKATLSQSTVTLDPGESADVEITF
FT                   VDETLAKDAWTKGTLTWTAAGQNDVRSPIAVRAGDLKAPQLVEGKATDATIDIPMISGE
FT                   DRDVSIATRGLVKGDDVRGEVRLPSSRDDLVIDDPNNFRYDFEGSRYSTVWTEIIPDDP
FT                   SVDLDLYVTYKGMSLKVGQAATAGAAERILIPTLYLQDDYTVHVQAYDLGGADSTGFTL
FT                   RTFVLPEKGDAGNLTFANPFSLEQGVETNVPGTISVDDTSAPWFGKATTTPPNNSFRTL
FT                   AETYVLLEPGEKGEPGLERIEGRDRYATAAEISKKFGSSDTVYIASGMNFADAMSGTAA
FT                   AGAGIEGLQSLPDDADKEIPVLLTRPDRIPPQTTEALQSLGAKRVVLVGGETAISEKVA
FT                   DELAASGLSVERISGANRYETSANVAKSFRGDVETLYIASGDEKNYADALAGSALAGSQ
FT                   DVPVLLTRPDRVLPTTMHAVSTLKPKNIVVLGGETAVSPEVYETLGATERLAGSDRYGT
FT                   AVEIAKEFPAKSDFTGYATGMNWPDSLTGGAYAAKEGGPLLLTRPDRLPPVVSDYVTAN
FT                   PTTQNVIYGSEAAVSQNVEDALRGLLGL"
FT   gene            complement(550761..553649)
FT                   /locus_tag="Ksed_05540"
FT   CDS_pept        complement(550761..553649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05540"
FT                   /product="cell wall-binding protein"
FT                   /note="PFAM: Putative cell wall binding repeat 2; Subtilase
FT                   family; Peptidase inhibitor I9"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05621"
FT                   /db_xref="GOA:C7NL79"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL79"
FT                   /protein_id="ACV05621.1"
FT                   /translation="MLNSTSRRALSAVGVFGLTLGMVPVAAVATGDSAQPAAKDASSEA
FT                   STAKADTKRYIVTMAKPSLSATFKNSGATGRLNTQTAAAQSYTQKLEAQHATAAKAVGA
FT                   DMVFEYSTVINGFSADLTETQVAALTARGDVVSVTPVRIERLLDGPAAPSAFSANKPQT
FT                   DVSRDVIGLTGENGLWNQVGGPTEAGKGQVVAVIDSGITPDNPSFSDEGMPQAPSTWNG
FT                   ECEAGNDPANWSADKCNNKLVGARSYVDEMMAAYPGQEFGPDESNSPYDKNEQSHGSHV
FT                   AAIAAGAPVSVQGYDMVGVAPAAHIAAYKVCMDIVQDGQVFQGCLGDASVMAYEDAVQD
FT                   GADVINFSISNDDQYANDPVDEAMKGAADAGVFVAAAGGNYGPGTSNPVNVNNGLPWVT
FT                   TVAAANHREENGPVPSVPDWSSIGPVTDSPANQNLLAPSLGAPGVQVLSAINNDNWGWM
FT                   DGTSMASPHVAGMATVVAGARSDWSPMAIKSALQTTSTSYANDISNDPFVGGSGFIDGS
FT                   KVLNPGAVFDSGLADWNAFDGDRANGYQMNIASIQIGQLKSDGATAVTRSLTGVAEGSV
FT                   TWTATYEGPETLEVTAPDVTVAAGETVETEISVANTGAAADEWQKGWITYSADGQNDIR
FT                   VPVVARGPVTDSGTDPEPEPDNELMRWWGADRYGTAADIATKYGKADTVYIASGEGFSD
FT                   AMTGSTAAARGETLSMPDGGEDVPVLLTRNDRIPAQTTEALQTLGAKKVVLIGGETAIS
FT                   GEVADQFAAAGLTVERIGGEDRYETSANVAEKFGAGLDTLYVASGEDAAYADALAGSAL
FT                   AGMQNVPVLLTHPTEVAKSTQDAINELKPKKVVVLGGPAAVSDAVAQQLGASERLAGAN
FT                   RYETAAEIAEQFGDTDWTFVADGMDFPDALTGGAYAASVDSPVLLTRTAKLPTATSAYI
FT                   TANTTEKTVIFGGTAAVSQGVEAELKAILGIN"
FT   gene            554052..556649
FT                   /locus_tag="Ksed_05550"
FT   CDS_pept        554052..556649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05550"
FT                   /product="ATPase with chaperone activity, ATP-binding
FT                   subunit"
FT                   /note="PFAM: C-terminal, D2-small domain, of ClpB protein;
FT                   ATPase family associated with various cellular activities
FT                   (AAA); ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05622"
FT                   /db_xref="GOA:C7NL80"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL80"
FT                   /protein_id="ACV05622.1"
FT                   /translation="MDLQPTTLVSEVLAIAQREAQAAGHAEITPAHVAAATVALGDATV
FT                   SSLLAAGGTSPEAVAAATRSTLSSLPTATGQTPQLGQQALRLLQQAHTIMTARGDTHLA
FT                   VDVLTLALVETGAITADAAAVSAELDALRGGTKVTSENPQNGSEALEQYGTDLTALARE
FT                   GALDPVIGRDSEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQRIVDADVPESLR
FT                   GKRLISLDLGAMVAGAKYRGEFEERLKSVLEEIKASDGQIVTFIDELHTVVGAGGTGDG
FT                   SMDAGNMLKPMLARGELRLVGATTLDEFRENIEKDAALERRFQQVFVGEPSVVDTIAIL
FT                   RGLKERYEAHHKVTIEDSALVAAATLSDRYITHRQLPDKAIDLIDEAASRLRMEIDSSP
FT                   MEIDTLRRAVDRLAMEEMHLAAETDEASRERLAALREDLAAKREELSNLNARWQAEKTG
FT                   LNRVGELKAQLDEARTQAERLQREGDYAGASKLLYGDVPALEAQLAEAEGRDAGRGPDA
FT                   EGDAPASGQVGDATAPMVSDAVTADDIAEVIAAWTGISAGRLLEGETEKLLRMEEFLGE
FT                   RLIGQTAAVRAVSDAVRRSRAGLADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDER
FT                   AMVRIDMSEYSERHAVARLVGAPPGYVGHDEGGQLTEAVRRRPYSVVLLDEVEKAHPET
FT                   FDILLQVLDDGRLTDGQGRTVDFRNTILIMTSNLGSQYLVDPSLDPAVRTESVMAAVRA
FT                   HFKPEFLNRLDDTVVFEPLSREELARIVDLQVDALASRLAARRITLQVTDAARAWLADQ
FT                   GYDPAFGARPLRRLVQTEVGDTLARALLAGEVRDGQEVTVDVADDAEGGLRLV"
FT   gene            complement(556735..557646)
FT                   /locus_tag="Ksed_05560"
FT   CDS_pept        complement(556735..557646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05560"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05623"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL81"
FT                   /protein_id="ACV05623.1"
FT                   /translation="MNEQTNNASDSPAVDPVTRFESITPPEQDQDFPGLDTELDPVPDL
FT                   GEDSYRGSGRLEGRKALVTGGDSGIGAAVAIAYAREGADVAINHLPAEQSDADRIIALI
FT                   EAEGRTAVSIPSDLTTREACDDVIAQAVEGLGGLDILVSNAGKQVSTPEISQISDEQFD
FT                   LTMKTNVYAMFWLCRAAVEHLGTGSSIIITTSVQAYSPSEHLLDYAATKAAENAFGKAL
FT                   SKQLAPKGIRVNLVAPGPIWTVLQAVEGQPEEKLPKFGKDQPLGRAGQPAELASAYVFL
FT                   ASPEASYVVGETLNVNGGADSP"
FT   gene            complement(557789..559231)
FT                   /locus_tag="Ksed_05570"
FT   CDS_pept        complement(557789..559231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05570"
FT                   /product="predicted flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05624"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL82"
FT                   /protein_id="ACV05624.1"
FT                   /translation="MTRCTVAVVGAGFGGVSVVDALARQGIHDVVVVDERGGVGGRWLD
FT                   RLDPGARSRGSLSESTLPGRPRTPAESSPFADAMRSYLQRVAAWTSMGERLLTDRVASA
FT                   TQAGDGSWTLHLGSGDTLEAQFLVLATGLEGDPLVPEIRGTNAFEGPLLHTHVWDPAAE
FT                   LDGQHVAVLTHPTAGHLAPLEHVHTAAALAEGASRVTVFSPDQPWILPERPTTDPVDLV
FT                   MSNSRVRTAGDRARRVNQVVRTALPAPARAPWDAAETVLRPSPMPWQRAMHDATRLARQ
FT                   HLEPQALEHHHASTPVSRGTVRSEAWFRGVTQGRLDLLRIGIHRITPDAVVDVNGTRHR
FT                   VDAIVLATGAESVGPGHGIEGLDPATGGLLADWAPHLGTLGRVANLMVTGGPASDLPVG
FT                   GDAEVFGARADLVARLIGTTIRRGAQTVRATPLAVERWERRVRELQRDAGLERVVEAVM
FT                   WPGQRRDLVRLLRGAPEDFVLG"
FT   gene            complement(559228..560073)
FT                   /locus_tag="Ksed_05580"
FT   CDS_pept        complement(559228..560073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05580"
FT                   /product="Exodeoxyribonuclease III"
FT                   /note="PFAM: Endonuclease/Exonuclease/phosphatase family;
FT                   TIGRFAM: exodeoxyribonuclease III (xth);
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05625"
FT                   /db_xref="GOA:C7NL83"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL83"
FT                   /protein_id="ACV05625.1"
FT                   /translation="MRIATWNVNSLRARLDRVAEFLQRHEVDVLALQETKVQDDKFPAE
FT                   RFAELGYEIAFHGLNQWNGVAIASRVGLEDVTVAFPDQPGWGDEPVVEARALGATVGGQ
FT                   PRADGSATPRIRLWSLYVPNGREIGHPHMDYKVGWLDTLAGHAGTWAGEDLPLALVGDF
FT                   NVAPLDTDVWDIAAFEGHTHVTEPERAAFQGFLDAGLVDVVRPHTEPDTFTYWDYQQLR
FT                   FPKRQGMRIDFVLGSQPFADRVTGAFVDREERKGKGASDHAPVVVDLAIDLPTGTRDTP
FT                   "
FT   gene            complement(560091..560684)
FT                   /locus_tag="Ksed_05590"
FT   CDS_pept        complement(560091..560684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05626"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL84"
FT                   /protein_id="ACV05626.1"
FT                   /translation="MAAKDPTPDLPEGVEITHDHTGSTLRITGARPVRALAHVARQHVI
FT                   ELLYDGRVLTASAAATAVGTTPSAMSYHLRALEKFGIVRRADSLDGRERPWRAAADHLA
FT                   VTHSALRQDDAGTETYLSTLLPTVERALRSASGIQVPTRFKRTTLQLTPQEAEQLNTEV
FT                   EALLDAWAARHATPSDGARTYTQFWIDAPTGPDA"
FT   gene            560751..562070
FT                   /locus_tag="Ksed_05600"
FT   CDS_pept        560751..562070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05600"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05627"
FT                   /db_xref="GOA:C7NL85"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL85"
FT                   /protein_id="ACV05627.1"
FT                   /translation="MKENLRNSASIWTEGDIRWILPARLAALLGSSALATALLLTTEGA
FT                   GRGAVGVALLMGAVTLPVVLTIGWTGRLADTRDSRQLLLAATAVQLAGLAGLVAAVRAP
FT                   GPGGGSETLWWWLTLGTVALVQTGHALELPVWPALTAKVVGDERIGDAMAWQQGLGVLA
FT                   APAGALLGAFAYSLGGVVAAAGITALCALAGGVAALAIRTRRGGGAATHPLATDEIAES
FT                   EDAEAPPTVSTLRWLVTHPVLGPILLVLTPLVLVGEAVNVVEVLLARQELGASAAQYGW
FT                   GEVAFGVGAVIGTWGVRRVTSDAARLVLFLGGFWVVSVLILVAGVVPSWWWYVGLAVPI
FT                   GAGNMAANVSSATLLMLHTPEARRGRVQAAFVGTVRAFSLGALAIGGLLGSALGPRGTY
FT                   VACGTAACLVMLAGSVWLHRAHRAARPSGRRPRRAATVVP"
FT   gene            562067..562957
FT                   /locus_tag="Ksed_05610"
FT   CDS_pept        562067..562957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05610"
FT                   /product="short-chain dehydrogenase of unknown substrate
FT                   specificity"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05628"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL86"
FT                   /protein_id="ACV05628.1"
FT                   /translation="MTSVEHSSHPMALVTGASSGIGKQFAEQLAAKGHGLVLVARDRER
FT                   LEALAIHLGTHYGVPTEVLSADLTQRADIERVARRIRQDEAPVTVLVNNAGYGLGSGFL
FT                   RSEIEDEEDALTVMVRAVMVLSQAAAQRMADRGAGVIINVSSVAGFLPYGSYGAAKAWV
FT                   TRFSEGLALDLHGTGVHVQALLPGLTHTEFHARSGEKFGGAPEWMWLPAEKVVRESLAA
FT                   VGSGEVTCVPGLPYKAAMLVLPRLPRRVVLALVQRANERDRAARAARRAVTTRAEGPPQ
FT                   EHLEEPAGDSLPSGA"
FT   gene            562954..563511
FT                   /locus_tag="Ksed_05620"
FT   CDS_pept        562954..563511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05620"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05629"
FT                   /db_xref="GOA:C7NL87"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL87"
FT                   /protein_id="ACV05629.1"
FT                   /translation="MTSAASSVKQQLADTIAADAVVYGRVTLSSGKEADYYVDLRRVTL
FT                   SGSAAPLVGRAMLELTADFEFDAVGGLTMGADPVATAMLHAAAAQGRPLDAFVVRKAGK
FT                   AHGLQQRIEGPSIEGRRVVVVEDTSTTGNSPLTAVEAAREAGAEVVAVAVIVDRSSGAR
FT                   EAVEAQGVEYRAALGLGDIGLA"
FT   gene            563627..565063
FT                   /locus_tag="Ksed_05630"
FT   CDS_pept        563627..565063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05630"
FT                   /product="arabinose efflux permease family protein"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05630"
FT                   /db_xref="GOA:C7NL88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL88"
FT                   /protein_id="ACV05630.1"
FT                   /translation="MPATLTAEFSTPPQQSLWRVPDVPWVVAGRGLVTAASRMLMVALM
FT                   LWVEASPHGAVGLAAVMLAVALPALFFMGTAGEVADQHDSRHVLTVGVLVQVLGALGVT
FT                   AAVAWAPASIALPLVIVLAFVYQAGATFNAPVWEALVPRIVGEGRVGAVASWQQGITSV
FT                   AGPLGAALGGVLVGWTSGTVALGVTAALAALVLVPALSVRTRRGGPADALLRDAREEAR
FT                   RKAAEATPWARFWRRTPFGQVSRSIAAVRSVPTAAVIVTVMVSFMIAQGASNVIEVFLV
FT                   RGPLGASEAQYGASEAFAAVGGVVGAWMTARILAPSQRVWAFVAGLVTGGVALLWIGLA
FT                   PNFWFYVVGQVALGVMQALVVASAITVTVTSTPDERRGAVMAGLGGLTRLGTVGALGVG
FT                   AIIGSVMDPRPAFLALGAAALVLLVVSGWRLPGIARDMAVQEREQEQREQDEQATADLP
FT                   VEPDSLGQQEPATSRVSARA"
FT   gene            565076..565783
FT                   /locus_tag="Ksed_05640"
FT   CDS_pept        565076..565783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05640"
FT                   /product="rRNA methylase"
FT                   /note="PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05631"
FT                   /db_xref="GOA:C7NL89"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL89"
FT                   /protein_id="ACV05631.1"
FT                   /translation="MPDPTPRSSQPEHDAGTGPARVVGVGPWEGPWPRDDAGELPAHLD
FT                   PELLEHGDRRNVADAFRYWSQSAIVAALDERRHGLHVAVENWGHDFNIGSVIRSANAFN
FT                   VAAFHIVGRRRWNRRGAMVTDRYQHEFHHADAGELAAWAAAAPRQDGGTGLPLIGIDNL
FT                   PGSVALEGYMLPAECVMVFGQEGPGLTPEVVARCEAVLHIEQFGSTRSINAGAAAAVAM
FT                   HAWVRQHIHGLPA"
FT   gene            565913..566953
FT                   /locus_tag="Ksed_05650"
FT   CDS_pept        565913..566953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05650"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="PFAM: Fructose-bisphosphate aldolase class-II;
FT                   TIGRFAM: fructose-bisphosphate aldolase, class II, yeast/E.
FT                   coli subtype; ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05632"
FT                   /db_xref="GOA:C7NL90"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL90"
FT                   /protein_id="ACV05632.1"
FT                   /translation="MPIATPEVYRDMLDRAKAEKFAYPAINVSSSQTLNAAIRGFAEAG
FT                   SDGIIQVSTGGSEYFSGPTVKDMVTGARAFAAFAREVAKNHDVNIALHTDHCPKDKLDG
FT                   FVRPLLDASEEEYKAHGTPLFQSHMWDGSAVPLEENLQIASELLERCRALDIILEVEIG
FT                   VVGGEEDGVANEINEQLYTTPEDAIATVEALGLGEKGRYMVALTFGNVHGVYKPGNVKL
FT                   RPEILQQAQAAVVEKFGPSQHSSVAEKPFDLVFHGGSGSTEQEISDAVDYGVVKMNVDT
FT                   DTQYAFTRPVAGYMLENYSGVLKIDGEVGNKKQYDPRSWGKVAEEAMAARVVTACENLR
FT                   SAGTHR"
FT   gene            566953..567402
FT                   /locus_tag="Ksed_05660"
FT   CDS_pept        566953..567402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05633"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL91"
FT                   /protein_id="ACV05633.1"
FT                   /translation="MAGGTGGSLSSSGNLLGIPETHLPEDPAVAALEQGQDARTVAAAR
FT                   PTSSAAWAELAEAALEDGLTVEAYAFARTGYHRGLDSLRRAGWKGQGPVPWEHAPNRGF
FT                   LRCLAVLSKAAGVIGETDEEQRCASFLADSSATAAAELGIERPAV"
FT   gene            complement(567417..568187)
FT                   /locus_tag="Ksed_05670"
FT   CDS_pept        complement(567417..568187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05670"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05634"
FT                   /db_xref="GOA:C7NL92"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL92"
FT                   /protein_id="ACV05634.1"
FT                   /translation="MTLGDALIVLVAGFGAGALTSSVGVASLVSFPVLVALGLPPVLAN
FT                   MTNAVGLVPAGVGGGLGYREEVREHPRLNLLVLVLTGLSGLAGAALLLVLPPGVFELVA
FT                   PWLLLFTCAIVAVQPRLSRWLARRRESHGEGGDRVTLSPIAIGFTLLIGAYGGYFGAGA
FT                   GVMMLALLALSLDLDLRFLAAMRTTSMLASKLTAASLFVVVAEIDWLAAGMLALGSVFG
FT                   GYAGARVARLLPDPVLRGAVIVAGVAAAAYLFVA"
FT   gene            568299..569747
FT                   /locus_tag="Ksed_05680"
FT   CDS_pept        568299..569747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05680"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /note="PFAM: Carboxyl transferase domain; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05635"
FT                   /db_xref="GOA:C7NL93"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL93"
FT                   /protein_id="ACV05635.1"
FT                   /translation="MTATAHDASGQTPRRYGARELVDLVLDAGSFTSWDEPVDHGEVGD
FT                   SYRDALRRAAEKSGEDESVLTGRGAVQGRPVAVLVGEFRFLGGSIGRAAAHRIVTAVRR
FT                   ATAEGLPLLASTASGGTRMQEGTPAFVTMIEISRAIMEHRRAGLPYLVHLRHPTTGGVF
FT                   ASWGSLGHVTVAEPGALIGFLGPSVYEGLHGEPFPEGVQRAEHLAQLGVIDRVVATEDL
FT                   PQLVATSLAVLADPATEPRFERAPLTASPPEDDWEAVVTTRRGDRLGVRDLLAHAAAET
FT                   ITIRGTEKGEIDDSVLVALTRLDGLPCVVIGQDRARQSRTSPMGPAALRQAHRAMQLAE
FT                   ELGLPVVTVIDTPGAELSVDAEERAMAGEIARCIGRLATLEVPTLAVILGQGCGGGALA
FT                   LLAADEVLALENAWLAPLPPEGASLIVHGDVEHAADLARSQQVGAGAMARAGIVQGVVP
FT                   EAGRSTEELARAVAAEVVGRLRSR"
FT   gene            complement(569734..570366)
FT                   /locus_tag="Ksed_05690"
FT   CDS_pept        complement(569734..570366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05690"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05636"
FT                   /db_xref="GOA:C7NL94"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL94"
FT                   /protein_id="ACV05636.1"
FT                   /translation="MAGSPDRPTFAPLRRERLHDRLATHISNFIDAQGLSAGDRLPSER
FT                   QLAAELGVSRATLSRALASLESKGRIEVRHGVGALVRSPGGAGELDALASTLTATPRDE
FT                   VAVAREAVLAGIARAAAANPNDALRAAMLAGDGTTRTFRDTWRCIRHLAHSELLTDLDA
FT                   MLGASAPDPADSPALEDALARLARAIVRGDAATAATRCDGLLRLSDS"
FT   gene            570489..571832
FT                   /locus_tag="Ksed_05700"
FT   CDS_pept        570489..571832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05700"
FT                   /product="Na+/H+ antiporter NhaD-like permease"
FT                   /note="PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05637"
FT                   /db_xref="GOA:C7NL95"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL95"
FT                   /protein_id="ACV05637.1"
FT                   /translation="MSHEIIALAVLAIVFLIATLRGVNMGALALVASFIVGLSVYGVSV
FT                   DDVLSGFPADLFVILVGVTYLFALAKNNGTVDWIVHSAVRAVGGRVALVPWAMFLVCAA
FT                   VTAMGAVSPAAVAIVAPVAMGFALRYQIHPLMMGMMVVQGATAGSFSPIGIFGSITNGV
FT                   VEGNGIPGNQLVLFLTTFFASAAIAALAYVAFGGRQLVARGREPIAVGGFVDEGPTPWS
FT                   EKRSGEPHSAVEARRSTEQEQEAAQATRLDAQRSLTLVGMLALLVGALGFDLDVGFTAL
FT                   TIAVALTLVFPASAKGAVEKISWGTVLLIGGIVTYVTLLQNQGVVDWLGDGVANVGAPL
FT                   VAALLICFIGAVVSAFASTTGIIGALIPLAVPFLLTDQVSAIGLIAALAISSSVVDCSP
FT                   FSTNGALVVANAEPEQREMVFKRLMQWGMSIVVVAPLVAWAVLVVPTV"
FT   gene            complement(571852..572574)
FT                   /locus_tag="Ksed_05710"
FT   CDS_pept        complement(571852..572574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05710"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05638"
FT                   /db_xref="GOA:C7NL96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL96"
FT                   /protein_id="ACV05638.1"
FT                   /translation="MVTWTVEVTTSGHLGVGADAGSARTVEHGRMTTDAPWLTPPPADV
FT                   GRMVRLVPLAPDHAEGWFSAAQATGPEAWRWLSRPFPRTLTDARADIEAALSEQERGTR
FT                   LPLAQLDAVDGTFVGTTSYYAPDADVRSVAIGYTWLAGWFQGRGHNAESKLQLLHHAFE
FT                   GLGAEVVVWHTDALNAHSRAAIEKLGAHHDGVLRHHKRRPDGTVRDTACFSLLADEWPA
FT                   ARERLEGRVSAALQPGAG"
FT   gene            572803..574140
FT                   /locus_tag="Ksed_05720"
FT   CDS_pept        572803..574140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05720"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: Adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05639"
FT                   /db_xref="GOA:C7NL97"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL97"
FT                   /protein_id="ACV05639.1"
FT                   /translation="MPAIVIVGAQWGDEGKGKATDQLGARVDHVVKFNGGNNAGHTVVI
FT                   DGEKYALHLLPSGILTPGVTPIIANGVVVDLAVLFEEIEALEARGVDTSKLKVSANAHV
FT                   IPSYNTTLDKVSERFLGKRKIGTTGRGIGPSYADKMNRAGIRVQDLFDESILRQKVEAA
FT                   LVLKNELLVKTYNRRAVEADEVVTELRSYVDRLRPMVVDSGLEIARALDAGETVLFEAG
FT                   QATMLDVDHGTYPFVTSSSCVAAGASTGSGMAPGRIDRVVGIFKAYTTRVGEGPFPTEL
FT                   LDETGDALREAGFEFGTTTGRPRRCGWADALVGRYATRVNGLTDMVLTKLDTLTGFETL
FT                   RVATGYRVPAAKASGLGDGRREGEWVYFDEMPMSQSDFHHAEPVYEDHAGWTEDITGCR
FT                   AFDELPQAAQDYVLRLEELVGTRISVIGVGPGREQSIVRHELAPGR"
FT   gene            complement(574201..574599)
FT                   /locus_tag="Ksed_05730"
FT   CDS_pept        complement(574201..574599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05640"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL98"
FT                   /protein_id="ACV05640.1"
FT                   /translation="MSMDRFFNPRRAGALLGCALTLCVTSGCGQDGTQAATWQGEWGHT
FT                   DKGYTATLSESDGCLKATVDGTEYLAVLPSGSSVQGDTVKTPDKEYDLASEVTIGGWGA
FT                   SRQEAEDTVSVTIPEVCTDQTDRVWLLT"
FT   gene            complement(574599..575234)
FT                   /locus_tag="Ksed_05740"
FT   CDS_pept        complement(574599..575234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05641"
FT                   /db_xref="UniProtKB/TrEMBL:C7NL99"
FT                   /protein_id="ACV05641.1"
FT                   /translation="MALAGALTLLWSAAHGEDEAAISPAQSQQVDEFTSSQDLGMPTDD
FT                   VSRYVSGQDEFAVLVDELQRDMPEGYVDAEWDGPGSRGTYIAMRPDHYEAAVTAVTASD
FT                   PSLVERLLVSYAVPATTRSEAEYDLVDQTARLTDGAQDISATIDPKTNEANITVMTRPS
FT                   ANTRLARVGGMSPVHVEQQLELPDFVKSASVEFAAKESGPEFASGGNW"
FT   gene            575564..576670
FT                   /locus_tag="Ksed_05750"
FT   CDS_pept        575564..576670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05642"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA0"
FT                   /protein_id="ACV05642.1"
FT                   /translation="MWMVLTAAGLGLTAGCGSGVDGGQVEEFESWARDQPQVQSVDSVT
FT                   FEEPDTLFGGTNPEVITTLHFSPETSDEQILSVAGAMAGALTEGGDPKYRVGEREGVTF
FT                   RLQGDDLVDRRTLGLASDLEAAAPDAQPLDPDVDHVAMVTPSSVSAVVRDADMADLARS
FT                   IAISGGAVGNDLTVTIQGQGGSSFTFQAGAGQDTASLAAIGAELAGQGIEVRTMQQTPD
FT                   GHLSMEVGEMDRSQAVELDRAVRSWPAGAVVQGEVAASAVPGATDPVNLAFDTRLLPAG
FT                   QMEGLLDAVGEVPDPWTVLSVGITEGRSAAYLAIPGDDREPSAEDIARVKEGGLALTRY
FT                   VDSYFLNGTQEEGDAVPGEWVSPGPQNP"
FT   gene            complement(576728..578995)
FT                   /locus_tag="Ksed_05760"
FT   CDS_pept        complement(576728..578995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05760"
FT                   /product="DNA/RNA helicase, superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05643"
FT                   /db_xref="GOA:C7NLA1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA1"
FT                   /protein_id="ACV05643.1"
FT                   /translation="MSTSREQDPLVEQQIALEQAHVDRVHAELAKAAERAGLVEAEGLA
FT                   RGRTMRTGDVRDEEMSGLFERDALVFSSHKRRTSLEMEHEGLVFGRLDLDHSMPDAGPA
FT                   EGEAPTVEEVRYIGRLGVRDDDYEPLVVDWRAPAASAFYRATPVQPHKVVRRRVLRCRA
FT                   EQVIGIEDDLMVAEPPEDLPVVGDGALMAALTRSRGGRMRDIVATIQQHQDEAIRAEAR
FT                   GVTTITGGPGTGKTVVALHRAAYLLYTDRRRYEHGGVLVIGPSAAYTAYIERVLPTLGE
FT                   DSVALRAAGDVVDGMTGLRLDAPEAARVKGMLRIRKVLARAAKAPAPDAPVELRCFVSG
FT                   HAIRLVEQDLRRIRNTVLRGAKRNDAAAAAREMLSQAAWTQARSQTSGEILREDRERFF
FT                   SRFEDSREVDAFMESWWRPVDPREVVLWLADAEQLAGWARDALDAEEQAALAASMQVAL
FT                   DTGTWSVADAALVDEVSARIGQPQVEVDTERGFYEVEELDDASQYGVSALKGGEGRAET
FT                   EYHQVSPTTAWEKLLYGTVEQPATYAHLLVDEAQDLSPMQWRMLGRRGRTASWTVVGDA
FT                   AQASWPDAAEAEEARDETFGAKPRRSFHMDTNYRNASEIFAYAAEYIRRHEPEADIPNA
FT                   VRETGVQPREVGVTATGKDSGAWATAAVEAARELVDEVDGAIAVITPAVHRVDVEAALE
FT                   PLRGEHPRVVAIDPMSTKGLEYDATVVVDPEEIVAESPGGARVLYVVFTRAAHRMVVLA
FT                   EG"
FT   gene            579078..579635
FT                   /locus_tag="Ksed_05770"
FT   CDS_pept        579078..579635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05770"
FT                   /product="acetyltransferase, ribosomal protein N-acetylase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05644"
FT                   /db_xref="GOA:C7NLA2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA2"
FT                   /protein_id="ACV05644.1"
FT                   /translation="METLTTERLVLRPFTTGDHDFVADLHRHPGIERFIPSQATTTPER
FT                   TSHQLERFTSYADHPVHGMWCVTLADGRPVGLLMLKPIPFSADNPRADGESDLELGWRI
FT                   HVDHEGNGYATEAARRVLEHAWGAGLPRVVAVTDPENHPSMRVCTRLGMRDAGLTDDYY
FT                   DETVRLFVLERPDADETAEDRV"
FT   gene            579632..580387
FT                   /locus_tag="Ksed_05780"
FT   CDS_pept        579632..580387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05780"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /note="PFAM: Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05645"
FT                   /db_xref="GOA:C7NLA3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA3"
FT                   /protein_id="ACV05645.1"
FT                   /translation="MSGLVPDAVVDLARSARRVLVLTGAGASAESGVPTFRDAATGLWA
FT                   RFDPMELATPEAWAADPAQCWAWYAWRAHLVRGAEPNAGHRAIAAWQQHEGVDLRVSTQ
FT                   NVDGLHERSGAEVLAHVHGDLFALRCARCGAASDAEYPPVPEPVERLEPPVCGRCGGLV
FT                   RPGVVWFGEMLPAGALEATVTAAEWAEMVVVVGTSGMVYPAAAVPGIAREAGVPVVEVN
FT                   PAGSSLPDGADHVIEAPAGQALPALVAAL"
FT   gene            complement(580457..581104)
FT                   /locus_tag="Ksed_05790"
FT   CDS_pept        complement(580457..581104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05790"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05646"
FT                   /db_xref="GOA:C7NLA4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA4"
FT                   /protein_id="ACV05646.1"
FT                   /translation="MGTREETKQQTRARILHAARKEIAERGGVGLSMRAVARGSDLVSS
FT                   AVYRYFPSREALLTAMIIESYEHLAGALGEAPDGSPADRWRHLASAFRDWARQHPHEFQ
FT                   LIYGTPIPGYQAPPETVPAATAVASPFLAAARNGAAAASRFAGAELLDQLAGPASELDA
FT                   EPARLGAVLAELAALVGVVSLELAGHLVGTADPADHLFAALVERQVTTLGLD"
FT   gene            581210..581860
FT                   /locus_tag="Ksed_05800"
FT   CDS_pept        581210..581860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05647"
FT                   /db_xref="GOA:C7NLA5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA5"
FT                   /protein_id="ACV05647.1"
FT                   /translation="MSATARTLHPIDPRRLVAPLTGLGAGMCGYLLLRPYGDVGGGATL
FT                   EAAAAFASPLWVASHCLGVVALASFVRLLLRVHEVGPDLATRTARASGLLGLVLVLPYY
FT                   GAEAFGLHAVGRAAQSGTAGVMTLEEAIRSQPVAITAFGAGLLLLALAAGCLGRGWQRA
FT                   AGSRAAWPLAALMAVFLPQFYLPPVGRMAYGVAVALAAVWMLVSAWRTDSSRG"
FT   gene            complement(581870..582406)
FT                   /locus_tag="Ksed_05810"
FT   CDS_pept        complement(581870..582406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05810"
FT                   /product="predicted phosphatase, C-terminal domain of
FT                   histone macro H2A1 like protein"
FT                   /note="PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05648"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA6"
FT                   /protein_id="ACV05648.1"
FT                   /translation="MSTQDEVRIECVQGDITTQEVDAIVNAANSGLRGGGGVDGAIHRA
FT                   AGPDLLAECEELRAGPLPDGLPVGEAVATGAGNLPARWVVHTVGPNRRAGQTDPALLRA
FT                   TFANSLRVADEVGAASVALPAVGAGVYGWSAADAAAAAMAAAQEFAADAPQSVRLVRFV
FT                   LFSPELLSAFEAARG"
FT   gene            582517..583077
FT                   /locus_tag="Ksed_05820"
FT   CDS_pept        582517..583077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05820"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /note="PFAM: Pyridoxamine 5'-phosphate oxidase; Pyridoxine
FT                   5'-phosphate oxidase C-terminal dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05649"
FT                   /db_xref="GOA:C7NLA7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA7"
FT                   /protein_id="ACV05649.1"
FT                   /translation="MTTLRNRLRALPSFPADLPELDPDRAPASPHDLFASWLGDAIEAG
FT                   ERQPHGMTLATVRDDGTPVARTLILKDVDTDGYHFSTHRSSRKSQQLATIPRASMLFWF
FT                   KEAGRTVRITGGVQELGREASERDWQGRPSYDGEPNPDWQLYALLPEEFEFMQAREDRH
FT                   HTRLEYLLGAAGWERGLVRTPAG"
FT   gene            583206..584546
FT                   /locus_tag="Ksed_05830"
FT   CDS_pept        583206..584546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05830"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="PFAM: Phosphoribosylglycinamide synthetase, C
FT                   domain; Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   TIGRFAM: phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05650"
FT                   /db_xref="GOA:C7NLA8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA8"
FT                   /protein_id="ACV05650.1"
FT                   /translation="MKILVIGTGGREHGILEALRRTQDPAHPLELFAAPGNPGMAQLAE
FT                   CRAVDAASPAAVVALAQELGAELVVVGPEAPLVAGVADALRDAGVPTLGPDQAAARLEG
FT                   SKAFAKEVMAAAQVPTAQARTCTDDATVAEALDAFATSGAGTPVPWVVKADGLAGGKGV
FT                   VVTTDRAEAEQHATDCIAKEGQVVIEEYLDGPEASVFCLLDGITARALPAAQDFKRAGD
FT                   GDLGPNTGGMGAYSPLPWAPEGFEDEVVRTVAQPVADEMARRGTPFVGVLYVGLALTAA
FT                   GPRVVEFNVRFGDPDSQAVLARLTSPLAPLLLAAATGSLSDAADLTFADESAVVVVLAA
FT                   DGYPVSPVPGGQLTGIAEAEARGAVVLHAGTRTEDASGDLASGAGTTNRSPRLVAAGGR
FT                   VLDVVARGADLAHARHNAYAALSLIDLPGGWARTDIAADAAAGRIVL"
FT   gene            584543..585553
FT                   /locus_tag="Ksed_05840"
FT   CDS_pept        584543..585553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05840"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05651"
FT                   /db_xref="GOA:C7NLA9"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLA9"
FT                   /protein_id="ACV05651.1"
FT                   /translation="MTTPADPQRTAQPGTPTGPTLPGYELVHAGKVRELYAPGPDAPLP
FT                   GGFAADEVLLMVASDRISAYDHVLSTPIEDKGEVLTRMSLWWFDQLADLVPHHVLATEA
FT                   PLVPEQVAGRAVLVKRLRMLPVECVARAHLTGGGLSEYRRAGTVSGVRLREGLVDGDEL
FT                   PDPIFTPSTKAPAGEHDEPISYEQVVTTIGEPLARAARNLTVAILRRGHEVAAGRGIIV
FT                   ADTKVEFGLEGVEAERDLRTVTQKELDAGSVRIVLADEVLTPDSSRFWPAEGFEAGRQQ
FT                   PSFDKQYVRDWLTSPASGWDKESDTPPPVLPADVAAATRGKYVEAYERLTGESFR"
FT   gene            complement(585605..585970)
FT                   /locus_tag="Ksed_05850"
FT   CDS_pept        complement(585605..585970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05850"
FT                   /product="death-on-curing family protein"
FT                   /note="PFAM: Fic/DOC family; TIGRFAM: death-on-curing
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05652"
FT                   /db_xref="GOA:C7NLB0"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB0"
FT                   /protein_id="ACV05652.1"
FT                   /translation="MTTYLTLEDLLTLTGDLGVGPVRDVGLLESAAHRPSTSVWGQEAY
FT                   PELDLKAAVLLESIVRNPPLVDGNKRLGWLSLVVFYGLNGAELDAPDDEAYDLVVGVAS
FT                   GVVEPAEAAAALGRWWG"
FT   gene            complement(585967..586170)
FT                   /locus_tag="Ksed_05860"
FT   CDS_pept        complement(585967..586170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05653"
FT                   /db_xref="GOA:C7NLB1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB1"
FT                   /protein_id="ACV05653.1"
FT                   /translation="MAMTLRLTDEDARLLGELAAAQGVSRQEATVRAIRETAARRGHES
FT                   TVRTLSAKARERYADLLDKLGT"
FT   gene            complement(586306..586920)
FT                   /locus_tag="Ksed_05870"
FT   CDS_pept        complement(586306..586920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05654"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB2"
FT                   /protein_id="ACV05654.1"
FT                   /translation="MNIRPQHTLLTSVAALALIGCSAQEEERSLHDLTTDSGTHVDYDP
FT                   VDSKATVDDRAAGAALVRLTGVQPGHQRTILGEVRYEFASLTAEVVEPLHGPGQAGDVV
FT                   HLEMIRPEGADLDDLRAALPDGEVVAVWSQWTGDSTEDASLSLPDGGVADDPAKFLFPD
FT                   GLWYQDSGELENPMVAGEEPGSPWAGAEDVAGVARSVRDGG"
FT   gene            complement(586930..587340)
FT                   /locus_tag="Ksed_05880"
FT   CDS_pept        complement(586930..587340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05655"
FT                   /db_xref="GOA:C7NLB3"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB3"
FT                   /protein_id="ACV05655.1"
FT                   /translation="MTADEQEAAGYAMRRLRDTTDLTIEYIGYGCGRYFGYNDMTWFSE
FT                   DLPPGVRGRYQCDDCRGGRSYKGSVYIDFPELKRGANDWSDIRKTTVHEVGHSLSFRHD
FT                   SVSAMIQGEVPSTHWRWRSFSASDRDDINRAF"
FT   gene            587631..587930
FT                   /pseudo
FT                   /locus_tag="Ksed_05890"
FT   gene            587996..588187
FT                   /locus_tag="Ksed_05900"
FT   CDS_pept        587996..588187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05656"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB4"
FT                   /protein_id="ACV05656.1"
FT                   /translation="MVFVPVPEPKVEKNRVHPDLWGGEADLVAAGATVVDRQPGWVVLA
FT                   DPEGNEFCAFAPPDADEC"
FT   gene            588308..588745
FT                   /locus_tag="Ksed_05910"
FT   CDS_pept        588308..588745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05657"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB5"
FT                   /protein_id="ACV05657.1"
FT                   /translation="MTTTTRLLTIGLAATGVIGLAGCDGLLGALQPSSVQVSDGMVVYT
FT                   NPPNHAEGEPLIIGELTWDADHACWYTVGADGSEATTVYPEGTTSTPGEQITFAGGEVV
FT                   RAGEELAVGGTGWTPGEDEGFTPDMRCGERELHFSAGTGPL"
FT   gene            588849..589139
FT                   /locus_tag="Ksed_05920"
FT   CDS_pept        588849..589139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05920"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="PFAM: Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05658"
FT                   /db_xref="GOA:C7NLB6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB6"
FT                   /protein_id="ACV05658.1"
FT                   /translation="MGHVIVDVMPKPEILDPQGKAIAGALPKLGIEGFTEVRQGKRFVL
FT                   AVDGEVTDAVLSSAREAATTLLSNPVIEDVVSVREATAAELEADKAQEATA"
FT   gene            589136..589804
FT                   /locus_tag="Ksed_05930"
FT   CDS_pept        589136..589804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05930"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /note="PFAM: CobB/CobQ-like glutamine amidotransferase
FT                   domain; TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05659"
FT                   /db_xref="GOA:C7NLB7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB7"
FT                   /protein_id="ACV05659.1"
FT                   /translation="MKVGVVTFPGSLDDRDAARAIELAGGQAVALWHGDEDLTGIDAVV
FT                   LPGGFSYGDYLRCGAIARFAPMMTRVIAEAQRGMPVLGICNGFQVLCESHLLPGALIRN
FT                   DHQTFVCRDQRLRIENATTAWTSGYAEGQEITIVLKNGEGGYVADDATLDALEGEGRVV
FT                   ARYLEHNPNGSLRDIAGITNERGNVVGLMPHPEHCVEEGYGPSTDGLPFFTSVLREMAR
FT                   "
FT   gene            589801..592197
FT                   /locus_tag="Ksed_05940"
FT   CDS_pept        589801..592197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05940"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /note="PFAM: AIR synthase related protein, C-terminal
FT                   domain; AIR synthase related protein, N-terminal domain;
FT                   TIGRFAM: phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05660"
FT                   /db_xref="GOA:C7NLB8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB8"
FT                   /protein_id="ACV05660.1"
FT                   /translation="MTPTHQTTGPDAVNADLDTVTHAASTPETEQPWADLGLAADEYAR
FT                   IREVLGRRPTNAELAMYSVMWSEHCSYKSSKVHLRQFGEKQSDEMREHLLVGIGENAGV
FT                   VDIGDDWAVTFKVESHNHPSFVEPYQGAATGVGGIVRDIISMGARPIAVMDALRFGDPS
FT                   HPDTLRVLPGVVAGISGYGNSLGLPNIGGETRFDAVYQGNPLVNALCVGAMKKQDIHLA
FT                   NASGVGNRVVLFGARTGGDGIGGASVLASGSFDADGPSKRPSVQVGDPFSEKVLIECCL
FT                   ELYREGLVEGIQDLGAAGISCATSELASNGEGGMHIELTSVLLRDPTLNAGEILMSESQ
FT                   ERMMAVVTPENAEAFEAVMARYEVEYSWLGEVTDTGRLVIDWQGETIVDVDPRTVAHDG
FT                   PVYERPYARPEWLDAVQADTVTAAGLERPGSAADLRATLLDLLGSPNLADASWITDQYD
FT                   RYVQGNTASAMPDDAGIVRVDEQTGRGVAVSTDCNNRFSYLDPYAGAQLSLAEAFRNVA
FT                   ASGAAPRAVSDCLNFGSPEEPGTMWQFAEAIRGLADGCLELGIPVTGGNVSLYNSTGDT
FT                   AIHPTPLVAVLGVLDDVARRIPTAWRAAGLDLVLLGETRDELDGSAWAGLHGHLGGVPP
FT                   QVDLAAERRLGELLGRAADEGLVAGSHDLSEGGLAVALAEGVERHGTGARVDLASLLGA
FT                   GGAAAGEGALDAAAALFSESGGRVLVAVAPEHREAFDALVAEHGVPAVALGTTTPGDSL
FT                   RVETGAGELVLTASEISTARQRTFRELLAGDEAVVEAAVAEAHGH"
FT   gene            592199..592555
FT                   /locus_tag="Ksed_05950"
FT   CDS_pept        592199..592555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05661"
FT                   /db_xref="GOA:C7NLB9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLB9"
FT                   /protein_id="ACV05661.1"
FT                   /translation="MYVVLLPLAALIAVAVVVIGRAVSGGGRPAPGWMTPAAAVVMVLV
FT                   AGAYALLGTVVARTRDAQGFEALNAPFAASLMVLLVPAVVLTVQFWRDRTTHRFAAAMV
FT                   AAALGLLLVLGIQF"
FT   gene            592565..592930
FT                   /locus_tag="Ksed_05960"
FT   CDS_pept        592565..592930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05662"
FT                   /db_xref="GOA:C7NLJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLJ6"
FT                   /protein_id="ACV05662.1"
FT                   /translation="MDPADLWVPTMAVVLVTALAVFAATRRSEPAGPLKRGVAGVATAV
FT                   VVGWVAWAAVASVTGGPLPGGGGAGYLSVLGLRALSVGAVLVTFWRARTDRAFTVAMMV
FT                   TLAMSLPELGWAADALR"
FT   gene            593007..593441
FT                   /locus_tag="Ksed_05970"
FT   CDS_pept        593007..593441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05663"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLJ7"
FT                   /protein_id="ACV05663.1"
FT                   /translation="MDTPFPTRLPLPTGITRPRVVGALAVLAMAVPLTAGCGPEEGEKH
FT                   DEKLEQCDRAPDNTELGHMVSSRDAEDRPVPTLDELVAQAEGIAVVHTGRVWPGEQTES
FT                   GLGGGEASTAVTARVLRSVKGDRRRLTGASQCSHSAPIRL"
FT   gene            593482..594156
FT                   /locus_tag="Ksed_05980"
FT   CDS_pept        593482..594156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05664"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLJ8"
FT                   /protein_id="ACV05664.1"
FT                   /translation="MSTQTLRGTHVLAIAALGAMALTGCGTGEEGAAPSQSVTAAAPSG
FT                   TSDPGGSPSGDAVCAVGSVDPWHERLAPGLAGADWPTLPAPAKALTELDGIALVEPAGD
FT                   LRESGAKGAYELPVTVLDGVEGAEDGQHLTVVLLGDGLSLAEVEELRPEGPYLVFWEDT
FT                   EQGAVPHAEGFWYELDVEPCSNSEGAVSQVSDPVAGIGSPLGWQETHTLAGMVEQLRAA
FT                   QG"
FT   gene            complement(594184..595431)
FT                   /locus_tag="Ksed_05990"
FT   CDS_pept        complement(594184..595431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_05990"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05665"
FT                   /db_xref="GOA:C7NLJ9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLJ9"
FT                   /protein_id="ACV05665.1"
FT                   /translation="MTTPGDRTTPRSLPQSAKLADVLYEIRGPVNAEAQRMEAAGEHIL
FT                   KLNIGNPAPFDFPPPPDIVRDMIATLPVSHGYSESKGILSARRAVVDRYNETPGFPEVD
FT                   VDDVYLGNGVSELIMLVLNALLDDGDEVLVPSPDYPLWTAATSLAGGRPVHYRCDEEDG
FT                   WNPDVADLESKVTPRTKAIVVINPNNPTGAVYSDETLRAITDVARRHGLLLFADEIYDR
FT                   ITYDDLPVTNLATFAPDLLCVTLSGLSKTYRVAGYRSGWMVITGPRDHAAGFLEGVELL
FT                   TSTRLCANVPGQQAIQAALGGKQSIEDLLLPTGRLTRSRDVAWEGLNAIDGVSCVKPTG
FT                   ALYAFPRLDPEVHPIADDQQFALDLLRSEKILITHGSGFNIPTTDHFRVVTLPHPDTLT
FT                   VAVERMGNFLASYRQA"
FT   gene            complement(595481..596281)
FT                   /locus_tag="Ksed_06000"
FT   CDS_pept        complement(595481..596281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05666"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK0"
FT                   /protein_id="ACV05666.1"
FT                   /translation="MLPDRIGFEEAEGGGVIVLRDGRPQSHVDTDDPRRLDFPYIAHLA
FT                   AVLDLVATPSPPERIGVTHVGGAGLTLPRYVQATRPGSPQIVLEPDAALTDAVRARLPL
FT                   PAGHRIRVRPQAGRTGVAGLKDASADAVVVDAFDAGRVPDELVTAGFAADCLRVLAPGG
FT                   VLAMNVADEPELARTGEVLGAWVAGGWRAEEIALIGAREVLNSRRPGNVVVVARRGGTD
FT                   EGTAPGRGAPAWATALERRVGRSALPTEVRAGAVLARWTGPPRA"
FT   gene            complement(596430..597485)
FT                   /locus_tag="Ksed_06010"
FT   CDS_pept        complement(596430..597485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06010"
FT                   /product="theronine dehydrogenase-like Zn-dependent
FT                   dehydrogenase"
FT                   /note="PFAM: Zinc-binding dehydrogenase; Alcohol
FT                   dehydrogenase GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05667"
FT                   /db_xref="GOA:C7NLK1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK1"
FT                   /protein_id="ACV05667.1"
FT                   /translation="MKATVIHAPGDVRLTEVPDPQVVLPTDAVVRVVASCVCGSDLWPY
FT                   RGANAVDEPRRIGHEFVGVVEEVGPEVTGVRPGQFVIAPFVWSCGECAACRWGMQTSCE
FT                   RGGGWGGEDRDGHFVDGGQGEAVRVPRADGTLVPVDGIDASVDERLLASLLTCSDVMGT
FT                   GWHAALRAGVQPGETVAVVGDGAVGLCAVLAAGLQGAERVIAMSRYPQRQAVARTFGAT
FT                   DIIETRGDEGVEALRELTDGWGADRVLECVGTHDSMLQAIRSARPGGTVGYVGVPHGIE
FT                   LPIELMFRRNVNLAGGVAPAREYAPMLRDKVLAGEIDPGQVFDAVMPLAEVARAYTAMD
FT                   ERTAIKVMLRP"
FT   gene            597614..598843
FT                   /locus_tag="Ksed_06020"
FT   CDS_pept        597614..598843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06020"
FT                   /product="arginine deiminase"
FT                   /note="PFAM: Amidinotransferase; TIGRFAM: arginine
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05668"
FT                   /db_xref="GOA:C7NLK2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK2"
FT                   /protein_id="ACV05668.1"
FT                   /translation="MPFHVGSEVGKLKQVIVHRPGLEMSRLTPTNCERYLFDEVLWLEK
FT                   AQAEHDEFRAVMEGRGVVVHEFSDLLRETLAVPDAKKHVLDNSLDERMVGPQAADELRG
FT                   VFQAMSDEELATYLVGGLTKGELNARLPRSTSLYLNTLTDRDMVLAPLPNHLFTRDTSA
FT                   WMFGGVSVNSMHKKARRRETVHFEAIYRWHPLFAEADFARWNDGLQSGPATTEGGDMLV
FT                   IGNEAVMIGVSERTNPQGVERVAQNLLRSGQARTVLALDMPKARALMHLDTVMTMLNPT
FT                   TFTRYQNLPPMQSWTIRADGEGAEAGLEFTHNAPERLDAAIAEALGVDRIEVLAADQDE
FT                   RSAEREQWDDGCNVLALEPNVVVGYERNTTTNDYLRAQGVEVLTIDGGELGRGRGGPRC
FT                   MSCPIEREAV"
FT   gene            598845..599261
FT                   /locus_tag="Ksed_06030"
FT   CDS_pept        598845..599261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05669"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK3"
FT                   /protein_id="ACV05669.1"
FT                   /translation="MPPRRRIDPSAGHAAVGQWLAAQSGQDEGEPAPVAVDRQVLATAV
FT                   RFTLEELGARAPGRSVEVRVPPLGVVQCVEGSTHRRGTPPAVVEMDAATWLALATGRLA
FT                   WVDAVGAGSVQASGQRADLASHLPLVEDAGARRA"
FT   gene            complement(599269..599610)
FT                   /locus_tag="Ksed_06040"
FT   CDS_pept        complement(599269..599610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05670"
FT                   /db_xref="GOA:C7NLK4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK4"
FT                   /protein_id="ACV05670.1"
FT                   /translation="MGGWCRQQAQPSTYRGTVQDETQEFPDQNSPTPDPTPVHRAPRVL
FT                   PFVLIGTVLGVALAGLVTVMGPSSPMYSPGRSFAFLAVMFGIAGLLLGGVVFAIVDAIA
FT                   LKRSERRGS"
FT   gene            599647..601203
FT                   /locus_tag="Ksed_06050"
FT   CDS_pept        599647..601203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06050"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="PFAM: Glutamine amidotransferases class-II;
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05671"
FT                   /db_xref="GOA:C7NLK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK5"
FT                   /protein_id="ACV05671.1"
FT                   /translation="MCPVTRGDGRLSHALLPDEALPQDECGVFAVWAPDEDVATLTYYG
FT                   LYALQHRGQESAGIAVSNGSSLLVYKDMGLVSQVFNDQVLRPLKGHMAIGHTRYSTTGA
FT                   SVWENAQPTLAGSDDRTLALAHNGNIINSAELLDRLKELLDGDVSKAAGELGRGSTTDT
FT                   AILSSLLSTGEGTVLERAQRILPTVRGAFSLVFLDENRLYAARDPQGVRPLVIGRLSRG
FT                   WVVASETAALDIVGASFVREVAPGELIAIDHDGLESVSFAEPEPKGCIFEYVYLARPDT
FT                   KIAGREVYDARVEMGRALARRHPAEADMVMPVPESGTPSAIGYAEESGIPYGLGLVKNS
FT                   YVGRTFISPTQTIRQLGIRLKLNPLKHVIAGKRLVVVDDSIVRGNTQRALVKMLREAGA
FT                   AEVHVRISSPPVEWPCFYGIDFATRAELAAANMTVEEICTSIGADSLGYVEVEDIVAAS
FT                   EQPADRLCAACFDGVYPIPLPTDGRTGKKWLELERAARATDPTDVGTQQVRDFAQNPGR
FT                   P"
FT   gene            601286..602413
FT                   /locus_tag="Ksed_06060"
FT   CDS_pept        601286..602413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06060"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="PFAM: AIR synthase related protein, C-terminal
FT                   domain; AIR synthase related protein, N-terminal domain;
FT                   TIGRFAM: phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05672"
FT                   /db_xref="GOA:C7NLK6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK6"
FT                   /protein_id="ACV05672.1"
FT                   /translation="MNTPQNTPGITYAQAGVDTEAGDRAVELMKSSVARATRPEVVGGL
FT                   GGFAGLFDASALQGMSRPLLTTSTDGVGTKIAIARALDRHDTIGQDLVAMVVDDIVVCG
FT                   AEPLFMTDYIATGSVVPERIAAIVSGIARGCELAGVALVGGETAEHPGLMAPDEYDLAG
FT                   AATGVVDAPDVLGPERVAQGDAVLCIASSGLHSNGFSLVRRVVEHAGLSLEEEVPEFGR
FT                   TLGEELLEPTRIYSLPLLEVIRATRVHALSHVTGGGLAANLARVMPQGLYAALDRSTWA
FT                   PAPVFDAVQRWGGVDRADLEKTLNQGVGFVALLPQESVDTAVELLAGHGIDAWVAGEVH
FT                   GSAEAGLGAQVATGDWVTGAKGVEGGAAALVGDHA"
FT   gene            complement(602509..602703)
FT                   /locus_tag="Ksed_06070"
FT   CDS_pept        complement(602509..602703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05673"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK7"
FT                   /protein_id="ACV05673.1"
FT                   /translation="MGRGRAKAKQTKVARELKYYSPDTDLSALERELRASSDRESSRNG
FT                   YSSSSDDEDDEDRWPANDR"
FT   gene            complement(602912..603112)
FT                   /locus_tag="Ksed_06080"
FT   CDS_pept        complement(602912..603112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05674"
FT                   /db_xref="GOA:C7NLK8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK8"
FT                   /protein_id="ACV05674.1"
FT                   /translation="MATTTHAAAPESATHGGDDEGIKKHRMSPAVHAALFILLGIIVSL
FT                   VIIGIWPLMEILGNDVDTSKP"
FT   gene            complement(603242..603943)
FT                   /locus_tag="Ksed_06090"
FT   CDS_pept        complement(603242..603943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06090"
FT                   /product="uncharacterized protein, copper resistance
FT                   protein CopC-like protein"
FT                   /note="PFAM: Copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05675"
FT                   /db_xref="GOA:C7NLK9"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLK9"
FT                   /protein_id="ACV05675.1"
FT                   /translation="MTTHHSARARRTRALAAVGAAALTCTFAAPAGAHDVLEGAEPSAG
FT                   ETLTEAPDELVLTYSDAVQQVGNRVSVTDSAGEVVAEGEPTADGSVVTFDLPEDLADGS
FT                   YTTTWRVVSSDGHPISGTTDFTVAADSDDAGSSPAESSEPAESSGAPSGSSEPAGSPSS
FT                   EPTAAPSDSASTEPTESTTTEATGTPSDEAGSDAQDSDQDSSGGLSTTGWVGLGALALV
FT                   LLAGGALLLRR"
FT   gene            604035..604667
FT                   /locus_tag="Ksed_06100"
FT   CDS_pept        604035..604667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06100"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /note="PFAM: Uncharacterized protein family UPF0029; Domain
FT                   of unknown function (DUF1949); TIGRFAM: conserved
FT                   hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05676"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL0"
FT                   /protein_id="ACV05676.1"
FT                   /translation="MPVTSYRTLARDAHGEIEEKNSRFVCRIAPSDSEEAARAVIEAER
FT                   RTHHDARHHCSAFVLGPDGRIERSNDDGEPAGTAGTPMLDVLRGSGYRDVTAVVTRWFG
FT                   GTKLGAGGLVRAYGDAVRAALEDARPRERRLVCEHSLVVAHAEAGRIENDLRVAGFVVT
FT                   GTDYAERATLHVATPPDQQDALASAVAVATGGGGVLVPGDERWVDAP"
FT   gene            complement(604725..605990)
FT                   /locus_tag="Ksed_06110"
FT   CDS_pept        complement(604725..605990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06110"
FT                   /product="predicted ATP-grasp enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05677"
FT                   /db_xref="GOA:C7NLL1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL1"
FT                   /protein_id="ACV05677.1"
FT                   /translation="MPKTPAASPDAPAFDLVMVGGDIGVYALARAFNDRYGTIPTVVSR
FT                   VETGPVMRSEIINHHLIGEDKTSDDTIDELVRIGRKHHGRHPLVLLTNQDTIVRMVMER
FT                   VDELAPYYTIPMPGVDLLDRISDKVEFAQACAELDIPHPATQVLDFAGSDGADWAAPAV
FT                   EQPFPVVAKPATTSQYETLKFAGKKKVYFLDTQEQYDDMVRVLRAAGFTGQFLVQQLIG
FT                   GDDTYMRSVTAYRDRNGETTLLCSAHVLLEEHSPTALGNPAAMFTTALPDLWDSAVKFL
FT                   DHMDYQGFANFDVKVDPRDGTGYFLEMNSRIGRNNYYVTAAGANVAEFVVTDVVENKRH
FT                   TPVRVENEILYTVLFKPFLMRYVLDPELRRRVNAAARNGIHHPLWNPRKDSLWRQGYTV
FT                   VAMLNHVRKFLKYYPKPSSHGF"
FT   gene            complement(606185..607579)
FT                   /locus_tag="Ksed_06120"
FT   CDS_pept        complement(606185..607579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06120"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   Pyridine nucleotide-disulphide oxidoreductase, dimerisation
FT                   domain; TIGRFAM: dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05678"
FT                   /db_xref="GOA:C7NLL2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL2"
FT                   /protein_id="ACV05678.1"
FT                   /translation="MADHYDVVVLGAGPGGYVAAIRAAQLGKKVAVIEKKYWGGVCLNV
FT                   GCIPSKALLRNAELAYTLTKEKKTFGIEGDATMSYGPTHSRSRKVSEGIVKGVHFLMKK
FT                   NKITEIDGWGTIQSDSTVSVDLNDGETQEVTYDHLIIATGATTRMIPGVELSENVVTYE
FT                   EQILDEELPESIIIAGSGAIGVEFAYVMANFGVKVTIVEFLDRMVPTEDEEISKELLKH
FT                   YKKLGVDVKLSTKVEKVEDTGSGVKVTVSKDGSEEVLEADRLLSAIGFAPRIEGYGLEN
FT                   VGVETTERGAIDIDQWGRTAVENIYAIGDVTGKLMLAHTAEAMGVVASERIAGADTMPV
FT                   EFDFIPRATYCQPQIASFGYSEAQAKEKGYDVKVSKFPFSANGKAMGFGDARGFVKVVA
FT                   DAEHNEIIGAHMIGPEVTELLPVLTLAQKWDLTADEVARNVFAHPTLSESVKEAVEGIA
FT                   GHMINL"
FT   gene            607755..608078
FT                   /locus_tag="Ksed_06130"
FT   CDS_pept        607755..608078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06130"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="PFAM: ACT domain; TIGRFAM: acetolactate synthase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05679"
FT                   /db_xref="GOA:C7NLL3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL3"
FT                   /protein_id="ACV05679.1"
FT                   /translation="MKRHALSVTAENHPGVLTKVCGLFATRDANIQYLAAAPTLQKGVS
FT                   HMTIVVRANDQFDVEDLITHVEQVPHVVAVEAIDDVDAVATELQTTADRAPRTVGSLTQ
FT                   RAF"
FT   gene            608146..610053
FT                   /locus_tag="Ksed_06140"
FT   CDS_pept        608146..610053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06140"
FT                   /product="anthranilate/para-aminobenzoate synthase
FT                   component I"
FT                   /note="PFAM: chorismate binding enzyme; Glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05680"
FT                   /db_xref="GOA:C7NLL4"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL4"
FT                   /protein_id="ACV05680.1"
FT                   /translation="MPAEPAVSAELLAPLLGEHAPPFALIHRAEDPAHVLLLTGQVQDL
FT                   DRLAEIPSPGELPVLAMVPYRQVAERGFAAHDDGAPLRVLLPERAQRLEVDGVLDALAR
FT                   LVPTAPAVTGERMSVSDADYAAMVRRVITDEIGRGEGANFVIRRDVVADVDAAPATAAL
FT                   GWFRALMDQEAGAHWTFVVHTPGHTLVGASPERHVGVADGWAVMNPISGTFRHGEHASP
FT                   GELVSAFRGFLEDTKETEELFMVVDEEMKMMARVCSSGGRMTGPQLKQMAHLTHTEYVL
FT                   DGQTEMDPREVLRETMFAPTVTGSPMENACTVIHRHEPTGRGYYSGVLALLDRDEAGRE
FT                   RLDAPIIIRTAQLPHNGTVSVSAGATLVRHSSPEAEVAETAVKATGMLAAMGLRPQRPR
FT                   GAAPDLAGLPGVSAALAARNDRLSPFWLAPQAPTHVEGVAGASVLVIDAEDAWTQMLVH
FT                   QLRHLGMVGRVKRWNEVTLDDVAGPAAPDLVLSGPGPGDPTDLTQPRIARLHELVSARL
FT                   EAGGALVAVCLSHQVLAHLAGLPIERLDEPHQGVQLEVDWFGLPARIGFYNTFVARGPA
FT                   AGGVRVAGRELEVTAEPGSGAVRGLRGPGVATIQGHAESVLSADGLPVLREMVRHALGA
FT                   "
FT   gene            complement(610122..610739)
FT                   /locus_tag="Ksed_06150"
FT   CDS_pept        complement(610122..610739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06150"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05681"
FT                   /db_xref="GOA:C7NLL5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL5"
FT                   /protein_id="ACV05681.1"
FT                   /translation="MRMANLNEWITSVIEALGGPGLALMMLLETVFPPIPSELVLPLAG
FT                   FTIGQGQMGWLEVMLWTTSGSVAGAVFLYAVARAFGRERTIRWMAKLPLVEENDGDAAH
FT                   RWFDKYGKVAVLTGRCVPGVRSLISIPAGTSQMPFGTFFFYTLLGSSAWNALLVTLGYV
FT                   LGSNWHAVEGTVSIISKIVLALLVLGVLWFVYKRVSARRAAR"
FT   gene            complement(610852..610924)
FT                   /locus_tag="Ksed_06160"
FT   tRNA            complement(610852..610924)
FT                   /locus_tag="Ksed_06160"
FT                   /product="tRNA-Phe"
FT   gene            complement(610954..611027)
FT                   /locus_tag="Ksed_06170"
FT   tRNA            complement(610954..611027)
FT                   /locus_tag="Ksed_06170"
FT                   /product="tRNA-Asp"
FT   gene            complement(611172..611244)
FT                   /locus_tag="Ksed_06180"
FT   tRNA            complement(611172..611244)
FT                   /locus_tag="Ksed_06180"
FT                   /product="tRNA-Glu"
FT   gene            complement(611285..612367)
FT                   /locus_tag="Ksed_06190"
FT   CDS_pept        complement(611285..612367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06190"
FT                   /product="PHP family phosphohydrolase, histidinol
FT                   phosphatase"
FT                   /note="PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05682"
FT                   /db_xref="GOA:C7NLL6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL6"
FT                   /protein_id="ACV05682.1"
FT                   /translation="MSTPPEVPSPAEAREHALAALREVAYLYERARESSHRIGAYRRAA
FT                   ETVERLDDHKFADHVAADSWQSLDGIGSSTAGVLREAVSGKVPAKVVAARRDHGGPLLE
FT                   MTEAGEALLHRLRGDLHSHTTDSDGGSPLVDMARTADDLGREYLAVTDHSPRLRVANGL
FT                   SAERLVAQRDTVAEVRERMEDEGRSIELLHGIEVDILDDGALDQHEDLLAVLDVRVASV
FT                   HSKLRMPARQMTPRLLAAVENPLTSVLGHCTGQLVTGSRGTRPPSEFDAREVFAACAEH
FT                   EVAVEINARPERSDPPDELLALALELGCLFSIDSDAHAPGQLDLLRFGAQRAADAGVPP
FT                   ERIVTTWPAQEVRAWAAGRL"
FT   gene            612456..612914
FT                   /locus_tag="Ksed_06200"
FT   CDS_pept        612456..612914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06200"
FT                   /product="predicted acyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05683"
FT                   /db_xref="GOA:C7NLL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL7"
FT                   /protein_id="ACV05683.1"
FT                   /translation="MLNVIACPGPDLSAAQLHGLLKLRVDVFVVEQECPYPEVDGLDLE
FT                   PTTTHVWVERDGQVASTLRLLDADGPAGPLVIGRVVTAPDHRGTGLAAELMGWVLERRG
FT                   RRTLELEAQSHLAGWYERFGFVRTGPDFDWDGIAHTPMERRPSVGQGA"
FT   gene            612993..613415
FT                   /locus_tag="Ksed_06210"
FT   CDS_pept        612993..613415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06210"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05684"
FT                   /db_xref="GOA:C7NLL8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL8"
FT                   /protein_id="ACV05684.1"
FT                   /translation="MADLSDHGPKPYTVNIEEATLANENFRATLWTGEFLQMTVMTIPP
FT                   GGEVGLEMHDDHDQFIRVEQGQARAQMGPAKDDLSFDETIGDDWVAIVPAGQWHNFTNT
FT                   GDEPLKLYSLYGPPDHVKGTLHPTKDDADDDPNEQH"
FT   gene            613512..613874
FT                   /pseudo
FT                   /locus_tag="Ksed_06220"
FT   gene            complement(613892..614674)
FT                   /locus_tag="Ksed_06230"
FT   CDS_pept        complement(613892..614674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05685"
FT                   /db_xref="GOA:C7NLL9"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLL9"
FT                   /protein_id="ACV05685.1"
FT                   /translation="MSTQTPPPPQDGPQHDHYGQHGQHSAWQAAPTPPRRRNWFRRHKF
FT                   LTALLAIVALVGLTQLGGGNDDAAPSASNSPTKEAASAAETGQDAEPAGDGGDQEPAAD
FT                   EQADQEPADEEQAEEAPAPAQDDAPGVGDPVSAGDFEYTVTKVTPGVKQIGDSTFGQKP
FT                   QGQFVLVKLSVTNTGSEAQMFNDSEHKLVDTEGREHSADGEAAIYVPGNDSFLEDVNPG
FT                   NTLKGTIVFDVPADAKPQELKLMGPGFWDPAEVVVSVR"
FT   gene            614813..616129
FT                   /locus_tag="Ksed_06240"
FT   CDS_pept        614813..616129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06240"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05686"
FT                   /db_xref="GOA:C7NLM0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM0"
FT                   /protein_id="ACV05686.1"
FT                   /translation="MAEEIVGADAYGGAMTMRTTAAALRGRRRVAWWAMMLPTVVLGVL
FT                   CATLSIGLAFERAGQEATAWMMWLIIGCLGVLGQPALLLAVRARPVAVGYGTSLASLLW
FT                   PLGWFVPVVAWALAIVYAPARADDSADGGDVPVIGLLTAVGMWWIVWRDSIQATDKGSL
FT                   FKLLLHAPAEGQQAPQSSDPLPWWFAVALTALLMTLVGTLAQAVRSRREGAAARARTAR
FT                   AEGERDHTRTELGRQVERERIAREVHDTLGHRLSLLSVHAGALELQAEGRDEEVSRSAA
FT                   LVRQGARQAMDDLRSLVGILREDPDGSPAPSLVDLPSVIDEVAAAGDPVVATVYLHDVE
FT                   GADEALSRAVYRIVQELLTNARKHAPGVPVRLVVEGSPLHGVSVETVNRLEGVPRAGGA
FT                   GLAGVRERAELLGGSVEAGPAGGVFRARAWLPWRGRQGE"
FT   gene            616178..616864
FT                   /locus_tag="Ksed_06250"
FT   CDS_pept        616178..616864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06250"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05687"
FT                   /db_xref="GOA:C7NLM1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM1"
FT                   /protein_id="ACV05687.1"
FT                   /translation="MPRTAAEGPPTKVLVVDDDRLLCAGLTSILHTTPDLVVVAAVHDG
FT                   AQVQGAVDAHRPDVVLLDIRMPVLDGIEATRQLAARASRPAIVVMTTFEGDDTVVRALG
FT                   AGADGFLLKAEDPRQIIDAVRSAAAGHSPLSPTSARSLVRLVGPGSRADLASRARELAA
FT                   GLTERERQVAALVGEGLTTPQIAARLFVSEATVKTQLAEVQRKWGCENRTQVAVWADRA
FT                   GLIAHD"
FT   gene            complement(616884..617681)
FT                   /locus_tag="Ksed_06260"
FT   CDS_pept        complement(616884..617681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06260"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="PFAM: Formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05688"
FT                   /db_xref="GOA:C7NLM2"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM2"
FT                   /protein_id="ACV05688.1"
FT                   /translation="MTDVANHPDENHAEEEIRSEYHEVRQEGAERLHRSWRALVATGLL
FT                   GGIEIGLGVLAYIATLDATDSHLLAGLAFSIGLVAILLAHSELFTEGFLYPVIGVLAGE
FT                   GSVGQLLRLWGITLVTNLVGGWLVMWLVVLGFPDLHGTLVESARHFVEVPLSAKGAALA
FT                   LLGGLVITLMTRMHAGSESDFGKITASVACGFLLAGLSLFHSVLDSIIIFGAQHTGAEG
FT                   VGWGAWWNWFWWTALLNLVGGVVGVTAPRAVRASEVHTDPAEA"
FT   gene            618204..618569
FT                   /locus_tag="Ksed_06270"
FT   CDS_pept        618204..618569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05689"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM3"
FT                   /protein_id="ACV05689.1"
FT                   /translation="MLRAVGMTQTFLSPAQVDELVALYEEGATLVDLGERFGIHRRTAA
FT                   AHLVRRSVPIRRLGLDERHLAEAVELYSGGLTLMEVGLRFGVSQQAVRRALAAKGVEIR
FT                   SSGRRQLAVNQSARSAP"
FT   gene            complement(618615..619613)
FT                   /locus_tag="Ksed_06280"
FT   CDS_pept        complement(618615..619613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05690"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM4"
FT                   /protein_id="ACV05690.1"
FT                   /translation="MLHVYLDQFAWIGLARAAHGRPDGARYRDALEMCRAARAHEVASF
FT                   PLDLYRYWETAKNHNDGSRNRLVDTMIELSDFDAITTPKQLLQYEIDIALRARFGRPND
FT                   VTAPRVFGRGIAHLTAGGVHNSKRRTDQRTASEDKSSDLRTPIDRPLEELLLRAGPSTH
FT                   ARAGLPLDLVNWGGLFVRHEVSVAEEIARRKVPRAELLPAVVHSDFNDIAPAIRERVTA
FT                   AGISATEVTETLGGVGLLQLVESLPTRRVTNALRVSKHLHPRSHQKWKANDFIDVVQLP
FT                   VPAVYCDVVFTEQQWVRALTREKDGRLDERFDTKLIFEPEQLVEVLVAASL"
FT   gene            complement(619753..622887)
FT                   /locus_tag="Ksed_06290"
FT   CDS_pept        complement(619753..622887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05691"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM5"
FT                   /protein_id="ACV05691.1"
FT                   /translation="MTEHIPEAEAYIRFRLDELSSRNEHHRFEEIATRVAQKRISSNIL
FT                   IATGPVSSGGDQQRDAETFTTRLPSELPHSAGFAAAAATSPVVVACTVQSGSLKQKVLS
FT                   DLAGICANDAADVDHVAFFSVHPISEGVTHDVQRTARESYGVTLDIFCGGDIATFLAEA
FT                   DLVWVARHYLELPSHLVPTPEDEPAPQWYADLIDGLRHNHGPEALTPAVQGEITHGLRH
FT                   ATWDEHANADLPEWLDFMGAFLADSADGSDTELVFRACYEMAIARFRGMGVAAGIEDLV
FT                   RRAVDYACTSTRPNIVDDAVTLCAYWGTMWMTGVAKAEASEISAAMLRLRSHLVNLLDA
FT                   TDSVTHPVRSATLTGTLAFTHLVPDWERIETTDGKPPPAAVASNVGVQLDEFAVDTSAL
FT                   PVSYLFDFDAAMSFLEKLVDLLPRARAYSSSELARLFTMYAPAASGHTNYEKVRDGFDI
FT                   VLAQVQGDSATAERCRDRGMAFVRAGQPLKALAELHNAKAQWFNGDTIYGAILTMRYLG
FT                   SLYAGLGLMYAAKMYACTAAALAMMSDDIDVQVHVPKALLETAKYAQQAGAWVDAARLT
FT                   EVALLARAQMLTDPFDYDKHPDLAAHDTNATLELAGIRTFWPELEPLIEAALKTTNWYK
FT                   QLVEVIEHDDSRFDMTEHEFQARAAEELAGPLLGDVGHRRLIDFQALGVRWTFQFDNNR
FT                   ETVLTAEGFVAALQVLLADIAPMNPVLIKSTIRVTVDVRPGASREDDSIDIDDSRPEVL
FT                   ANVVLSNSLTDPEAHNRAILAMCYQLLHAVHVRPPDELQDLLEPLFRGGLIHKVSIGRP
FT                   YEETAALLDDDHYARCADASRPSSSDAFQPTECEHLPASTVTGPGYDRDESLQAIRERY
FT                   EVANEALRFTLPRLLSDQAGRATIVRLRNDGWLDWQILVALVNTSMNWRMKRAGLRPGV
FT                   GDPRRALDLAREPETSASPTMPLSEFTDDVVDMHIFTQTVSVARRWNLRGRPEAPGENA
FT                   MRDLLTRRYRYATDDIPHRDLLDCIDKDGNLLTLLDIPADHGDDGHRVRDANGPA"
FT   gene            complement(623024..625588)
FT                   /locus_tag="Ksed_06300"
FT   CDS_pept        complement(623024..625588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05692"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM6"
FT                   /protein_id="ACV05692.1"
FT                   /translation="MTDATPPQRVDPRDLLSEWANTSDEWVRYIVRHVLNGRGPLGSEE
FT                   QSGTYVLFRQEKAFDTRELPTEEPLFTLEREDEAIEPLTLTSLSDVVGVNALVEGGVIE
FT                   PHAGLTILFGENGTGKTGYSRIFKALAASRTADVILGDIEAASPQPQSALVGYTLGTET
FT                   KTYTWTGQQGVAPFTRMSIFDSPSVSFHVDDDLEYVYVPAALALFNHVIAGIKSVQAHI
FT                   DQAVEDLRSGSTGLLSRFPRTAAVYPLIETLGASTDLEHLRSLADSDPDVETRIGDLRR
FT                   TVAALEADTISAEIKLQQRVERVLTQASNAATVMADFNVEAYGRERDTLHGLEEDYRAF
FT                   RAALFEAADLPAEPDDTWSTFVEAGEAYQAHLIAVGAHDADRCLYCRQPLNEAARSLIG
FT                   KYSEYMEDKITTDIAASKARLHALTEPVTSIQVNDVSTFADEYADTEDKPHFHVELDRT
FT                   LSTIAELSEQLLAASAVNAALTEHAGTDAIALGSALETAKRALGELRTQAATRADTLAE
FT                   KKKELVELEAAAELTKSWTLIESHVRDAKQADRLMLLAKPMPGLLRAVTGLAKTASDQM
FT                   INESFDALFSEECAALRAPALHVEFVGRQGRAQRRKILSGKHKPSKVLSEGEQKVLAIA
FT                   DFLAEARLAGITAPVIFDDPVSSLDHRRINEVAQRVASLADTTQVIVFTHDIFFASTLL
FT                   TLMEATKRCSYFQITDEEGKGKVTRATGPRWDSLNNIKKNINETIQAAKSQDGDARAAL
FT                   VRTGYDWVRAWCEVFTETELLQGVTQRYQPNVRMTNLPKIKSEALPAAIGTVNRIFEEA
FT                   CRYIDGHSQPLPSLGVSPTLAGLEAHWAELTEARNAYNSATP"
FT   gene            625915..626022
FT                   /locus_tag="Ksed_06310"
FT   CDS_pept        625915..626022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05693"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM7"
FT                   /protein_id="ACV05693.1"
FT                   /translation="MMNFIAFHTDQSTTRCSQPGAPWSRALVQMLAISR"
FT   gene            complement(626315..627979)
FT                   /locus_tag="Ksed_06320"
FT   CDS_pept        complement(626315..627979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06320"
FT                   /product="dinucleotide-utilizing enzyme possibly involved
FT                   in molybdopterin or thiamin biosynthesis"
FT                   /note="PFAM: ThiF family; TIGRFAM: UbiD family
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05694"
FT                   /db_xref="GOA:C7NLM8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR032865"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM8"
FT                   /protein_id="ACV05694.1"
FT                   /translation="MRIAQQPQVGTDGDATLRLRLHTADIPHRPGGLELGDDEEFIVKI
FT                   RPSLFAPPSAEVDHTRFLGFPHVLQGQRLCIYLDPSREWRPSAGMAGFLSRLWGWLTDA
FT                   AAGAFDPSTAMYHAVGGVLHHAEDTPTIVVREPGPPKRQQIARLVARSPHRYDLTYSTD
FT                   REGHRTPVFVLASDLPFGAASTFALFLTLLDDPHLHRAEGRPPEVSPQSPAFLTSLLAS
FT                   ALRNPDGTEQYFVLAVPHPAGGPHHLLGGRLPATTADALRRLAKKHGTAVNLDPAIINA
FT                   DIPIEWCNMSDERQEVTTRRDDNRPVNGFQGKTVHIWGCGGLGSWLAEFIARAGASAIT
FT                   VCDPGTITGGLLVRQNYTEADIGQTKADALATRLRAIRDDLTVTVAEGSVPDPAVSLSA
FT                   DLIIDATVSHSITTYLDTLAGEDRTALIAQVATDARTGTLGIANIRASGDSCTPSELDD
FT                   QAGRSVTADGGLELYHPLWEEAAEGDELTPTRGCSVPTFHGSAADLAAVAATLVNMIGL
FT                   HLQQAETPVSGTHLIALPHAPTGPRHHFLPAASDTRG"
FT   gene            complement(628066..629058)
FT                   /locus_tag="Ksed_06330"
FT   CDS_pept        complement(628066..629058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05695"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLM9"
FT                   /protein_id="ACV05695.1"
FT                   /translation="MKLTDYFNVLLKDTVNLGQVKLDSLDSRVEAVYKALKADEQIGHL
FT                   ILGKTPQGSWAHKTIINPVGSNEFDADFMLDMSENTDWSDDPKKYIEEVYAALHRHSTY
FT                   GNMPHSRKCRCVRVVYANSMHLDIVPHLNLADGREVIVNRDDNDWELTDPQGFTDWMKN
FT                   KDALAKGNLRKVIRLMKYLRDHKNSFTGTRSILLTTLLGEQVTELRTLLNPGYYSDVPT
FT                   TLLHLVKDLDAWLQARPTKPSIPDPSGSGVTFDHRWEQSTYSYFRDRIHVHAAEIEEAY
FT                   KEENKERSIELWQGIFGDGFKAPATSSSAKFPAAAPAAASTVGRSGRAG"
FT   gene            complement(629055..629981)
FT                   /locus_tag="Ksed_06340"
FT   CDS_pept        complement(629055..629981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06340"
FT                   /product="patatin"
FT                   /note="PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05696"
FT                   /db_xref="GOA:C7NLN0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN0"
FT                   /protein_id="ACV05696.1"
FT                   /translation="MLARLEQDLGVSIKDSFDLIAGTSAGGIVALGLGAGLTPSEIVGH
FT                   YEELVEAVFPAARRRLWRRARQLTAPIYDGDALRTALTKVLGEGLLGDSAKRLVIPAWD
FT                   VQRGSVHIFKTPHHARLARDWRIPMVDIAMATSAAPLYFPAARVDGHRLIDGGVWANNP
FT                   SVVAIAEAVSMLDVPLASIRVLNVGTIDQLTNHPKRLDRGGLFNWAKPIAPLILTAGSR
FT                   GGQGIAEHLIGKAAFTRFDALVPGGLYALDSADPSDVAGLAASVSRELSPIYTARFADH
FT                   RAADYTPLIGDRHRGDPTSTSTTEVTR"
FT   gene            complement(630285..630554)
FT                   /locus_tag="Ksed_06350"
FT   CDS_pept        complement(630285..630554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05697"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN1"
FT                   /protein_id="ACV05697.1"
FT                   /translation="MSTLLISYDLNKPGQKYDDLYEKIKALGTWWHYLDSTWIVVSSLS
FT                   PSQAFDRLKPALDDSDRVLVVDISGDSYSGWLPQKAWDWLRKHV"
FT   gene            complement(630616..630786)
FT                   /locus_tag="Ksed_06360"
FT   CDS_pept        complement(630616..630786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05698"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN2"
FT                   /protein_id="ACV05698.1"
FT                   /translation="MEVKEMAKNTGRGHRVGAVKSRSEFKRGTTWFKRDTGTGRILNGS
FT                   PNQHKGVRNEK"
FT   gene            complement(630858..631415)
FT                   /locus_tag="Ksed_06370"
FT   CDS_pept        complement(630858..631415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05699"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN3"
FT                   /protein_id="ACV05699.1"
FT                   /translation="MCAIALAKHLPGLGAIAIIDRYTGTVTHASVKPDPEQGWPTVFPW
FT                   RDQKLTEGHPLLNLTPGASTARRLAWRTPWGTQADFYVDAVSDDKRAIVVFCDLDLWNV
FT                   EQFHAPIQRDFDSRPLLTGSCCGTTFERRGYPCSNCGQPFCPRCGDCRCERDAKREVVC
FT                   TECFLQFQPHLVVDGLCVDCRS"
FT   gene            complement(631606..632010)
FT                   /locus_tag="Ksed_06380"
FT   CDS_pept        complement(631606..632010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05700"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ3"
FT                   /protein_id="ACV05700.1"
FT                   /translation="MTTPPIGSLHHVELWVPDIVRATTHWGWLLGELGYQPFQDWPGGR
FT                   SWRLADTYIVIEESPDLTGREHDRQRPGLNHLAFHAGDRAKVDEFADTAHANGWTLLFA
FT                   DKHPHAGGADSYAAYLANYDGYEVELIAHD"
FT   gene            complement(632007..633287)
FT                   /locus_tag="Ksed_06390"
FT   CDS_pept        complement(632007..633287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06390"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05701"
FT                   /db_xref="GOA:C7NIJ2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7NIJ2"
FT                   /protein_id="ACV05701.1"
FT                   /translation="MLKVVHDAETSNDDSTDGTGTAGGSLLDEIVRDGARQMLAAALQA
FT                   EVGAYIEAHAHEVDEDGHRLVVRNGYHQPREVTTSSGAVPVTAPRINDKRVDEATGERA
FT                   RFASAILPAWARKSPQVTEVLPLLYLHGLSSNDFAPALEQFLGSSAGLSAATITRLTKD
FT                   WQHEARSFNERSLTDADYVYVWVDGIHLKVRLEQDRVCLLVMIGVRADGHKELIALQDG
FT                   HRESTESWADLLRDCKRRGMRDPVLAVGDGALGFWAAVRQVFPDTREQRCLFHKISNVL
FT                   NALPKSAQPGAKKALAEIWQAEDKEHARSGARAFASEYGKKWPKAAAKITDDLDVLLEF
FT                   YDYPAEHWIHLRTTNPIESTFATVRLRQRVTKGPGSRAAGVAMAFKLIESAQTRWRAVN
FT                   APHLVALVRAGAVFEKGKLIERTQGAA"
FT   gene            complement(633384..633734)
FT                   /locus_tag="Ksed_06400"
FT   CDS_pept        complement(633384..633734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05702"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN6"
FT                   /protein_id="ACV05702.1"
FT                   /translation="MNLEGCVDQALSLLTDDVRARFAGNPTSVLRADLDLTVSAVEHLA
FT                   SSRDDGGACDGVSFLQDGVILYAPTPWSRRENFTLAHELGHWLAERAPDIYDWIADQDG
FT                   GMIRTCGWPSAG"
FT   gene            634126..635433
FT                   /locus_tag="Ksed_06410"
FT   CDS_pept        634126..635433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06410"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05703"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NKS2"
FT                   /protein_id="ACV05703.1"
FT                   /translation="MPDATFTRPDLTTFAGLDDLGLEVTGQRLEPDRAVLACRVVEPGD
FT                   WCRRCGCQGVARDTVTRELAHEPFGWRPTTLLLTVRRYRCPECGHVWRQDTTAAAEPRA
FT                   KISRAGLRWGLVAIVIGHLSMARVAEGLAVSWNTANDAVLAEGQRLLIDRPSRLDGVNA
FT                   VGVDEHVWRHTRKGDKYVTVIIDLTPVRDGTGPSRLLDVVEGRSKKAFKDWLAQRDQAW
FT                   RDGIEVVAMDGFAGFKTATTEELPGAVTVMDPFHVIRLAGDALDECRRRVQQELHGHRG
FT                   RKDDPLYSARRTLHTGADLLTDRQHERLDKLFTGDRHVQVECTWGIYQRMISAYRDPNR
FT                   VTGRVEMSSVIDALADGVPRPLVELRKLGRTLARRVCDVLAYFERPRTSNGPTEAVNGR
FT                   LEHLRGLALGFRNLTHYIARALLEAGGFRPRLHPRL"
FT   gene            635684..635842
FT                   /locus_tag="Ksed_06420"
FT   CDS_pept        635684..635842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05704"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN8"
FT                   /protein_id="ACV05704.1"
FT                   /translation="MGRKPECVRGLNDASEFCALSIGQLSVTQDQFALLRSFEQLGDKP
FT                   VAFIVIH"
FT   gene            complement(635832..636389)
FT                   /locus_tag="Ksed_06430"
FT   CDS_pept        complement(635832..636389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06430"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05705"
FT                   /db_xref="GOA:C7NLN9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLN9"
FT                   /protein_id="ACV05705.1"
FT                   /translation="MAEAAAMSYMPPDLGALYLRHRDAMHKVAASVLREAGRASEADDA
FT                   VHDAIVSIMASPPENVRNWEAFLVTAAKRKALDRIRSAEVRHAGPEFVEASHDRADDSD
FT                   LGEDVADAIDQQERAGHAWDCLSVLDERHRKAVWETTALGRPRSEVATELSVTPARVSQ
FT                   MTTRSPALLREEMRRREEGINE"
FT   gene            complement(636588..640142)
FT                   /locus_tag="Ksed_06440"
FT   CDS_pept        complement(636588..640142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06440"
FT                   /product="TrwC relaxase"
FT                   /note="PFAM: TrwC relaxase; TIGRFAM: conjugative relaxase
FT                   domain, TrwC/TraI family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05706"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP0"
FT                   /protein_id="ACV05706.1"
FT                   /translation="MVTVSMRVMSAGDGYKYLLRTVAAADGDRELSTPLTRYYLEAGTP
FT                   RGQWLGSGVASLGKGQLAVGNRVSEAQLQLLMGMGRDPITGDPLGHAFPAYRSVSEKIE
FT                   ARIVDLDPDLSPGVKGEAVARIEAEESERGRRRAVAGFDFTFSVPKSASALWAVADAGT
FT                   QALIGEAHHAAVAEVVAFMEREVAATRTGATAGDGAVAQVDVTGFVATAFDHFDSRAGD
FT                   PHLHTHVVISNKVQTAFDGKWRSLDGRPMHAAVVALSELHEAVFADHMTRTFGVEWEAR
FT                   DMGRDRNPAWAISTVPEELVQEFSTRARHIDAEKNRLIAEYVARHGRQPSTATIIKLRA
FT                   QATLATRPEKAVRSLADLTSDWRTRATGVLGQDATGWARTITDNDQPLLLRADDVPLDA
FT                   IGELGQTVVEVVGEKRSTWRRWNLMAEASRQTMGWRFATMHDREAVVAMVADAAEQASL
FT                   RLTPPDLATSPATFRRGDGTSVFRPKHSTVFSSELLLAAEERLLDRSRTLTAPTVPVTT
FT                   VEKITNKPDHEGRMLGEDQTDVLMKIAVSGRMLDVLVGPAGAGKTTAMSALRRAWEKEH
FT                   GSGSVVGLAPSAVAAQVLADDLGIRCENTAKWWQNHLIDGTDFEAGQLVIIDEASLAGT
FT                   LSLDRITHLAERAGAKVLLVGDYGQLQSVDAGGAFGLLVGDRNEAPELVDVHRFTHEWE
FT                   KTASLALRHGRTQVIDTYLDHDRIHEGEAEAMTDAAYTAWRTDRDRGLVSVLVAETRDD
FT                   VSALNQRARADLILDGTLTPGQEVELTDGTTAGIGDTIITRRNDRRLRNGKDWVRNGDT
FT                   WTITGVRDDGSVTIRKTGRRFGGTIVLPTTYVADHVDLGYAITAHRAQGVTVDTAHVLV
FT                   EPTTTRENFYVAMTRGKHSNRAYVILDRADEHAYPHPGDNPDATAHSVLYGVLQHVGAE
FT                   LSAHETITAEQERWGSIAQLAAEYETIAAAAQHDRWAILIRNAGLTAEQADATIESEAF
FT                   GALTAELRRAEANHHDLDTLLPRLVTARGFADADDIASVLHYRVARATARPAGSGRTHK
FT                   APRLIAGLIPSADGPMTDDMRQALDERRELIEARADAVLDTARDAGEAWTRPLGDPPRD
FT                   PRKTAAWRRHARTVAAYRDRYGITDDTPLGPAPENAAQKIDAARARSALVRARDIAQER
FT                   PRDAERRPVEQAAPTRSL"
FT   gene            640493..641215
FT                   /locus_tag="Ksed_06450"
FT   CDS_pept        640493..641215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06450"
FT                   /product="dehydrogenase of unknown specificity, short-chain
FT                   alcohol dehydrogenase like protein"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05707"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP1"
FT                   /protein_id="ACV05707.1"
FT                   /translation="MTTVLITGGNRGLGRAVAEELVERGMTVVVGARQASDGVEAARQI
FT                   GGGATSVQLDVTDPASIGQAAAWIQEHHGRLDVLINNAGVLPEATSQSAEAVNLDLFQQ
FT                   TYATNVFGPIAVLETFLPELRKSSQGRIVNVSTTMGSLADQTDPSSAYYGMIVPAYQSS
FT                   KAALNNITIALAKALADTSIKVTSVCPGFVQTDLTPVNREQAPLTATQAAEVVVAAATL
FT                   PDDAPSGTFIDSNGTVPW"
FT   gene            641378..641875
FT                   /locus_tag="Ksed_06460"
FT   CDS_pept        641378..641875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06460"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05708"
FT                   /db_xref="GOA:C7NLP2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP2"
FT                   /protein_id="ACV05708.1"
FT                   /translation="MKYPFEQAVKEHGQTVLRVCRAVLGPNLDAEDAWSETFLAALQAW
FT                   PELPEDTNVEAWLVRVAHRKAIDILRAHARHAIPTGDLPEQTSSLGNPGSDEHGVWAEV
FT                   GALPERQRLAVAYHYLGGLPHAETAALIGGSTDAVRRAAADGIKSLRQTYHAGEHTKGA
FT                   SR"
FT   gene            641872..642516
FT                   /locus_tag="Ksed_06470"
FT   CDS_pept        641872..642516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06470"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /note="PFAM: 6-O-methylguanine DNA methyltransferase,
FT                   ribonuclease-like domain; 6-O-methylguanine DNA
FT                   methyltransferase, DNA binding domain; TIGRFAM:
FT                   O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05709"
FT                   /db_xref="GOA:C7NLP3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP3"
FT                   /protein_id="ACV05709.1"
FT                   /translation="MTDVTPVGISRPTDDGKGAEHAAIFPIEPDKMADLHTRLAALASE
FT                   QGLLDVAYRTIDTPIGPLLLAATEKGLVRVAFERENFDTVLESLAQKISPRVLEAPRRL
FT                   DAVAAEIDEYFNGKRHVFDLPLDYAMSSGFRQMVQRYLPHIGYGHTQSYKEVAELVGSP
FT                   KAVRAVGTACATNPLPVVVPCHRVLRADGSLGGYIGGLDAKTALLTLEKAA"
FT   gene            642513..643241
FT                   /locus_tag="Ksed_06480"
FT   CDS_pept        642513..643241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06480"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2086)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05710"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP4"
FT                   /protein_id="ACV05710.1"
FT                   /translation="MNTKTESDVYAQRVDSGDWESITEEVNEYGGALLPQLLTPAEAEE
FT                   IRDLYDVDDAFRQTVNMGRVRFGEGQYKYFHAPYPEPIERLKQALYPHLLPIARDWWGK
FT                   LAREAIWPDTLDEWLQMCHEAGQDKSTAILLKYGEKDWNALHRDLYGDLVFPLQVVINL
FT                   NNPGVDHTGGEFLLLEQRPRAQSRGSAFLLPRGHGYVFTTRDRPVESKRGWSAAPVRHG
FT                   VSAIRTGERFTLALVFHDAA"
FT   gene            643249..643521
FT                   /locus_tag="Ksed_06490"
FT   CDS_pept        643249..643521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05711"
FT                   /db_xref="GOA:C7NLP5"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP5"
FT                   /protein_id="ACV05711.1"
FT                   /translation="MTEKTYTLLGADRKPYESTIPGTLGGHRDGRIYGRMDCPAALRAI
FT                   ANGGYVKNRVFFADETAAIAAGFRPCGACLPEKYAAWKQARKETG"
FT   gene            643518..644051
FT                   /locus_tag="Ksed_06500"
FT   CDS_pept        643518..644051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05712"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP6"
FT                   /protein_id="ACV05712.1"
FT                   /translation="MSYSPRLSRPSMAHDVVLEPASDAEIDALVWLAYHLGARNVVIGH
FT                   GRDDVSCMNAARFARDWEAGGEAVMVQVPWREEAASWLRQARRLVTPGPDLWVLGGAAT
FT                   GLAQMTRRLAWSTSWEPCRTLVLGTRTMSEALRLAGGGVLEGVRGAHSDGALWQIRDDS
FT                   MEALHPAEVERSQR"
FT   gene            644048..644719
FT                   /locus_tag="Ksed_06510"
FT   CDS_pept        644048..644719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06510"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /note="TIGRFAM: DNA alkylation damage repair protein AlkB"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05713"
FT                   /db_xref="GOA:C7NLP7"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP7"
FT                   /protein_id="ACV05713.1"
FT                   /translation="MSTLFGDDMIDRLTITLPEGAYYVPGWLTLEQQRWIVARFHEWTN
FT                   GPVPIRAAKVRGHEMSVRTVCLGWHWRPHAYTREAVDVNGNRVLDFPDWMVRLGRKALV
FT                   TATGNPYAGDGYLPDTALVNYYDDAARMGMHQDRDERSAAPVVSLSIGDTCRFRFGNTE
FT                   TRNKPYQDVNLASGDLFVFGGPSRLAYHGIPKVYPDTAPEGCGLADGRINITMRVTGLD
FT                   G"
FT   gene            644768..645403
FT                   /locus_tag="Ksed_06520"
FT   CDS_pept        644768..645403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06520"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: Methyladenine glycosylase; TIGRFAM:
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05714"
FT                   /db_xref="GOA:C7NLP8"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP8"
FT                   /protein_id="ACV05714.1"
FT                   /translation="MSASTPTGPSGAAEDLGIVVGDDGLARPAWASIDPMLRDYYDTEW
FT                   GMPVRDEQGMYERISLEAFQAGLSWATILRKRSAFRAAFDDFDPEQVARYGAVEIERLM
FT                   ADAGIVRNQAKIHAAITNANATIRLREKGGLAEFVWSFQPTETPAPRTFAEIPTKSPES
FT                   LALSKALRKEGFAFVGPTTMYALMEAIGIIDTHLIRSHRRSSSGVWPA"
FT   gene            645400..646260
FT                   /locus_tag="Ksed_06530"
FT   CDS_pept        645400..646260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06530"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase"
FT                   /note="PFAM: HhH-GPD superfamily base excision DNA repair
FT                   protein; AlkA N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05715"
FT                   /db_xref="GOA:C7NLP9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLP9"
FT                   /protein_id="ACV05715.1"
FT                   /translation="MSAVSRTRIDANGPFDRVAALGTLTAHAVDGLHRLDPDTTELTRW
FT                   VDVHGDPQLVTVCLDPGGATVSTATRDAGVSDEIAARVQHWFDLDTDLTPVNARLGADP
FT                   VLAGQVRSRPGIRITRFHAPFEAVILTVLGQQVSLAAGRLFAARLIAAYGDDAAPVRQE
FT                   PGLRVFPTPVALTAVPVEELRAVIGLTGTRARTVHAVAAHFAETARDASLPARAELHAV
FT                   HGIGPWTLDYLAIRASTDADAFPATDAVLRRTLAAISPDTGPERAASWSPYRSYAASRL
FT                   WAHTL"
FT   gene            646506..647342
FT                   /locus_tag="Ksed_06540"
FT   CDS_pept        646506..647342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06540"
FT                   /product="DNA-binding domain-containing protein, AraC-type"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05716"
FT                   /db_xref="GOA:C7NLQ0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ0"
FT                   /protein_id="ACV05716.1"
FT                   /translation="MAYDCVKVIVVRSGSAILFSEFGQRPVNVGDAVILGANVLCGSEP
FT                   EGHITVTTIYLDTDYVIDQVFWQHAGLLQDRLEAHWLAETVYSEPAQILRLGEERAGML
FT                   MPWLDELVDRSIDGDFARSFYRMQAVWFSIAHVIAPFVKVSPVRISASQRAHIRPTLPR
FT                   HRQFAPLRAEARRAAELLHRAPEEHWTLDALAARVHLSPSQLSRVFTDAYGKTPLAYLT
FT                   MLRAEHLAKSLRETDLPIETAMREVGWRSRGHAAQQFRKYVGLTPTRYRQLTLRAS"
FT   gene            647593..647733
FT                   /locus_tag="Ksed_06550"
FT   CDS_pept        647593..647733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05717"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ1"
FT                   /protein_id="ACV05717.1"
FT                   /translation="MATRQEARQAREAKLNELHARLTGAVEQLVSGPDWVRALAFAARF
FT                   S"
FT   gene            647847..649094
FT                   /locus_tag="Ksed_06560"
FT   CDS_pept        647847..649094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06560"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05718"
FT                   /db_xref="GOA:C7NFX3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7NFX3"
FT                   /protein_id="ACV05718.1"
FT                   /translation="MTAPHIVDPAGLLGEALAEASPDLMRHLLQEVINALLSADADAVV
FT                   GAEYGRPSQTRTAQRNGYRHRDLDTRVGTIDVAVPKLRTGTYFPQWLLERRKRAESALI
FT                   TVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMAAELDEHVEEFRHRPLDTAGPWT
FT                   FISADALTMKVREGGRVINTVALIATGVNNDGRREVLGLRVATGETHSAWNEFFADLVA
FT                   RGLTGVQLVTSDAHVGLVEALRANLPGATWQRCRTHYAANLMATCPKSMWPAVKAMLHS
FT                   VYDQPDAPAVEAQFDRLLDYVAEKLPDVHDHLDAARADILAFTAFPKDVWSQIWSNNPA
FT                   ERLNREIRRRTDSVGIFPNRAAVVRLVGAVLAEQTDEWAEGRRYMGLDLLARCRLHLVT
FT                   TPEETTTTTTLPALTA"
FT   gene            649119..649982
FT                   /locus_tag="Ksed_06570"
FT   CDS_pept        649119..649982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06570"
FT                   /product="protein of unknown function (DUF955)"
FT                   /note="PFAM: Domain of unknown function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05719"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ3"
FT                   /protein_id="ACV05719.1"
FT                   /translation="MPLHHSTGLDPRFRSRSFNNTLLIWVAHEEAFEQGRVPKPFPSYV
FT                   AGYKQWQALGRQVEKGQPGYQILAPVTGRFASANPADAESWRRLGKGEKPRAGEVVRSK
FT                   MVGVRPAMIHGANGVTDYTARTVAVRENMDPAAQVKTLAHELGHVLLHGPDSDEARQHR
FT                   GIGEVEAESVALIFGAAHGMDTSGYTIPYVSTWAARVDGKEPGEIVKATGERVRKTALS
FT                   ILDRLDTAQVADGAPPGLDRDAPQREEHSRTQPTHDALAPGRVTPLPEPEPRTVTASAT
FT                   TQARAL"
FT   gene            649979..650932
FT                   /locus_tag="Ksed_06580"
FT   CDS_pept        649979..650932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06580"
FT                   /product="DNA primase/polymerase-like protein"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase,
FT                   N-terminal; Primase C terminal 1 (PriCT-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05720"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ4"
FT                   /protein_id="ACV05720.1"
FT                   /translation="MTAAVDAVASVLGRAAGPRPVSVVARELAAVGVPVFPCLSGGKRP
FT                   LTTHGFHDATTDLERITAWWREHPEANLAVPTGAASGVVVVDVDVHGPVDGYRAFERAH
FT                   RAGLVSGWWQLLVATPSAGMHAYYPATPDREQRSWQAARAGIDFRGDGGYIVVPPSTVS
FT                   TGGKSAGYRVRRTNSGASSVLDSDQLREFLDPRPTPAGRSGRKVERSADVSRLAAWVAG
FT                   RGEGERNRGLFWAACRLAESNIPAPEALEVLAAAATQAGLGEREITATVRSAYRTIIRP
FT                   RPQTSSRVQDGSSPATDGWFSREATVRPSPPVRGLS"
FT   gene            650974..651909
FT                   /locus_tag="Ksed_06590"
FT   CDS_pept        650974..651909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05721"
FT                   /db_xref="GOA:C7NLQ5"
FT                   /db_xref="InterPro:IPR021235"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ5"
FT                   /protein_id="ACV05721.1"
FT                   /translation="MVTAVAGTVFIAAGAFWLSFTALADLAARSGVGGSQAWAWPLIVD
FT                   GIIVVATVAVVAMAGQRSAWYPWALLIGGAAVSVTANALHAVVAADADVPGVLAAAVAA
FT                   VPPVVLLAITHLTVILTRPQRLTDASVSRDDAVVEQEDRPGTRRASLHGGPLVHRGAPS
FT                   RQHRCRGGDPMSSEHDHDPRRPKADERVPEQDSARTAAESVEKSEASDAVRAARASHRR
FT                   GTERQTPAAETRRARGVEWVRPTDLIARHGAALAGRGIDFEVELARRTRTPIATGAQQL
FT                   GERARRLPPLSAFGRSSTAQAAPSPRVGMS"
FT   gene            651996..652907
FT                   /locus_tag="Ksed_06600"
FT   CDS_pept        651996..652907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05722"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ6"
FT                   /protein_id="ACV05722.1"
FT                   /translation="MTAHTRPVHDRSPIGIEDFTTGEGLRALLHRLHHGGRRAWQHDAH
FT                   AAELMAFTAEKYAPLARKHGLDPWEAASAAFDVMRTRAAREAHDPWAVVTHAVRITCIF
FT                   EERAQGLLCSVHQARRPHISAFHDPERFSDRETPLTDYHPAFHIPAADAPDAATESPAS
FT                   ARASTTAGSAVEDAVALFTLLDWPADTARAAVEHVCGALTRAGTRQAAYEALRRDKHAR
FT                   ALLDIPSHSWTALLKALLGHPHPAYTATGLGRGVLLRLLIGETLPVLLRDDDLVLSVSL
FT                   GAPHRRRRNHDDADEPRGSGSR"
FT   gene            652904..653914
FT                   /locus_tag="Ksed_06610"
FT   CDS_pept        652904..653914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06610"
FT                   /product="ParB-like nuclease"
FT                   /note="PFAM: ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05723"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ7"
FT                   /protein_id="ACV05723.1"
FT                   /translation="MSAPAGFIELERTVASIHVGRRHRTELGDIDALAASIDRDGLLQP
FT                   ITITPDGVLVCGARRLAAITQLGWKTVNVWVRSGISDRLGHLLAEQDDNVLHKPLTQLE
FT                   AAALYRELKQVMAEDAARRQAATRFSAQQQPGEDGAGKFPTPSDQGRASEQAARMIPGA
FT                   SSYKTMDKISDLQHIAADPAQPDELRQQATAALERIDAGNPVQPLYRQIREQVDTARGD
FT                   RDADLHQLATDALARIKTTTPKRRPARPTPAAGQGEGGPVRYPVRAFVLTWSELADWWT
FT                   HYDLDQLAAELTGEQIESFLATVDGTSRFAEELRATRDRHRGDHPMPGRGHLRAL"
FT   gene            653997..654647
FT                   /locus_tag="Ksed_06620"
FT   CDS_pept        653997..654647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05724"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ8"
FT                   /protein_id="ACV05724.1"
FT                   /translation="MIAVLAALVAVLVLAGIGVYGLITGPPTSTEPSSDDSNGPGPVVT
FT                   VPDPVPTQTPRLPVVRPSADPETFAGNVATALFSWDTASGFMPLDYTAVVLEVGDPSGA
FT                   EQAGLAADIATYLPSREAWVELRQYATTQHLTVDTIYVPDTWDDAVAQAQPGQLAEGTI
FT                   AYTIEGARHRDGVWNEQAVTSEHPVAFTVFLVCGPTYDTCHLLRLSQLDNPLR"
FT   gene            654662..656305
FT                   /locus_tag="Ksed_06630"
FT   CDS_pept        654662..656305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06630"
FT                   /product="metalloendopeptidase-like membrane protein"
FT                   /note="PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05725"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLQ9"
FT                   /protein_id="ACV05725.1"
FT                   /translation="MLKKLTVAALALVLLGPSLGLIGVGLVMNPAASATCTVTGTNVTV
FT                   GDVPDSLTVTTAGGEIFTLNRAQLTHAATIIETGSGIDGVTRDGLVIALMAALTESTLR
FT                   MLSNTSAYPESGDYPNDGDGSDHDSLGLFQMRPQSGWGTVADLMDPVYQARAFFGGPDG
FT                   PNHPSPRGLLDIPGWEQMDKGEAAQAVEVSAYPDRYRNYEPVAETILTTLTTTGASPAA
FT                   GATAVPAVQTVSAESSRVVFPVPESAWVLTSDYGPRVHPISGENSFHTGTDFAAPDGTP
FT                   ILAAADGTVTVAEFSGGYGGLIVVEHQIAGQTVATAYAHMWEHGIHVTAGDQVAAGQHI
FT                   GDIGSSGNSTGPHLHFEVRTGGTDGEHADPAAWLNSHHAADLPEPETGAPAGCDPGTAP
FT                   PGGEPDPVDGDPDALVDDPTSGGQITARMQHVYTQGIEAFPDTSWACYSPRPGTRSEHP
FT                   LGRACDLTFGNAIGQHPTPAQLEAGWAVTNWMKDHAEVLGVEYLIWQGRIWSAARDAEG
FT                   WRDYNGGGMHDPDDVTGGHYDHLHITVRAN"
FT   gene            656478..657599
FT                   /locus_tag="Ksed_06640"
FT   CDS_pept        656478..657599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06640"
FT                   /product="site-specific recombinase XerD"
FT                   /note="PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05726"
FT                   /db_xref="GOA:C7NLR0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR0"
FT                   /protein_id="ACV05726.1"
FT                   /translation="MDFEDGNRPGSVVALRPGNVSLLRPAEQVFDDMLTGWSAQQSSRM
FT                   LNPKTIQARLAQVRRFTGFCGNLPWEWAPADVEEWTTELVSGDKPCSHGTIRSYQNAVA
FT                   LFCDFLTDRRYGWIERCEELFGTHPVQICHEWNTAIHTGDHETRPAVRPLSRSEVQTFF
FT                   DYADDRVDQARTRGKKGWKSVFRDATLFKMIYAFGLRRREVGMLDLHDFTRNPTATEFG
FT                   RFGVCNVRWAKASRGSQPRRRAVLAVFDWTRPVIEEYVTDVLPLFDVADAAMLWPTERQ
FT                   SRITGSYIGMRFAEYRDDLGFDAALHPHCLRHSYVTHLIEDGFDPLFVQQQVGHRWGST
FT                   TALYTGVSGDYRNRTLRRALDAAFTPPTAIEEG"
FT   gene            657605..657943
FT                   /locus_tag="Ksed_06650"
FT   CDS_pept        657605..657943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05727"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR1"
FT                   /protein_id="ACV05727.1"
FT                   /translation="MTKTVAYHWHLRKVMNEHGMNATTDLVPLLAERGVVMTSTQVYRI
FT                   VTGEPERLNMRLLAALCDIFDVTPNDLIEPYVATSSRRGRKTGTTGATPPKPSKNRPTR
FT                   AVIKPAGD"
FT   gene            657953..659617
FT                   /locus_tag="Ksed_06660"
FT   CDS_pept        657953..659617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06660"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05728"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR2"
FT                   /protein_id="ACV05728.1"
FT                   /translation="MASTIVSGTCFRCGRVRNLRWNHALDRGECRACRARRSPKETCAG
FT                   CRRQRRVNARTRDGGALCVTCYARTRTTDDACDECGSIGPLAIRAGGRGSSSRSLCVRC
FT                   YRNPRRPCGICGRLKRVALKATATTPDVCPTCYQAPVIDCSLCGQQALGRRTTNHGWPR
FT                   CFACQSAQQIDAALTGPDGTIRPELKPVRDALTEFRQPRSLLNNWHDLPSLHLLTDIAR
FT                   GRLDLSHDALDARPQVFSVTYLRAMLVAAGALPPRDENAARLHRHAAEAVTDITDPELR
FT                   GVLTRYARWHVVGRAKTDRHGHLTAHVAARCRSDIQAAHAFLDHLTALGHDLDDCPQTC
FT                   VDAWLSTNRSARLTFIRWLKRGGYLPQTRLPDPVAQKDPSHDIDPEDQLARVRQFLHDP
FT                   DSASVEDRAAACLILLYAQPVAKIAALTTNDVGVRGGDTYLALGSEPMLLIPPLDALVT
FT                   ALPVAKPFGTASTLADTRWLFTGKNAGTHLHPASLMARMNRLGIITRASRNTALLHLVS
FT                   TTPPAVFASLIGIHVNTATRWAELTGSAWNNYAGARR"
FT   gene            complement(659688..660182)
FT                   /locus_tag="Ksed_06670"
FT   CDS_pept        complement(659688..660182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR3"
FT                   /protein_id="ACV05729.1"
FT                   /translation="MRDDDQRGGLLAQEVPVPGNPEDAQQLLYLLLGRAIARCQVAEAA
FT                   AETIHQVLLGKPPRERSTLGAKAKAVEPQLPDHLQAEYRNLVEARNYLVHRLLFDHGGW
FT                   KGIPGWDSPELYRKLYDSIDDATQTIDRVSDLLNRYLVDTNPEVTIFKISDEGVEDIRD
FT                   L"
FT   gene            complement(660321..660923)
FT                   /locus_tag="Ksed_06680"
FT   CDS_pept        complement(660321..660923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06680"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05730"
FT                   /db_xref="GOA:C7NLR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR4"
FT                   /protein_id="ACV05730.1"
FT                   /translation="MSRTASGLRERKRAAAMHRIQVAAVDLFDTHGFDHVTVEQVAAAA
FT                   HVSPSSIYRYFGTKEALVIRDEHDDTLMSSLARHLRDHDIYEATALALDDISEAHFVRD
FT                   AELTARRTRYYFEVPSVRAAWLMTIDQTRQALAEALTARRTAPQRTPTECHVIAASLVW
FT                   ALYTAVEQWYLAGAHEPLGPALRKALGAIHPQEDSHG"
FT   gene            661003..661956
FT                   /locus_tag="Ksed_06690"
FT   CDS_pept        661003..661956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06690"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05731"
FT                   /db_xref="GOA:C7NLR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR5"
FT                   /protein_id="ACV05731.1"
FT                   /translation="MAAGVAPASTDAVVEATGLVKRFGAARALDGLDLTVARGEVHGFL
FT                   GPNGAGKSTAIRGLLGQLRLDAGSARVFGLDPWRQAVEIHGLLAYVPGDVALWPSLTGG
FT                   ECIDLLLSLQGSGSRRRRAELLDRFQLDPTKRVRTYSKGNRQKVALIAALATDAELLVL
FT                   DEPTSGLDPVMEAEFQRSILEARDAGRTVLLSSHILGEVEALCDRVTIIRQGRTVRTGT
FT                   LDALRGDTLTSIEAVTAQPVVGLGRLEGVSALVERPVPGAVRTTFRAAQDELARAVGLV
FT                   VAAQPTSLVVAPPSLDELFLGHYQQDLPAGPAVIEG"
FT   gene            662112..663602
FT                   /locus_tag="Ksed_06700"
FT   CDS_pept        662112..663602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06700"
FT                   /product="putative exporter of polyketide antibiotics"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05732"
FT                   /db_xref="GOA:C7NLR6"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR6"
FT                   /protein_id="ACV05732.1"
FT                   /translation="MVTAVTASVADLYDDPAARELYAQTLGASPMTWALNGPAYDLHTV
FT                   GGIAVYEVGFFGLLVLPAIGIHLAVSRTRRPEESGVVELVTATRVGRLAPLGAALMVVT
FT                   GSVALSGVLSGVGLVVVGLPPGSSARYAIGIALLVLVHSGVGFVAAQICRGARASYMLA
FT                   LSAQLAMYLVRAVVDGLELSTTWATPMGWFAQIRPFGEQRVWPILALAALSAVFMALAV
FT                   SLREHRDLGAGLLQERNGAPEASRALRSPAGLLWRTSRSSFGGWMAASLAWGVGLGLLA
FT                   RDMQALVDTNPALATFLGASEAPEKAMTAVGATILALAAAAMALQGVGQLVGEEQSGRL
FT                   AALLATRTSRLNWWASAASVIALEVLAVLVMGGLALGGGTAMAIGDPGAVTSGIVACVA
FT                   YIPAVLVLGAAGGLLFTVQPAAAHLGWVLLAWSAIVALLGDTLQLPSSVRQLSPLEHVG
FT                   RVPVQDPQLAASAALSALAVLLVLAGGLALTRRDLRHN"
FT   gene            complement(663810..664124)
FT                   /locus_tag="Ksed_06710"
FT   CDS_pept        complement(663810..664124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06710"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05733"
FT                   /db_xref="GOA:C7NLR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR7"
FT                   /protein_id="ACV05733.1"
FT                   /translation="MISFITTDRRSGGNFGCSATLVLWYLLLMMVSFLKWCLVDAQLLL
FT                   RSRTRAGDHHQEFNGSETTSRAALVGRGHRELVALHGERDRPAVLQADAVGDHRRLDEV
FT                   "
FT   gene            664609..664875
FT                   /locus_tag="Ksed_06720"
FT   CDS_pept        664609..664875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05734"
FT                   /db_xref="GOA:C7NLR8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR8"
FT                   /protein_id="ACV05734.1"
FT                   /translation="MDVFPDFDGIGGIGDLRAVIGALLMFVLITAVLMLIVSAIIWAIA
FT                   AANGNYSAAGRGRTGVLVALGTAILAGAGVAWMNWLIDLGQQL"
FT   gene            664998..665309
FT                   /locus_tag="Ksed_06730"
FT   CDS_pept        664998..665309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05735"
FT                   /db_xref="GOA:C7NLR9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLR9"
FT                   /protein_id="ACV05735.1"
FT                   /translation="MFDLITALPALLPMDVDITPNDDGLPGIAQLRTIVGAVMTIGLIL
FT                   SVLALIISAIVWGFGANSSNPHLAGRGKIGVLVSCGAAVICGASVTLINFFWDVGQQV"
FT   gene            665349..666836
FT                   /locus_tag="Ksed_06740"
FT   CDS_pept        665349..666836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06740"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05736"
FT                   /db_xref="GOA:C7NLS0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS0"
FT                   /protein_id="ACV05736.1"
FT                   /translation="MGVCDIPVISAVCDTAGEAAASLVAAPFDWLAQAMGAAAGWLFEA
FT                   VWSVFDTTTLVDVTRDEYVAVYNLLFGIAVFVMLIFFCLQLLTGLVRRDPTALSRAALG
FT                   LAKSVLGSFVVITLTALLLEIVDQLCVGIIQAAGETTESMGDKITLLAAGLVGINIAAP
FT                   GVGAIITIFLAGLAIAAATIVWLSLLVRKALLLVAIVFAPLAFSGASWDASRGWIGKWA
FT                   MFVIALICSKLVLVVMFLVAITQVSAPIDADLSSISDPLAGIVLMAMAAFAPYLTYKFI
FT                   SFIGFDMYHAIGSEQDAKQALNRPVPTPTTPAGDGPKKVLGGGNSSGGDESGGGSGGSA
FT                   GGGGKTPPQAKTSTPQASGSGAGAAGGTSTAGGTAGAGAGAGGGTGAGAGAGAGAAAAG
FT                   PAAAAVIAGKVAKDAATAGPKAGTALGNQAETTADNAGQTAATPPPAASPTSSPPATKA
FT                   PPPTEPKTPTAGPGPAQPEPPAPKPTPPPAPKPTGKD"
FT   gene            666844..668307
FT                   /locus_tag="Ksed_06750"
FT   CDS_pept        666844..668307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06750"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05737"
FT                   /db_xref="GOA:C7NLS1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS1"
FT                   /protein_id="ACV05737.1"
FT                   /translation="MTSKQKESATELVPVKFSRLTRRGILLGLSLAQLITLATGVLAVV
FT                   GALYAGGGILLAYTAPVWVLAAALTWIPVAGRPAVEWLPVACWWAWRSTAGQLLYRRRI
FT                   VAPRPVGTLALPGDMARLREYTDPDTGAGMIHDPHAATLTVVCKVTHPAFVLLDPGEQE
FT                   RRITSWGRVLATVCRSGRIATLQVLERTLPDSGTGLAEWWASHGTADDTWAATTYAELI
FT                   ERAGPAGERHATTLSLSLDMKTAARQIRTAGGGIRGAAAVLRQEMSTLVAALRSADLKP
FT                   SGWLSPGQIAVILRSAYDPAIAATLERHGELGQHLATAGPVAVNESWSRLRTDSAHHAV
FT                   LWISEWPRSMVYPGFLSPVLLSTGIQRSFSLLCTPMRSDQAARDIRKKKVEHISDQAQR
FT                   AKIGQIEDATQTAEYHDVLQQEADLTAGHGVLRFTGLISISAPTVEELDAGVAAIEQAA
FT                   IQASCETRLLVGQQAAAFTAAALPLCRRI"
FT   gene            668408..669274
FT                   /locus_tag="Ksed_06760"
FT   CDS_pept        668408..669274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06760"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05738"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS2"
FT                   /protein_id="ACV05738.1"
FT                   /translation="MPTYYDSLQDAAEASEALRGLAHASRVFDNPADTYSVLGDLLSGV
FT                   RSLRQVLDQLGSAHLVHRGRAHDDDGDHAIGAAEALAAADDLHHAGTLLDGVEERGNAA
FT                   MTHSGRIAWHAPTQELDREAVSPDEPRRWISVVFLQGAEADEVLDLIDRDGPDAAIEHL
FT                   RNWDCGEETTDAALENGYVYDEPPTGQLDRVITDGDYTLTYNPFMGHVSLLRAHPAAMS
FT                   DPDLDETDVVLAREAISGVGPLDASTPRTAVTPASAQTQQASAGLDRDWFAGPARSSGS
FT                   IGRGLSL"
FT   gene            669271..670758
FT                   /locus_tag="Ksed_06770"
FT   CDS_pept        669271..670758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05739"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS3"
FT                   /protein_id="ACV05739.1"
FT                   /translation="MSARESERLHASVLVAPAAERRRLRTQRRQAAAALRAEQHRTEQA
FT                   AARAKADAERAERRATTYLPAAGESGAAALRTPGRFRLPRHQDTSATLAGAYPFVAEGG
FT                   LGADGVFVGQDLYSGGSFVYDPWVLYARGIITAPNVVLAGIVGSGKSSLAKSLYTRSLP
FT                   FGRRVYVPGDPKGEHTPVANAVGGKAIVLGHGLNTRLNPLDEGHRPTGLSDQEWAITVA
FT                   ARRRDLIGALAETVLARGLTPLEHTAIDLALTAVVAENTVPILPMVVDRILTPDETADG
FT                   RLAEDGRLVGHALRRLVAGDLAGLFDGPSTVQFDPSLPMISLDLSRVTENSTLISVLMT
FT                   CSSAWMESALLDPNGGQRWVIYDEAWRLMSHPALLKRMDAHWRLARHYGIANMLIFHKL
FT                   SDLDNVGDAGSAMRSLANSLLANAETRIVYRQESDQLGPTAQALGLTGTEQKLLPSLGV
FT                   GQGLWRIKDRAFVTQHQLHPAELALFDTSSRLTSGVK"
FT   gene            670812..671336
FT                   /locus_tag="Ksed_06780"
FT   CDS_pept        670812..671336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06780"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05740"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS4"
FT                   /protein_id="ACV05740.1"
FT                   /translation="MLPHAVITVTETGALDVTIDGNNVPPPEGETWTRATFGPLLDVLT
FT                   QDRTITVRIEVHESDGTVFTDVIRARRRTRPEPSETEAETEREAEDERATPVRSRRKRR
FT                   PDLVEVTGEGFVPGEDVAAAIIVSHTDATNTGHARTLLDWKRLRSLLPDGGGEVMLFGR
FT                   ISGTTHVRRLP"
FT   gene            671333..673117
FT                   /locus_tag="Ksed_06790"
FT   CDS_pept        671333..673117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05741"
FT                   /db_xref="GOA:C7NLS5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS5"
FT                   /protein_id="ACV05741.1"
FT                   /translation="MSTPPGRQTGSFGDELTNAALIALVGMFGIALILRASGSVAAFLT
FT                   GTPHPAAGPAAGLGVLFNPSDPAGALDADGLNPTVYWIITAAMLAGLVTAGAWAWMRLR
FT                   HHSRRVETDPRRLAGTATAHEVTQSASAKALLRRAGTLRPSLDKPAPGDVGYRIGASKG
FT                   RDVWASVEDSILLIGPPRSGKGLHIVIPAILDAPGAVVTTSTRPDNLTATLRARQRGGR
FT                   PVAVFDPQHLAGGIPAGMRWSPIRGCEDPLTAMIRATGLSAATGLSAGGVESGGFWEGK
FT                   TRTALQSLLHAAALDHRPPAQLFRWTLDPSAAAEAVAILTNNTHAATGWADSLGAMIDA
FT                   DPKTRDSIWQGVALALGALADPRVLDAVSPGSGEGFDPETFIRDCGTLYLLATGAGAGA
FT                   SAALVAAFVEDLIETARRIAARSPGARLDPPLLLALDEIGNLAPLPSLPTLMAEGGGTG
FT                   ITTLPVLQSLAQARDKWNDNAAGAIWDASIVKIILGGASNSRDLQDLSTLIGERDEYTD
FT                   SVTLGDHGTRSNQRSVRRVPILPPDRIRTLPFGTGVTLLRAAPPIVTDLRAWPSRPDAA
FT                   QLKTDRAEVEALLRGPGS"
FT   gene            673207..673650
FT                   /locus_tag="Ksed_06800"
FT   CDS_pept        673207..673650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06800"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="PFAM: Single-strand binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06800"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05742"
FT                   /db_xref="GOA:C7NLS6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS6"
FT                   /protein_id="ACV05742.1"
FT                   /translation="MAIRTQESFSGFIASDPQLSQTSKGDPRFYARVGKEHFRREDDGS
FT                   FTQTETTYHHLVMFGRSAEHAHARFVKGDNFIAEGYTREVNYERGGQAVESEEFVAKKI
FT                   GHDAARTRYEVDRTPRRAAEREAPGFEPPARPTQAPQSTAIGL"
FT   gene            673670..674293
FT                   /locus_tag="Ksed_06810"
FT   CDS_pept        673670..674293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05743"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS7"
FT                   /protein_id="ACV05743.1"
FT                   /translation="MTDLTPEPSPIGGEGPGLDEPDVFHGPPHVSDADVPETPHPVNWN
FT                   LLSAHDLEQEWLALNRWVDWLRHTYGLPASVVPPFWHHHPELLWELSALHLHWLGAYDP
FT                   EQNASAAIGWHRDFADARARLRDWVAASGTRLDRDRPTRQTTWPGEDPAPPVEDVAIAD
FT                   RDAEFVQFVQAQVRKRQEAEDEFYASLDDDLDIDVDPVTGEVRD"
FT   gene            674293..674535
FT                   /locus_tag="Ksed_06820"
FT   CDS_pept        674293..674535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06820"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05744"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS8"
FT                   /protein_id="ACV05744.1"
FT                   /translation="MGGYVKKTYRRRYEDRSFSVRAVHRDQADLHKLAEVLIRLTLQET
FT                   GRSRADRSAAKPPETYRDPTASIDAPASVAGPLVE"
FT   gene            674719..676365
FT                   /pseudo
FT                   /locus_tag="Ksed_06830"
FT   gene            complement(676373..676448)
FT                   /locus_tag="Ksed_06840"
FT   tRNA            complement(676373..676448)
FT                   /locus_tag="Ksed_06840"
FT                   /product="tRNA-Lys"
FT   gene            676559..678700
FT                   /locus_tag="Ksed_06850"
FT   CDS_pept        676559..678700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06850"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="PFAM: DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; TIGRFAM: ATP-dependent DNA helicase,
FT                   RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06850"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05745"
FT                   /db_xref="GOA:C7NLS9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLS9"
FT                   /protein_id="ACV05745.1"
FT                   /translation="MTTPDAVNLPDRALGALRRLVGREDVEFRGGQLEAVESLVSDRAR
FT                   VLVVQRTGWGKSAVYFVATALRREQGAGPTIIVSPLLALMRDQIAAAGRAGVRAVTMNS
FT                   ANATEWDEVRAALDADEVDVLLVSPERLNNPRFRAEQLPELSRRCGLLVVDEAHCISDW
FT                   GHDFRPDYRRIRTLLSELPQDTPVLATTATANERVVHDVVEQLSAGPSGRRHEVSTIRG
FT                   GLARDSLRLGVLLGPEGRPLTPEQRLGWMTAHLSELPGSGIVYCLTVSAAEDVAAALSA
FT                   AGHRVAAYTGRTDTDERERLETALRDNQVKALVATSALGMGFDKPDLGFVVHLGAPSSP
FT                   VAYYQQVGRAGRATERADVVLLPGSEDRDIWRYFATVSMPRQEQADAVLTALAGAGKPL
FT                   STPALETLVDVRRTRLELLLKVLDVDGAVTKVPGGWTATGQQWTYDAERYARVAEARER
FT                   EAALMEEYQAGAGCRMQFLQRTLDDPTAAVCGRCDTCAGTWFPTGVPQEAIDGARSQLG
FT                   GTGVVIEPRAQWPSGMNRLGVEASGRIPAEEQLRPGRALARLSDLGWGQRLRQVLAADP
FT                   PAEDDLVRAVVLLLADWDWAERPVGVVAMPSRRRPQLVGSLAERLSTIGRLPLLGTLDL
FT                   VDGGPVGEPGGNSAFRLAGVWDRLAVGPELGGRLQGLSGPVLLVDDLVDSRWSLTVAGR
FT                   ALRRAGAPGVLPLALAVEG"
FT   gene            678803..679774
FT                   /locus_tag="Ksed_06860"
FT   CDS_pept        678803..679774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06860"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06860"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05746"
FT                   /db_xref="GOA:C7NLT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT0"
FT                   /protein_id="ACV05746.1"
FT                   /translation="MDVWSTQGLTKRFGTFTAVSDLTLSVGEGVTGVVGHNGAGKSTLI
FT                   RMLLGLEPPTSGTATIFGIDATQNPLEARARVGFMPEYDCMPPDVSAAQSIMHFGRISG
FT                   LPRDIARERASDVLRHVGLDEARHRPVGTYSTGMKQRAKLAQALVHDPDLIMLDEPTNG
FT                   LDPSGRDEMLGLIQRIGHEFGISVLVTSHLLGELERICDHVVVLDGGRLVTSSSISDLT
FT                   ADTGALEVEVIGTDERSPAPQLIAALHCRGIEAGRSGGMVIIPQASDEARAAVVELCAD
FT                   NGWGLSRMTGSRHQLSELFLGEGDSPEVSQGSGATRDGQEAA"
FT   gene            679771..680700
FT                   /locus_tag="Ksed_06870"
FT   CDS_pept        679771..680700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06870"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05747"
FT                   /db_xref="GOA:C7NLT1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT1"
FT                   /protein_id="ACV05747.1"
FT                   /translation="MSTTQQPDEAATVATATGRQQSVIHDLGYRGYDGPRAGRGGVLGY
FT                   LVRQGYASAYGVGRTWKGKVMPWVCVALMAAPMLIAAAIMVLIPFEGAEPVFHPARVPY
FT                   AFYTLVALFASVAAPVVFSADLRSRSIVHYLSRPLSRRDYVLARLASLVLALFTLQAVG
FT                   ILIGTLGWWLAGGPLGTIWGAAGVGALGALLVSLAVGVISGLIAALTPKRGVATAVILG
FT                   VLLVFSSVVVAVMEAVHATGSQSGLLARWTPALSPNTAVERVVEWATGNEELTAALDDA
FT                   TAVGFLVLLIIGCVLGLVALMRRYRRVN"
FT   gene            680700..681623
FT                   /locus_tag="Ksed_06880"
FT   CDS_pept        680700..681623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06880"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06880"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05748"
FT                   /db_xref="GOA:C7NLT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT2"
FT                   /protein_id="ACV05748.1"
FT                   /translation="MATVQIDGASRWFGNVVAVNDVSFDLRPGVTGLLGPNGAGKSTLM
FT                   AMIAGFETTSAGTISLDGQPVRRNPAIYRRLGMMPETESMYDELTGREFVTAMARLHKL
FT                   PDARSATRKALSVVDLEDAADRRIGKYSKGMRQRIKMASALVHEPEVLLLDEPFNGMDP
FT                   GQRVRLMGTLHEYAERGATVLVSSHILEEVQQLAGTIEVMLAGRHLASGDFRSLRRLMT
FT                   NRPHQYEIVSSDDRALASALIAEEGAASVTLASGLQDHVQVQVTDFEAFSALLPQVARR
FT                   HDIALHSVRPTDESLESVFGYLVEGR"
FT   gene            681623..682339
FT                   /locus_tag="Ksed_06890"
FT   CDS_pept        681623..682339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06890"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05749"
FT                   /db_xref="GOA:C7NLT3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT3"
FT                   /protein_id="ACV05749.1"
FT                   /translation="MGMTIATMTWRSLSRGWRPLLLVALPLGGLALALLLRVASGGVDE
FT                   VMADQIVRDLATGVIVPLAALLVAVNGIGNEVDDSSVLHILATPTSRASILLQKMLVIC
FT                   GVSVLLGALTCGGMALIMGSRETTSWLVAGAVSGLAYGAVFTALSTWVKHAVIIGALYL
FT                   VLWEGMLIGLAPRARFLSLHHGALAVAEKFRDTRAMVDLTDLSTIGGVMVLGIALVAGF
FT                   LLAWWALSRMRLAKSS"
FT   gene            682353..683804
FT                   /locus_tag="Ksed_06900"
FT   CDS_pept        682353..683804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06900"
FT                   /product="purine-cytosine permease-like transporter"
FT                   /note="PFAM: Permease for cytosine/purines, uracil,
FT                   thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06900"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05750"
FT                   /db_xref="GOA:C7NLT4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT4"
FT                   /protein_id="ACV05750.1"
FT                   /translation="MSTPLPPTGSSLVETTGFEVVAESERTGKPSDLFWPWFAANISVF
FT                   GLSYGTWILDFGISFRQALLVGVLGVVVSFLLCGVVALAGKRGSAPTMALSRAPFGVQG
FT                   NKLPGVVSWLLSIGWETVLAILATLATATVAERLGWGGGTATKIAAALVVSALIIAAAV
FT                   LGYRVIMRLQSIFTWLTGAITLLYIVLTIDEVDFTAVQAIGDGSMQAMIGGFIMTMTGF
FT                   GLGWINIASDWSRYLPRSTPGGQVVFWNTLGGALAPAVLVVFGLLLAGSDENLRTAIAA
FT                   DPIGALAAALPTWFLVPFLIAAVLSLVSGAVLGIYSSGLTLLSLGVKLPRPVAAGIDGV
FT                   ILTAGTLYVVFVAQDFFGPFQGFLITLGVPIAAWAGILIADILVRRKDYDEAALFDARG
FT                   RYGAVAWGPVLLMLAASVIGWGLVTNSYAEWLAWQGYLLEPLGLGGKEGAWAWSNLGVL
FT                   VALALGFLGYLLLGTPRVRRQEAGQ"
FT   gene            683801..684448
FT                   /locus_tag="Ksed_06910"
FT   CDS_pept        683801..684448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06910"
FT                   /product="nicotinamidase-like amidase"
FT                   /note="PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06910"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05751"
FT                   /db_xref="GOA:C7NLT5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT5"
FT                   /protein_id="ACV05751.1"
FT                   /translation="MTAGTEGSGEDLATESTEDLTEELEEDLAAMGVAPEPWLVVIDPQ
FT                   TLFADSAASPWGSPMFADVVATIRRLVDAHPGRVVITRFVADEEPTGSWVPYYREWPFA
FT                   QVPDADPLYAVVPELADVDALVVTEPTFGKWRDMLQAVVGETPHLRLAGVATDCCVIAT
FT                   ALPAADDGAFVEVVTDACAGSTPENHALALQQMALFAPQVTQVTAAQVLDPS"
FT   gene            684525..687200
FT                   /locus_tag="Ksed_06920"
FT   CDS_pept        684525..687200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06920"
FT                   /product="superfamily II RNA helicase"
FT                   /note="PFAM: DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06920"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05752"
FT                   /db_xref="GOA:C7NLT6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT6"
FT                   /protein_id="ACV05752.1"
FT                   /translation="MTPDAAPDAVTPDDLPGPPPVRPLIDRLPASTSADGADLHEAFVQ
FT                   WATDSGTTLYPHQDEAAFELAAGSNVILATPTGSGKSLVGVAGHFVALSQDKVSFYTAP
FT                   LKALVSEKFFALVDVFGAENVGMMTGDAAVNPDAPIIACTAEILANLALREGAAADVGL
FT                   VVMDEFHFYSEPDRGWAWQVPLLELPQAQFLLMSATLGDVSAFQEDLTRRTGRPTAVVA
FT                   TAERPVPLSFEWRMTPLEETLEELLTTHQAPVYVVHFSQKQAVEGALALSGTVKLSREQ
FT                   KDRLAERLVDVRFSSGFGKTLKTLLRQGIGVHHAGMLPRYRRLVEQLAQAGLLQVIAGT
FT                   DTLGVGINVPIRTVLFTGLAKFDGTRMRVLKAREFHQIAGRAGRAGFDTSGHVVAQAPP
FT                   HVIENAKAEEKAGDDPKKRRKLVRKQPPEGFISWTEETFTKLIGADPEPLASRMRVTHG
FT                   TLLNVIQRPGEPGEAWRTMRRLVGDNHETPAARRKLARRSIELYRGLRDAGVVSQVRDE
FT                   HTGATSIRLAEGVADDFALNQPLAPFAVAAMEVLDPEAPSHALDVVSVIESVLDDPRPV
FT                   LVQQQFKARGEAVAEMKADGIEYTERMNRLEEITWPKPLEELLDGTLEIYRQSHPWVAF
FT                   EELSPKSVVRDMFEKGASFGEYVRFYDLARAEGALLRYLSDAWRTLRHTVPEHARTEAV
FT                   EEIIEWLGEVIRQTDSSLVDEWTLLAGGVVPDREAQEVRPAHGVQGVTANEKAFRVMVR
FT                   TAMFRRVELVAYDRYGQLGELEQAVAQLSEPPARVVMDAAAWDEALAAYYDEYEDVGIG
FT                   PTARAAELFQVDTDPDDATLDALPEGVLHGERAWLVQQVIEDARGDHDWRITAVVDLDA
FT                   SDELGEAVVRAVSMGPAGQA"
FT   gene            687197..687832
FT                   /locus_tag="Ksed_06930"
FT   CDS_pept        687197..687832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06930"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05753"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT7"
FT                   /protein_id="ACV05753.1"
FT                   /translation="MSDRPRRPALRAPWQLDQQVGGSDPADAVELSHTTAQVLVHRGRA
FT                   ADDPEVTRRLVELVDDLGLDALALLWADRPARSLPGVLWRLYALRQWVASRPQGAAREY
FT                   RDGVLAAEVSHAVAGVVDPPGPQEVHDLVDAVLHGVYAGDLAVALERAAAFCRVVSAGR
FT                   GAQDAPRSEPVHPGGVARDEGARRGLALLDTAADLSAGAVLWRAGQLV"
FT   gene            688202..689512
FT                   /locus_tag="Ksed_06940"
FT   CDS_pept        688202..689512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06940"
FT                   /product="phosphate-binding protein"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: phosphate ABC transporter,
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06940"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05754"
FT                   /db_xref="GOA:C7NLT8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT8"
FT                   /protein_id="ACV05754.1"
FT                   /translation="MKLNRFGSVVALAAASSLTLAACGGDSEGEESSETTTSESGDESA
FT                   PAESESGDESAPAESESGEESSPAESESGEESSPAESESGDESSPAESESGDDDAAAGS
FT                   YPAYSKTEGLSGGLKGVGSSAQEAAVKAWVAGYNEQGPGVTVNYSPDGSGAGQEQFLGG
FT                   ATPWAGSDVALDDEQMEKATEVCGPDGAMNLPAYISPIAIPFNLPGVDELNLKPETIAK
FT                   IFNGDIEKWNDEAIAADNEGVDLPDEEITVVFRSDESGTTANFQDYLKEAAGDAWPHEP
FT                   SKEFPGDGEGAAKTSGVVNVVSSTEYTIGYADASAIGGLNSVKVGVGEEFVGYSPEAAA
FT                   KVVDGSEVMEGRPEGDLAMDLNREVEGSYPVVLVTYEIVCTEYENKEDADRVKDFMSYV
FT                   ISEEAQKRAADDAGSAPISPETAEQIATSLEKISAKG"
FT   gene            689594..690574
FT                   /locus_tag="Ksed_06950"
FT   CDS_pept        689594..690574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06950"
FT                   /product="phosphate ABC transporter membrane protein"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component; TIGRFAM: phosphate ABC
FT                   transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06950"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05755"
FT                   /db_xref="GOA:C7NLT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLT9"
FT                   /protein_id="ACV05755.1"
FT                   /translation="MAATNGPSADGATSLSTDPGPPAPATESNPTRGASTGRLGDKIFS
FT                   GLSIGSGALIAVTLALVAIFLLMEAWPALKQASEIGDEGFWMLAANLLGGTLLASAIAM
FT                   VIAVPVAVGIALFISHYAPPRLSKSIAFVIDLLAAIPSVIFGLWGYLTFAPFLVPLFEW
FT                   LEDNLGFIPLFEDASRTGRVLLTASIVLAIMILPIITSVARDVFQQVPRGHEEASLALG
FT                   ATKWEMIKQAVLPFGWPGVVGGAMLGLGRALGETMAVAMILAPKDEFQWNIIGSGNFPI
FT                   PAYIALNFPDATGLKVSTLIALGLVLFVLTLAVNLVARAIVERRS"
FT   gene            690576..691727
FT                   /locus_tag="Ksed_06960"
FT   CDS_pept        690576..691727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06960"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component; TIGRFAM: phosphate ABC
FT                   transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06960"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05756"
FT                   /db_xref="GOA:C7NLU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLU0"
FT                   /protein_id="ACV05756.1"
FT                   /translation="MTLSPVQADHGPTHEADRGPDMPELQRNTIHPASKTLWMGLLAAS
FT                   AVVGGLITWLIGWNIALFVVVTIVVFMLAVYIGYRVTAGHRQGLDQVVRALVYLAFALA
FT                   VIPLIWLLWTVFSNAIPPLLGNLQVFTQDMYGISGDVDEARVTEGAEIVGGMKHALIGT
FT                   LMITVIASIISIPVGLMAAIYLVEYGTNGWFSRTLRFLVDVMTGIPSIVAGLFAYALFS
FT                   MIFGPGTKFGFAGAIALSVLMIPIVVRNSEEMLRVVSRDLRESALALGVPKWRVITKIV
FT                   LPTAVAGLMSSVFLGVARVIGETAPLLVAAGYNAATNWNPFEGPMNSLAFYAYQLFQYP
FT                   LNPGYREVSDERSWIAVFVLVMLVLTLNLIARLVAAALAPKKS"
FT   gene            691746..692525
FT                   /locus_tag="Ksed_06970"
FT   CDS_pept        691746..692525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06970"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="PFAM: ABC transporter; TIGRFAM: phosphate ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06970"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05757"
FT                   /db_xref="GOA:C7NLU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLU1"
FT                   /protein_id="ACV05757.1"
FT                   /translation="MSKRIEIKDLNVYYTDFLAVEGVDMVIEPRTVTAFIGSSGCGKST
FT                   VLRTLNRMHEVIPGAHVRGNVLMDGDPLYGKNIDPVEVRRQVGMVFQKPNPFPTMSIRE
FT                   NVLAGVTLNARKLGKRDSDDLVEASLRGANLWNEVKDRLDKPGASLSGGQQQRLCIARA
FT                   VAVQPDVLLMDEPCSALDPISTLAVEDLIHELKEKYTVVIVTHNMQQATRVSDKTAFFN
FT                   IEGTGKPGHLIEYGETKQIFENPTHQETEDYVSGRFG"
FT   gene            693110..694426
FT                   /locus_tag="Ksed_06980"
FT   CDS_pept        693110..694426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06980"
FT                   /product="transposase family protein"
FT                   /note="PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06980"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05758"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C7NLU2"
FT                   /protein_id="ACV05758.1"
FT                   /translation="MRELTFDAPDLTTFARLDELGLVAVGQRVEPDRAVLECRVVAGDD
FT                   DAFCRHCGAEGAARGTVTRQLAHEPFGWRPTTLLIRVRRFGCQACRRVWRQDTTAAADR
FT                   RAKLSRAAVRWALVALVTQHLTVARLAEALGVAWDTANDAVLAEGRRVLIDDPTRFDGV
FT                   TVVGVDEHVWRHTRSGEKYVTVVIDLTPIRDGTGPARLLDMVQGRSKSTFKTWLAARTQ
FT                   AWRDRVEVVAMDGFTGFKTAAAEELPDAVAVMDPFHVVRLAGDALDRCRRRVQQDLYGH
FT                   RGRAGDPLYCARRTLHTGANLLTDKQTRRIESLFADAEHVEVEATWGIYQRMIAAYRHP
FT                   DRREGRALMTAVIDSVTRGVPTALSELVTLGRTLTKRAEDVLAFFDLPGTSNGPTEAIN
FT                   GRLEHLRGSALGFRNLTHYVARSLLEAGGFRPRLHPQIG"
FT   gene            694794..695459
FT                   /locus_tag="Ksed_06990"
FT   CDS_pept        694794..695459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_06990"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05759"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET5"
FT                   /protein_id="ACV05759.1"
FT                   /translation="MTVMVGLIAAGCGDSSDGRAQGADTAPSSVESSSPAPSSPSPSPS
FT                   PSTARRHIEASGPSYRDLEDASTRSTSAGAIRATVLRQIRTTDRLDPVQEDSPALEYDL
FT                   WEVRVDEAPGADATPRSLVVAQVANTANQSHSGPGPRLQEGARGVLVLGTAMSDEWVHP
FT                   EFGWVYYPVAFYGEEGKGQLRDRATERLAAASPQGRTVDEVLREANQGVTFHASTMTD"
FT   gene            complement(695542..696258)
FT                   /locus_tag="Ksed_07000"
FT   CDS_pept        complement(695542..696258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_07000"
FT                   /product="phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription"
FT                   /note="PFAM: PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_07000"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05760"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET6"
FT                   /protein_id="ACV05760.1"
FT                   /translation="MVQKQTIIGRISTLARANINAILDRAEDPEKMLDQMVRDYTNAIA
FT                   DAEEAVAQTIASLRMAEQDLEQDQQVAQDWGRKAAAASSEADRLRAAGDTAEADKFDNL
FT                   AKAALEKQIGFENDASTAEPMITQQRQTVETLKQGLVEMRSKLDELKSRRDSLVARART
FT                   ADAQRQVSDAMGSISILDPSSELGRFEEKVRREEAMVQGRQEAQAATLEGQFEQLEDST
FT                   KSAEVEARLAQLKNKG"
FT   gene            complement(696409..698559)
FT                   /locus_tag="Ksed_07010"
FT   CDS_pept        complement(696409..698559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ksed_07010"
FT                   /product="protein of unknown function (DUF477)"
FT                   /note="PFAM: Domain of unknown function (DUF477)"
FT                   /db_xref="EnsemblGenomes-Gn:Ksed_07010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV05761"
FT                   /db_xref="GOA:C7NET7"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C7NET7"
FT                   /protein_id="