(data stored in ACNUC7421 zone)

EMBL: CP001688

ID   CP001688; SV 1; circular; genomic DNA; STD; PRO; 3110487 BP.
XX
AC   CP001688; ABTY01000000-ABTY01000002;
XX
PR   Project:PRJNA27945;
XX
DT   05-SEP-2009 (Rel. 102, Created)
DT   02-JAN-2014 (Rel. 119, Last updated, Version 5)
XX
DE   Halomicrobium mukohataei DSM 12286, complete genome.
XX
KW   .
XX
OS   Halomicrobium mukohataei DSM 12286
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Halobacteriales;
OC   Haloarculaceae; Halomicrobium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3110487
RX   DOI; 10.4056/sigs.42644.
RX   PUBMED; 21304667.
RA   Tindall B.J., Schneider S., Lapidus A., Copeland A., Glavina Del Rio T.,
RA   Nolan M., Lucas S., Chen F., Tice H., Cheng J.F., Saunders E., Bruce D.,
RA   Goodwin L., Pitluck S., Mikhailova N., Pati A., Ivanova N., Mavrommatis K.,
RA   Chen A., Palaniappan K., Chain P., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Brettin T., Han C., Rohde M., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Klenk H.P., Kyrpides N.C.,
RA   Detter J.C.;
RT   "Complete genome sequence of Halomicrobium mukohataei type strain (arg-2)";
RL   Stand Genomic Sci 1(3):270-277(2009).
XX
RN   [2]
RP   1-3110487
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindal B., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Halomicrobium mukohataei DSM 12286";
RL   Unpublished.
XX
RN   [3]
RP   1-3110487
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindal B., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; afcc8aed4e47df5f300180187fe654b1.
DR   BioSample; SAMN00002610.
DR   CABRI; DSM 12286.
DR   EnsemblGenomes-Gn; EBG00001251160.
DR   EnsemblGenomes-Gn; EBG00001251162.
DR   EnsemblGenomes-Gn; EBG00001251163.
DR   EnsemblGenomes-Gn; EBG00001251164.
DR   EnsemblGenomes-Gn; EBG00001251165.
DR   EnsemblGenomes-Gn; EBG00001251166.
DR   EnsemblGenomes-Gn; EBG00001251167.
DR   EnsemblGenomes-Gn; EBG00001251168.
DR   EnsemblGenomes-Gn; EBG00001251169.
DR   EnsemblGenomes-Gn; EBG00001251170.
DR   EnsemblGenomes-Gn; EBG00001251171.
DR   EnsemblGenomes-Gn; EBG00001251172.
DR   EnsemblGenomes-Gn; EBG00001251173.
DR   EnsemblGenomes-Gn; EBG00001251174.
DR   EnsemblGenomes-Gn; EBG00001251175.
DR   EnsemblGenomes-Gn; EBG00001251176.
DR   EnsemblGenomes-Gn; EBG00001251177.
DR   EnsemblGenomes-Gn; EBG00001251178.
DR   EnsemblGenomes-Gn; EBG00001251179.
DR   EnsemblGenomes-Gn; EBG00001251180.
DR   EnsemblGenomes-Gn; EBG00001251181.
DR   EnsemblGenomes-Gn; EBG00001251182.
DR   EnsemblGenomes-Gn; EBG00001251183.
DR   EnsemblGenomes-Gn; EBG00001251184.
DR   EnsemblGenomes-Gn; EBG00001251185.
DR   EnsemblGenomes-Gn; EBG00001251186.
DR   EnsemblGenomes-Gn; EBG00001251187.
DR   EnsemblGenomes-Gn; EBG00001251188.
DR   EnsemblGenomes-Gn; EBG00001251189.
DR   EnsemblGenomes-Gn; EBG00001251190.
DR   EnsemblGenomes-Gn; EBG00001251191.
DR   EnsemblGenomes-Gn; EBG00001251192.
DR   EnsemblGenomes-Gn; EBG00001251193.
DR   EnsemblGenomes-Gn; EBG00001251194.
DR   EnsemblGenomes-Gn; EBG00001251195.
DR   EnsemblGenomes-Gn; EBG00001251196.
DR   EnsemblGenomes-Gn; EBG00001251197.
DR   EnsemblGenomes-Gn; EBG00001251198.
DR   EnsemblGenomes-Gn; EBG00001251199.
DR   EnsemblGenomes-Gn; EBG00001251200.
DR   EnsemblGenomes-Gn; EBG00001251201.
DR   EnsemblGenomes-Gn; EBG00001251202.
DR   EnsemblGenomes-Gn; EBG00001251203.
DR   EnsemblGenomes-Gn; EBG00001251204.
DR   EnsemblGenomes-Gn; EBG00001251205.
DR   EnsemblGenomes-Gn; EBG00001251206.
DR   EnsemblGenomes-Gn; EBG00001251207.
DR   EnsemblGenomes-Gn; EBG00001251208.
DR   EnsemblGenomes-Gn; EBG00001251209.
DR   EnsemblGenomes-Gn; EBG00001251210.
DR   EnsemblGenomes-Gn; EBG00001251211.
DR   EnsemblGenomes-Gn; EBG00001251212.
DR   EnsemblGenomes-Gn; EBG00001251213.
DR   EnsemblGenomes-Gn; EBG00001251214.
DR   EnsemblGenomes-Gn; EBG00001251215.
DR   EnsemblGenomes-Gn; EBG00001251216.
DR   EnsemblGenomes-Gn; EBG00001251217.
DR   EnsemblGenomes-Gn; EBG00001251218.
DR   EnsemblGenomes-Gn; EBG00001251219.
DR   EnsemblGenomes-Gn; EBG00001251220.
DR   EnsemblGenomes-Gn; EBG00001251221.
DR   EnsemblGenomes-Gn; EBG00001251222.
DR   EnsemblGenomes-Gn; EBG00001251223.
DR   EnsemblGenomes-Gn; EBG00001251224.
DR   EnsemblGenomes-Gn; EBG00001251225.
DR   EnsemblGenomes-Gn; EBG00001251226.
DR   EnsemblGenomes-Gn; EBG00001251227.
DR   EnsemblGenomes-Gn; EBG00001251228.
DR   EnsemblGenomes-Gn; EBG00001251229.
DR   EnsemblGenomes-Gn; EBG00001251230.
DR   EnsemblGenomes-Gn; EBG00001251231.
DR   EnsemblGenomes-Gn; EBG00001251232.
DR   EnsemblGenomes-Gn; EBG00001251233.
DR   EnsemblGenomes-Gn; EBG00001251234.
DR   EnsemblGenomes-Gn; EBG00001251235.
DR   EnsemblGenomes-Gn; EBG00001251236.
DR   EnsemblGenomes-Gn; EBG00001251237.
DR   EnsemblGenomes-Gn; EBG00001251239.
DR   EnsemblGenomes-Gn; EBG00001251240.
DR   EnsemblGenomes-Gn; EBG00001251241.
DR   EnsemblGenomes-Gn; EBG00001251242.
DR   EnsemblGenomes-Gn; EBG00001251243.
DR   EnsemblGenomes-Gn; EBG00001251244.
DR   EnsemblGenomes-Gn; EBG00001251245.
DR   EnsemblGenomes-Gn; EBG00001251246.
DR   EnsemblGenomes-Gn; EBG00001251247.
DR   EnsemblGenomes-Gn; EBG00001251248.
DR   EnsemblGenomes-Gn; EBG00001251249.
DR   EnsemblGenomes-Gn; EBG00001251250.
DR   EnsemblGenomes-Gn; Hmuk_R0001.
DR   EnsemblGenomes-Gn; Hmuk_R0002.
DR   EnsemblGenomes-Gn; Hmuk_R0003.
DR   EnsemblGenomes-Gn; Hmuk_R0004.
DR   EnsemblGenomes-Gn; Hmuk_R0005.
DR   EnsemblGenomes-Gn; Hmuk_R0006.
DR   EnsemblGenomes-Gn; Hmuk_R0007.
DR   EnsemblGenomes-Gn; Hmuk_R0008.
DR   EnsemblGenomes-Gn; Hmuk_R0009.
DR   EnsemblGenomes-Gn; Hmuk_R0010.
DR   EnsemblGenomes-Gn; Hmuk_R0011.
DR   EnsemblGenomes-Gn; Hmuk_R0012.
DR   EnsemblGenomes-Gn; Hmuk_R0013.
DR   EnsemblGenomes-Gn; Hmuk_R0014.
DR   EnsemblGenomes-Gn; Hmuk_R0015.
DR   EnsemblGenomes-Gn; Hmuk_R0016.
DR   EnsemblGenomes-Gn; Hmuk_R0017.
DR   EnsemblGenomes-Gn; Hmuk_R0018.
DR   EnsemblGenomes-Gn; Hmuk_R0019.
DR   EnsemblGenomes-Gn; Hmuk_R0020.
DR   EnsemblGenomes-Gn; Hmuk_R0021.
DR   EnsemblGenomes-Gn; Hmuk_R0022.
DR   EnsemblGenomes-Gn; Hmuk_R0023.
DR   EnsemblGenomes-Gn; Hmuk_R0024.
DR   EnsemblGenomes-Gn; Hmuk_R0025.
DR   EnsemblGenomes-Gn; Hmuk_R0026.
DR   EnsemblGenomes-Gn; Hmuk_R0027.
DR   EnsemblGenomes-Gn; Hmuk_R0028.
DR   EnsemblGenomes-Gn; Hmuk_R0029.
DR   EnsemblGenomes-Gn; Hmuk_R0030.
DR   EnsemblGenomes-Gn; Hmuk_R0031.
DR   EnsemblGenomes-Gn; Hmuk_R0032.
DR   EnsemblGenomes-Gn; Hmuk_R0033.
DR   EnsemblGenomes-Gn; Hmuk_R0034.
DR   EnsemblGenomes-Gn; Hmuk_R0035.
DR   EnsemblGenomes-Gn; Hmuk_R0036.
DR   EnsemblGenomes-Gn; Hmuk_R0037.
DR   EnsemblGenomes-Gn; Hmuk_R0038.
DR   EnsemblGenomes-Gn; Hmuk_R0039.
DR   EnsemblGenomes-Gn; Hmuk_R0040.
DR   EnsemblGenomes-Gn; Hmuk_R0041.
DR   EnsemblGenomes-Gn; Hmuk_R0042.
DR   EnsemblGenomes-Gn; Hmuk_R0043.
DR   EnsemblGenomes-Gn; Hmuk_R0044.
DR   EnsemblGenomes-Gn; Hmuk_R0045.
DR   EnsemblGenomes-Gn; Hmuk_R0046.
DR   EnsemblGenomes-Gn; Hmuk_R0047.
DR   EnsemblGenomes-Gn; Hmuk_R0048.
DR   EnsemblGenomes-Gn; Hmuk_R0049.
DR   EnsemblGenomes-Gn; Hmuk_R0050.
DR   EnsemblGenomes-Gn; Hmuk_R0051.
DR   EnsemblGenomes-Gn; Hmuk_R0052.
DR   EnsemblGenomes-Gn; Hmuk_R0053.
DR   EnsemblGenomes-Gn; Hmuk_R0054.
DR   EnsemblGenomes-Gn; Hmuk_R0055.
DR   EnsemblGenomes-Gn; Hmuk_R0056.
DR   EnsemblGenomes-Tr; EBT00001597131.
DR   EnsemblGenomes-Tr; EBT00001597132.
DR   EnsemblGenomes-Tr; EBT00001597133.
DR   EnsemblGenomes-Tr; EBT00001597134.
DR   EnsemblGenomes-Tr; EBT00001597135.
DR   EnsemblGenomes-Tr; EBT00001597136.
DR   EnsemblGenomes-Tr; EBT00001597137.
DR   EnsemblGenomes-Tr; EBT00001597138.
DR   EnsemblGenomes-Tr; EBT00001597139.
DR   EnsemblGenomes-Tr; EBT00001597140.
DR   EnsemblGenomes-Tr; EBT00001597142.
DR   EnsemblGenomes-Tr; EBT00001597143.
DR   EnsemblGenomes-Tr; EBT00001597144.
DR   EnsemblGenomes-Tr; EBT00001597145.
DR   EnsemblGenomes-Tr; EBT00001597147.
DR   EnsemblGenomes-Tr; EBT00001597148.
DR   EnsemblGenomes-Tr; EBT00001597149.
DR   EnsemblGenomes-Tr; EBT00001597150.
DR   EnsemblGenomes-Tr; EBT00001597151.
DR   EnsemblGenomes-Tr; EBT00001597152.
DR   EnsemblGenomes-Tr; EBT00001597153.
DR   EnsemblGenomes-Tr; EBT00001597155.
DR   EnsemblGenomes-Tr; EBT00001597156.
DR   EnsemblGenomes-Tr; EBT00001597157.
DR   EnsemblGenomes-Tr; EBT00001597158.
DR   EnsemblGenomes-Tr; EBT00001597159.
DR   EnsemblGenomes-Tr; EBT00001597160.
DR   EnsemblGenomes-Tr; EBT00001597161.
DR   EnsemblGenomes-Tr; EBT00001597162.
DR   EnsemblGenomes-Tr; EBT00001597163.
DR   EnsemblGenomes-Tr; EBT00001597164.
DR   EnsemblGenomes-Tr; EBT00001597165.
DR   EnsemblGenomes-Tr; EBT00001597166.
DR   EnsemblGenomes-Tr; EBT00001597167.
DR   EnsemblGenomes-Tr; EBT00001597169.
DR   EnsemblGenomes-Tr; EBT00001597170.
DR   EnsemblGenomes-Tr; EBT00001597171.
DR   EnsemblGenomes-Tr; EBT00001597173.
DR   EnsemblGenomes-Tr; EBT00001597174.
DR   EnsemblGenomes-Tr; EBT00001597175.
DR   EnsemblGenomes-Tr; EBT00001597176.
DR   EnsemblGenomes-Tr; EBT00001597177.
DR   EnsemblGenomes-Tr; EBT00001597179.
DR   EnsemblGenomes-Tr; EBT00001597180.
DR   EnsemblGenomes-Tr; EBT00001597182.
DR   EnsemblGenomes-Tr; EBT00001597183.
DR   EnsemblGenomes-Tr; EBT00001597184.
DR   EnsemblGenomes-Tr; EBT00001597186.
DR   EnsemblGenomes-Tr; EBT00001597187.
DR   EnsemblGenomes-Tr; EBT00001597188.
DR   EnsemblGenomes-Tr; EBT00001597189.
DR   EnsemblGenomes-Tr; EBT00001597192.
DR   EnsemblGenomes-Tr; EBT00001597194.
DR   EnsemblGenomes-Tr; EBT00001597195.
DR   EnsemblGenomes-Tr; EBT00001597196.
DR   EnsemblGenomes-Tr; EBT00001597197.
DR   EnsemblGenomes-Tr; EBT00001597198.
DR   EnsemblGenomes-Tr; EBT00001597199.
DR   EnsemblGenomes-Tr; EBT00001597200.
DR   EnsemblGenomes-Tr; EBT00001597201.
DR   EnsemblGenomes-Tr; EBT00001597203.
DR   EnsemblGenomes-Tr; EBT00001597205.
DR   EnsemblGenomes-Tr; EBT00001597206.
DR   EnsemblGenomes-Tr; EBT00001597207.
DR   EnsemblGenomes-Tr; EBT00001597208.
DR   EnsemblGenomes-Tr; EBT00001597209.
DR   EnsemblGenomes-Tr; EBT00001597210.
DR   EnsemblGenomes-Tr; EBT00001597211.
DR   EnsemblGenomes-Tr; EBT00001597212.
DR   EnsemblGenomes-Tr; EBT00001597213.
DR   EnsemblGenomes-Tr; EBT00001597214.
DR   EnsemblGenomes-Tr; EBT00001597215.
DR   EnsemblGenomes-Tr; EBT00001597216.
DR   EnsemblGenomes-Tr; EBT00001597217.
DR   EnsemblGenomes-Tr; EBT00001597218.
DR   EnsemblGenomes-Tr; EBT00001597220.
DR   EnsemblGenomes-Tr; EBT00001597221.
DR   EnsemblGenomes-Tr; EBT00001597222.
DR   EnsemblGenomes-Tr; EBT00001597223.
DR   EnsemblGenomes-Tr; EBT00001597224.
DR   EnsemblGenomes-Tr; EBT00001597225.
DR   EnsemblGenomes-Tr; EBT00001597227.
DR   EnsemblGenomes-Tr; EBT00001597228.
DR   EnsemblGenomes-Tr; EBT00001597229.
DR   EnsemblGenomes-Tr; EBT00001597230.
DR   EnsemblGenomes-Tr; EBT00001597231.
DR   EnsemblGenomes-Tr; EBT00001597232.
DR   EnsemblGenomes-Tr; EBT00001597233.
DR   EnsemblGenomes-Tr; EBT00001597234.
DR   EnsemblGenomes-Tr; Hmuk_R0001-1.
DR   EnsemblGenomes-Tr; Hmuk_R0002-1.
DR   EnsemblGenomes-Tr; Hmuk_R0003-1.
DR   EnsemblGenomes-Tr; Hmuk_R0004-1.
DR   EnsemblGenomes-Tr; Hmuk_R0005-1.
DR   EnsemblGenomes-Tr; Hmuk_R0006-1.
DR   EnsemblGenomes-Tr; Hmuk_R0007-1.
DR   EnsemblGenomes-Tr; Hmuk_R0008-1.
DR   EnsemblGenomes-Tr; Hmuk_R0009-1.
DR   EnsemblGenomes-Tr; Hmuk_R0010-1.
DR   EnsemblGenomes-Tr; Hmuk_R0011-1.
DR   EnsemblGenomes-Tr; Hmuk_R0012-1.
DR   EnsemblGenomes-Tr; Hmuk_R0013-1.
DR   EnsemblGenomes-Tr; Hmuk_R0014-1.
DR   EnsemblGenomes-Tr; Hmuk_R0015-1.
DR   EnsemblGenomes-Tr; Hmuk_R0016-1.
DR   EnsemblGenomes-Tr; Hmuk_R0017-1.
DR   EnsemblGenomes-Tr; Hmuk_R0018-1.
DR   EnsemblGenomes-Tr; Hmuk_R0019-1.
DR   EnsemblGenomes-Tr; Hmuk_R0020-1.
DR   EnsemblGenomes-Tr; Hmuk_R0021-1.
DR   EnsemblGenomes-Tr; Hmuk_R0022-1.
DR   EnsemblGenomes-Tr; Hmuk_R0023-1.
DR   EnsemblGenomes-Tr; Hmuk_R0024-1.
DR   EnsemblGenomes-Tr; Hmuk_R0025-1.
DR   EnsemblGenomes-Tr; Hmuk_R0026-1.
DR   EnsemblGenomes-Tr; Hmuk_R0027-1.
DR   EnsemblGenomes-Tr; Hmuk_R0028-1.
DR   EnsemblGenomes-Tr; Hmuk_R0029-1.
DR   EnsemblGenomes-Tr; Hmuk_R0030-1.
DR   EnsemblGenomes-Tr; Hmuk_R0031-1.
DR   EnsemblGenomes-Tr; Hmuk_R0032-1.
DR   EnsemblGenomes-Tr; Hmuk_R0033-1.
DR   EnsemblGenomes-Tr; Hmuk_R0034-1.
DR   EnsemblGenomes-Tr; Hmuk_R0035-1.
DR   EnsemblGenomes-Tr; Hmuk_R0036-1.
DR   EnsemblGenomes-Tr; Hmuk_R0037-1.
DR   EnsemblGenomes-Tr; Hmuk_R0038-1.
DR   EnsemblGenomes-Tr; Hmuk_R0039-1.
DR   EnsemblGenomes-Tr; Hmuk_R0040-1.
DR   EnsemblGenomes-Tr; Hmuk_R0041-1.
DR   EnsemblGenomes-Tr; Hmuk_R0042-1.
DR   EnsemblGenomes-Tr; Hmuk_R0043-1.
DR   EnsemblGenomes-Tr; Hmuk_R0044-1.
DR   EnsemblGenomes-Tr; Hmuk_R0045-1.
DR   EnsemblGenomes-Tr; Hmuk_R0046-1.
DR   EnsemblGenomes-Tr; Hmuk_R0047-1.
DR   EnsemblGenomes-Tr; Hmuk_R0048-1.
DR   EnsemblGenomes-Tr; Hmuk_R0049-1.
DR   EnsemblGenomes-Tr; Hmuk_R0050-1.
DR   EnsemblGenomes-Tr; Hmuk_R0051-1.
DR   EnsemblGenomes-Tr; Hmuk_R0052-1.
DR   EnsemblGenomes-Tr; Hmuk_R0053-1.
DR   EnsemblGenomes-Tr; Hmuk_R0054-1.
DR   EnsemblGenomes-Tr; Hmuk_R0055-1.
DR   EnsemblGenomes-Tr; Hmuk_R0056-1.
DR   EuropePMC; PMC2901701; 20400546.
DR   EuropePMC; PMC2905702; 20672053.
DR   EuropePMC; PMC3384331; 22396526.
DR   EuropePMC; PMC3404096; 22848480.
DR   EuropePMC; PMC3783009; 24003073.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01337; CRISPR-DR24.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; CP001688.
DR   SILVA-SSU; CP001688.
DR   StrainInfo; 118636; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083000
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Halomicrobium mukohataei arg-2, DSM 12286
CC   Culture Collection ID :: DSM 12286, ATCC 700874, JCM 9738, NCIMB
CC                            13541
CC   GOLD Stamp ID         :: Gi02248
CC   Greengenes ID         :: 245441
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Salinas grandes from Andes highlands in
CC                            Jujuy Argentina
CC   Collection Date       :: 1991
CC   Isolation Country     :: Argentina
CC   Latitude              :: -22.66332
CC   Longitude             :: -66.23672
CC   Depth                 :: Sea level
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 45C
CC   Salinity              :: Halophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Salt marsh, Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3110487
FT                   /organism="Halomicrobium mukohataei DSM 12286"
FT                   /strain="DSM 12286"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Halomicrobium mukohataei"
FT                   /db_xref="taxon:485914"
FT                   /culture_collection="DSM:12286"
FT   gene            43..2643
FT                   /locus_tag="Hmuk_0001"
FT   CDS_pept        43..2643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0001"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: hma:rrnAC1792 holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46152"
FT                   /db_xref="GOA:C7NVN7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVN7"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACV46152.1"
FT                   /translation="MTIPEHIEIDQPLLDGRSVAAGFRSNDQTWCDGHNQLQGLLRVLY
FT                   PAYRVEYTYAVEGRFPWSSPAHEREYALLDGLWEDNDAGLAMHRHAASETTTIDPRARY
FT                   GDASVPTVALGFHGDEARAASVLPTQLEHERERIDRQIERWHEQADTEASAGNHTKARR
FT                   FREQADAYEGGDPLRDLREIYGLPDGVDADSFEGVESIDRVSLPFWIAELGAQDQSELC
FT                   YVAVRPTDEGWARDTITSVGWLEQFVASHQSVLESDGHWLGAEDVAVESTQDRIDRRRE
FT                   ESDDRPARRQDDEVVDPPETELLDAQRLVDPSPDRSFSDVGGMTALKETLEEKVLKPLE
FT                   HPERYREYGLSTVDGVLLHGPPGCGKTYITGALAGELGQSFVRVSPADLSSKYMGEPAQ
FT                   KVQELFAIARANQPCLVFLDELDAVTVARDNDDSNQSEQGMVNQLLTELEGVRDEDVVV
FT                   VGATNHVDDIDSAIRRSGRFDERIEVPPPDADARREMLRVHLAGRPTTEGLDLSATVSA
FT                   TAGYAASDLERVVDEAARAALADDSPVGTDHLRAAAERTETSIDEWIGRYEFVAEETDG
FT                   TGTVVQPSSVDHLQADAIVSGDVTRTFDDVGGMTDLQTTLEEKVLEPLRQPERFEQYGL
FT                   EPTSGVLLYGPPGCGKTYITEALAGELDHFFVEISPAELVSKWMGEPAQRVADLFEIAR
FT                   ANQPCLVFLDEIDAVAGSRGSSTNQSGQQLVNQLLTELEAISDENVIVVGATNLIEDVD
FT                   GAIRRSGRFDERVEVPPPDADARREILRVHLADRPVADGVDWDRLATATDGYAASDLEL
FT                   VADEAAHRALRAGDSVDTTHLLDAVERTESSLRQWDDGQRYQQSEDTSDLRYFG"
FT   gene            2764..3687
FT                   /locus_tag="Hmuk_0002"
FT   CDS_pept        2764..3687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0002"
FT                   /product="thiazole biosynthesis enzyme"
FT                   /note="TIGRFAM: thiazole biosynthesis enzyme; PFAM:
FT                   thiamine biosynthesis Thi4 protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: hma:rrnAC1782
FT                   ribulose-1,5-biphosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46153"
FT                   /db_xref="GOA:C7NVN8"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVN8"
FT                   /inference="protein motif:TFAM:TIGR00292"
FT                   /protein_id="ACV46153.1"
FT                   /translation="MSEFEQFSDVGEAEVTRAIGQEWTEEFMDFSDSDVIIVGGGPSGL
FT                   TAAKELAERGVQVMVVEKNNYLGGGFWLGGFLMNKVTVRDPAQNVLDELDVDYKQSQDS
FT                   DGLYVANGPEACSGLIKAACDAGAKMQNMTEFTDIVIREDHRVGGIVMNWTPVHALPRE
FT                   ITCVDPIAVEADLVIDATGHDAMAVKKLDERGVLNAPGLEEEASGMDSTGDDTYGAPGH
FT                   DSPGHDSMWVGKSEDAVVEHTGLAHDGLIVTGMATATTYGLPRMGPTFGAMLLSGKRAA
FT                   QAALDELEVDAEPVDVTATNATPADD"
FT   gene            complement(3846..4562)
FT                   /locus_tag="Hmuk_0003"
FT   CDS_pept        complement(3846..4562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0003"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   hma:rrnAC1684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46154"
FT                   /db_xref="GOA:C7NVN9"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVN9"
FT                   /inference="protein motif:PFAM:PF02577"
FT                   /protein_id="ACV46154.1"
FT                   /translation="MKGRVQLREPRRSLLTGAKRPFARPEGLGESLSASTRSARSESRD
FT                   RNCTRVFGVYNSEDAAAYLNTICGPLHSFSYLRTEPSDMEHEATVEGVGIGVGEEGPGA
FT                   PVVLLRAREEVVPIFVSSDQAQSMQLALEGEPFERPLTHDLMVEMVAEFGAAIDRVRID
FT                   DLADGTFYAKIDTEQYLDDRRKEMVFDARPSDGIAIALRVDCPLIVSDEVVDEAGQPPE
FT                   AFEEAPEEDDDSEFEL"
FT   gene            4792..5085
FT                   /locus_tag="Hmuk_0004"
FT   CDS_pept        4792..5085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP0636A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46155"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46155.1"
FT                   /translation="MSDEYRVAIKPSAWQRSRAVGEWVNRDGARRGFASKALAREWARA
FT                   CSGHGVHLWVQDAPDREDRPIDGYLVGGARGTDRAADGGRQQSLAEGTDNPG"
FT   gene            5204..5638
FT                   /locus_tag="Hmuk_0005"
FT   CDS_pept        5204..5638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46156"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1683"
FT                   /protein_id="ACV46156.1"
FT                   /translation="MQLKTIATLVLAVALVTGSAAALPGNAPAQADDHADTDAADANAD
FT                   RDADSAESDDADGAANESADADRGPPADVPGDDRRGPPADTPAQVPDFVGEIHSLIGQH
FT                   VDGALDGSLGEQISDATPDDESDDADIDDADSDEQTDADA"
FT   sig_peptide     5204..5272
FT                   /locus_tag="Hmuk_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.580 at
FT                   residue 23"
FT   gene            5711..5968
FT                   /locus_tag="Hmuk_0006"
FT   CDS_pept        5711..5968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46157"
FT                   /db_xref="GOA:C7NVP2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1682"
FT                   /protein_id="ACV46157.1"
FT                   /translation="MAESSDRIDTSDLRDGLELNRWQAIKAVTPFLLLGLADLVLLLQW
FT                   GLDPLWGFMILPPILFISVLAWIAFRTGFTKERTQTAAKE"
FT   gene            complement(5973..6236)
FT                   /locus_tag="Hmuk_0007"
FT   CDS_pept        complement(5973..6236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46158"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1681"
FT                   /protein_id="ACV46158.1"
FT                   /translation="MSTDQSHSDDPTDEAVVETAATAAEDVVFSRYDTGAVEDLDVTVS
FT                   FEDGVLDVDVYLNAPDGRHDESRVADDAALAAQAAVDDLFSS"
FT   gene            complement(6237..6629)
FT                   /locus_tag="Hmuk_0008"
FT   CDS_pept        complement(6237..6629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0008"
FT                   /product="prefoldin, beta subunit"
FT                   /note="TIGRFAM: prefoldin, beta subunit; PFAM: Prefoldin
FT                   beta- domain protein; KEGG: hma:rrnAC1680 prefoldin beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46159"
FT                   /db_xref="GOA:C7NVP4"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR012713"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP4"
FT                   /inference="protein motif:TFAM:TIGR02338"
FT                   /protein_id="ACV46159.1"
FT                   /translation="MQGNLPPEAQEKLEELQDLQETAQQVAAQKQQAETQLQESQTALD
FT                   ELDDIDEDSTMYREVGELLVKTDYAEAVEDLEEKVDELEIRTETLEKQEERVREQFEDL
FT                   QSELQQMLGGGGGPGGAPGPGGAGGA"
FT   gene            complement(6703..7467)
FT                   /locus_tag="Hmuk_0009"
FT   CDS_pept        complement(6703..7467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0009"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hma:rrnAC1660
FT                   aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46160"
FT                   /db_xref="GOA:C7NVP5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46160.1"
FT                   /translation="MDLPAVGLGTMGIDETDPIARAIELGYRHLDTAQIYENEATVGDA
FT                   IAASPVARDELTVATKLWIDRLAADDVRPGTEASLDRLGLDAVDLLYVHRPRGDYEPAS
FT                   TLSALDAVADAGLTRAVALSNFEPDQLRTARTHLDAPIAAHQVEFHPYFRQDELLTHAQ
FT                   EHDYPLVAYSPLAGGKVFDDPVLEDIADKYNSSPATVAIAWLCSHDNVVTIPKASSPAH
FT                   LRANLAATDLTLDEADVARIEGIDERVELYPE"
FT   gene            complement(7507..7899)
FT                   /locus_tag="Hmuk_0010"
FT   CDS_pept        complement(7507..7899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46161"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1662"
FT                   /protein_id="ACV46161.1"
FT                   /translation="MTNQPTGEPDGDEWRGMTPRDRGLTVPMIDDVFELLADWRRRAVV
FT                   LHFVDTEASSATVEALATAVTQRGMGRDCLDVVSVSAVRTDLVEVHLPRLDEKGVLDFD
FT                   RRSESVHYWGQPTVEKWAEHVDEVLR"
FT   gene            complement(8006..10351)
FT                   /locus_tag="Hmuk_0011"
FT   CDS_pept        complement(8006..10351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0011"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: hma:rrnAC1663 bacterio-opsin activator-like
FT                   protein; TIGRFAM: PAS sensor protein; PFAM: Bacterio-opsin
FT                   activator HTH domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; GAF domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46162"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV46162.1"
FT                   /translation="MTGETGSGSETSDGKRVLYVDTPTDSVADRLAARLADCRLHHETG
FT                   VEAVTAAESESWDGLVVTDGIEADRRSALLDAVDCPSVLYASADPATIPAETTRRVETI
FT                   VERETADAASLLAEKIETLVGQFPDAFEDARGSALSTICREVTEGSALFAVDDEGRVRW
FT                   SNHSFEALFPVDRIERSIPETEDFYARLDAIVSAEPDDGGRRDIGPRDGPVENHSVVVA
FT                   TPTGTRYYVHQRHRLESVGDGITIEQFEDITDRVRRETRRRLLALLVEQARDGLYTLDH
FT                   NGVVDFCNESFAAMLGYERGELIGMHASEMLAPGELVAGQRTVQALLDDPDTDGAEVDM
FT                   TFRTRDGEDRELSIHYTLLSTGGDSYGGLMGVARDVTERRERTRRIESQRDELSTLSRT
FT                   NVLVQDIIGALGTAASTIELRQTVCDRLVESGRYGLAWIGERHGGDDVIVPLTSAGAWT
FT                   EHLDDVELRADDGADAAPVARAYRTGEVQVVSDTRSLAAFSPRPERAPAAGFEAVIVTP
FT                   LCHGETTHGILAVYATEPDAFSERIARSFAVLGETIGLALTAIQNKRLLQHEAPLRLAF
FT                   RSDSDDACLVRVARSCDCTLETAGVVETSDGVVQYLRVDGAAPSTVVDTVCESELVDDA
FT                   AVTRTDGDSLVELHGPSSPGTELAEVGARLVETEIDPGGARLVVETTGDADLRSVQTVV
FT                   ERWFPDVTLVSKRKRTQPESDGERSPLSPLTDRQREVLRAAYLSGYYDWPRETTAEELA
FT                   DSLGIASPTLHQHLRRAERNLLAGVLDR"
FT   gene            complement(10473..10718)
FT                   /locus_tag="Hmuk_0012"
FT   CDS_pept        complement(10473..10718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0012"
FT                   /product="rpo operon protein"
FT                   /note="KEGG: nph:NP5236A rpo operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46163"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP8"
FT                   /inference="similar to AA sequence:KEGG:NP5236A"
FT                   /protein_id="ACV46163.1"
FT                   /translation="MDHEAVLSFEYDDDQQARRVARSVRPEIGEIGGERTTATLRRDGA
FT                   TVVVEITAADLVALRAGCNTWATLVAVAERTAGTVP"
FT   gene            complement(10720..10854)
FT                   /locus_tag="Hmuk_0013"
FT   CDS_pept        complement(10720..10854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0013"
FT                   /product="RNA polymerase Rbp10"
FT                   /note="SMART: RNA polymerase Rbp10; KEGG: nph:NP5234A
FT                   DNA-directed RNA polymerase subunit P"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46164"
FT                   /db_xref="GOA:C7NVP9"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR023464"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVP9"
FT                   /inference="protein motif:SMART:SM00659"
FT                   /protein_id="ACV46164.1"
FT                   /translation="MSYKCSRCKRDVTLDEYGGVRCPYCGHRVLLKERSRDVKEVDVK"
FT   gene            complement(10854..11165)
FT                   /locus_tag="Hmuk_0014"
FT   CDS_pept        complement(10854..11165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0014"
FT                   /product="ribosomal protein L37a"
FT                   /note="TIGRFAM: ribosomal protein L37a; PFAM: Ribosomal
FT                   L37ae protein; KEGG: hma:rrnAC1669 50S ribosomal protein
FT                   L37Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46165"
FT                   /db_xref="GOA:C7NVQ0"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ0"
FT                   /inference="protein motif:TFAM:TIGR00280"
FT                   /protein_id="ACV46165.1"
FT                   /translation="MKVLGRQYDTMAKDKGRTGSAGRFGARYGRVARRRVAEIEDDMRD
FT                   DHACPECGKDRVDRKGTGIWECSYCGYKYTGGTYRPETPGGKTVTRSIRAALAEDEDE"
FT   gene            11353..12099
FT                   /locus_tag="Hmuk_0015"
FT   CDS_pept        11353..12099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ1562A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46166"
FT                   /db_xref="GOA:C7NVQ1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ1"
FT                   /inference="similar to AA sequence:KEGG:HQ1562A"
FT                   /protein_id="ACV46166.1"
FT                   /translation="MTGFVEIVAVAMIAQLSVLPGEKVQFIIAGLSTKYNPLVVVAAAG
FT                   SAFAGWTALEIAFGAAIQAALPGVYLDAFTAGMFLLFAVLLYRSAPTTGAQPEPAAIAD
FT                   GDGAGADHRTDGGTATVDLPEVVTLAGREFTVPDRFGSFLPIFLLMAAGEFGDKTQLIT
FT                   ITLAAEYGATAAIWAGEMLAIVPVSLLNAYFFYTFSHRFDLRKAHLFGAILFGFFGLDT
FT                   VLSILTGFSIWETIVDALTTALLAVV"
FT   gene            complement(12096..12818)
FT                   /locus_tag="Hmuk_0016"
FT   CDS_pept        complement(12096..12818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46167"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1671"
FT                   /protein_id="ACV46167.1"
FT                   /translation="MSCRQCGSELDRPGDYCLVCRSANTDVVVLELDRERATVTALADE
FT                   TVVAARTITTTPEAGGETGVVELRNFAGLVADDVRRKRPEEVYVTGDRDVVGAVRSQLH
FT                   YPFYRVDGDQPVEHVLERRGEPALEVVDAAPEEKLGGSHSTLVGGRAGKRAIQTVAAHP
FT                   HVKKVIPGPIDAGGSGSRTGVRAKATRADEHGNVRLLIRDGSSVQENRIVTTAGDRELG
FT                   ERVRADLNDALAEADLQD"
FT   gene            complement(12890..14239)
FT                   /locus_tag="Hmuk_0017"
FT   CDS_pept        complement(12890..14239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0017"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   hma:rrnAC1758 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46168"
FT                   /db_xref="GOA:C7NVQ3"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ3"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ACV46168.1"
FT                   /translation="MRPAQPIEQAVGMRYYVSDGDGIGGRLRASPEDFAVRELEAFEAE
FT                   PADADSGAYAHLVVRATLHNWDTNDFASALSDRLGISRERVSWAGTKDKRAVTTQLFSI
FT                   ADADAADVPEIDGAEIDVVGRAGRPVLFGDLAGNAFEIIVREVDRPDGVDGITEQLREF
FT                   AGSADAADEPTVAVPNYFGQQRFGSKRPITHEVGLAIVRNDWEGAVMAYLGNPNEREPE
FT                   ATQAARAYVEETHDWEGALERFPRALGYERALCHSLADADDASPAAFRSALETLPTNLQ
FT                   TLFVNAAQSYLFNRVLSERLDRGLPFDRPVAGDVVCFADSDAPDGLPLPDTDRTQRVTA
FT                   GRVDTVERHCERGRAFVTAPLVGTETELAEGEPGEIERAVLADAELEPTDFALPGEFDS
FT                   SGTRRAVQVRSQIDVRRRDGDAVEFAFSLPKGSYATVLLREYLKRDPAQL"
FT   gene            complement(14354..15067)
FT                   /locus_tag="Hmuk_0018"
FT   CDS_pept        complement(14354..15067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0018"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   hma:rrnAC0442 proteasome subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46169"
FT                   /db_xref="GOA:C7NVQ4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7NVQ4"
FT                   /inference="protein motif:PRIAM:3.4.25.1"
FT                   /protein_id="ACV46169.1"
FT                   /translation="MSKFPDLPGMKNLDANPYEPELASFDDMDADAGDGDAVAKTGTTT
FT                   IGITTDGGVVIATDMRASLGGRFVSNKSVQKVEQIHPSAALTLVGSVGGAQSFIRTLRS
FT                   ESDLYEVRRGEPMSISALATLAGNFARGGPFFAINPILGGVDEEGSHVYSIDPAGGVME
FT                   DDYTVTGSGMQVAHGKLEDRYHDDLSMEEAEELAVEAVYAATERDTGSGNGVYVATVTG
FT                   DGVDITGYDDFEGAR"
FT   gene            complement(15060..15803)
FT                   /locus_tag="Hmuk_0019"
FT   CDS_pept        complement(15060..15803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0019"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   hma:rrnAC1773 proteasome subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46170"
FT                   /db_xref="GOA:C7NVQ5"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ5"
FT                   /inference="protein motif:PRIAM:3.4.25.1"
FT                   /protein_id="ACV46170.1"
FT                   /translation="MQGQNQQQAYDRGITIFSPDGRLYQVEYAREAVKRGTASVGVRTA
FT                   DGVVLAADRHARSPLLERDSIEKIHKADDHVGIASAGHVADARQLIDLARRQAQVNHLR
FT                   YGEEIGVESLTKEVTDYIQQYTQTGGARPFGVALLVGGIEDGEPRLFETDPSGTPYEWQ
FT                   AVAIGGDRDEIQTFLEEEYDEGMDLEAGLSLALRALGSVSDDGLDATGVDVATIDVESE
FT                   QFTALSEDEIAERVTELELEGDDDE"
FT   gene            complement(15893..16231)
FT                   /locus_tag="Hmuk_0020"
FT   CDS_pept        complement(15893..16231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0020"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: protein of unknown function UPF0099; KEGG:
FT                   hma:rrnAC1774 peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46171"
FT                   /db_xref="GOA:C7NVQ6"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ6"
FT                   /inference="protein motif:PRIAM:3.1.1.29"
FT                   /protein_id="ACV46171.1"
FT                   /translation="MKQAIVARTDVGMGEGKLAAQVAHASLMAYEDADRQATSEWKGQG
FT                   QKKVVLAAAGEDALFRLADDAERKGLPNAIVRDAGHTQLDPGTVTALAVGPAADDRIDA
FT                   VTGDLSLY"
FT   gene            16379..16969
FT                   /locus_tag="Hmuk_0021"
FT   CDS_pept        16379..16969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0021"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: hma:rrnAC1776 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46172"
FT                   /db_xref="GOA:C7NVQ7"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ7"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ACV46172.1"
FT                   /translation="MILSDTDILRRLEAGDLVIEPLDDIDLQVQPASVDLRLGREFLEF
FT                   QHANIPCIHPDSEQETEEYTERVTVDGDDEYILHPGDFVLGTTRERVEIPADLLAHVEG
FT                   RSSLGRLAIVVHATAGLCDPGYQGQITLELSNLGTAPVALSPGMRISQLTFTELKTEAE
FT                   RPYGEERGSKYQGQEGPQASKIESDHEFGGDQK"
FT   gene            17007..17903
FT                   /locus_tag="Hmuk_0022"
FT   CDS_pept        17007..17903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0022"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   hma:rrnAC1777 DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46173"
FT                   /db_xref="GOA:C7NVQ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ8"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACV46173.1"
FT                   /translation="MRFVEEIVVDEFLPTFRSLLAEALRERDLTQSEVAELLGISQSAV
FT                   SKYAHGEVERNERLLENDRLAALIEELADGLASGEMTPVQALIETEVVVRELEQGGTLA
FT                   ALHEDAVPELAEYGGDFAVHDPDSNLREAEQTLSSVRRGLRLLENTSGFATLIPAVGSN
FT                   LVEALSDATGIEDVAGVPGRILDVKGRATIPAEPEFGVSEHVAGVLLAAQAGGADASAM
FT                   VNIRYDDGVVDDLEAAGYTTVAFDAEADTETAIGAALDECPDADVLYQTGGMGIEPISY
FT                   VIGPDASAVAEIVREIA"
FT   gene            17903..18535
FT                   /locus_tag="Hmuk_0023"
FT   CDS_pept        17903..18535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0023"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: nph:NP5170A homolog 8 to
FT                   S-adenosylmethionine- dependent methyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46174"
FT                   /db_xref="GOA:C7NVQ9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVQ9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV46174.1"
FT                   /translation="MGDVRSFYGRWARLYDWLATLPGVRSWRRAAASDLDLAAGQTVVE
FT                   MGCGTGANLPHLRSAVGSEGRVLGLDVTRAMLDRARGRGDADLLRGDATRPPLQSGVDG
FT                   LLGTFVVGMFADPRSVVDEWCTLVGPGHRVALLHFTRSRRAWARPIDACYRAFVWASST
FT                   DKRQRDVADSHDRRVEEAYRRLAERTADYRERRLAGGYLRLASGRVE"
FT   gene            complement(18569..19333)
FT                   /locus_tag="Hmuk_0024"
FT   CDS_pept        complement(18569..19333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46175"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1780"
FT                   /protein_id="ACV46175.1"
FT                   /translation="MVERVTLYRAPTTVADVDAIADWLAARIEAGVEVRDRFLDLYADD
FT                   ELADAFAAARVLSPYERETGNTMLGIVRYEQRALDHPERAGGVIYDGLQVQRSLGERLP
FT                   ADERGLDHLHVPVLDRVLGTWGDHDGRWHKRVNVLGQPALVSVPGLYEAPAKPEQYYKE
FT                   QQKHAMVAGDSPPREVLESEVEGEFLVEDDPRTTEALKGYVLQAYHYLETGEGFCEESG
FT                   CRLANPHRQPGVVAAQLQGTAFCPAHAERYRP"
FT   gene            complement(19624..21171)
FT                   /locus_tag="Hmuk_0025"
FT   CDS_pept        complement(19624..21171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0025"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; LeuA allosteric
FT                   (dimerisation) domain; KEGG: hma:rrnAC1690 (R)-citramalate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46176"
FT                   /db_xref="GOA:C7NVR1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR1"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACV46176.1"
FT                   /translation="MTETTLFGGHPLTRDLSDADGVQFLDTTLRDGEQAPGISLSPDEK
FT                   ARIARQLDAAEIDVIEAGSACTGPGERKTISRVADLDLDATVTSFCRGIRNDIDLALEC
FT                   GVDGINLVVPASDRHVEDKVGTSREDNVASTVELVEYAKAQGLWVEVIGEDGSRADLDY
FT                   LEELLGAAIDAGADRICWADTVGHATPDGALEAVSRLSKLGPVSAHTHDDLGLAVMNAL
FT                   VAVAAGADMVHGTINGIGERAGNVALEEVAIALDHGYGVETMDLTEVYDLAQLVANTTG
FT                   IQLAPNKAVVGQNAFTHESGIHTDGTLKDDAMYEPYRPEKVGRERRLALGKHAGRAGVA
FT                   AALDEHDIDVSDDELATIVGRVKEIGDRGRRVTDADLLTIAEEVKGTDRERRVELLDLT
FT                   TIAGGGTPTASIRLAVDGEEREPASATGSGPVDAAMTAIEEALGSSVNWNLDSYHVDAI
FT                   TGNTDAVVTVEVEMSRGDRTVTVSNSDSDITRASVHAMVDAIDRLLADEDEPVVADD"
FT   gene            complement(21325..21705)
FT                   /locus_tag="Hmuk_0026"
FT   CDS_pept        complement(21325..21705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0026"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   hma:rrnAC1691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46177"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR2"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ACV46177.1"
FT                   /translation="MRVVHEDGDERRTLADTVEVAASTVEQAKGLMFRESIPDDYALVF
FT                   RLHGPPWPLSALLGDHGYQSIHMLFVRFPIDVVWLRDETVAQVKTLSPWTGLGMARADT
FT                   VVELPAGAADGVEPGDRVVIES"
FT   gene            21784..22356
FT                   /locus_tag="Hmuk_0027"
FT   CDS_pept        21784..22356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46178"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1692"
FT                   /protein_id="ACV46178.1"
FT                   /translation="MEKAPGGTSVGVDDPYAHVDRCDWITDDGKCRWAVEHGHHDPDFA
FT                   DARSAEDFQCPVVAGGDDHDPSVSSTGEQAGRWDWGDCPHFRRRERDRACTRCGLEERR
FT                   MAHTDERPLLEEHHLSYREGGGDDLNHEITIYLCRWCHAKVHQSWARIDDDANPDPEAV
FT                   AEREGRRTRERSELGFESAAERYRDDE"
FT   gene            22433..23521
FT                   /locus_tag="Hmuk_0028"
FT   CDS_pept        22433..23521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0028"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   hma:rrnAC1693 membrane bound his kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46179"
FT                   /db_xref="GOA:C7NVR4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46179.1"
FT                   /translation="MDLTKQSLGQSYVVAAGVALSLALLGHAVVASEHGWLTAVLIVGG
FT                   LVPALTLAGAQYWLPASGIEGEQVWRVAEWSSLGIGILTLVNVAVLAFGHPLSDLGPVV
FT                   LATSVAIGGIAGVLVGTMLELRNTNARLQRSNDVLNRVLRHNLRNDLTVVLGHLSELEA
FT                   NVSGQQADRVRQLEGKVDEIVATTEKAREIDVALTAEHRTQHPLDVVSHVRERAEAVET
FT                   AYPDATVETDLPESAWVYGDWLVGTVLDNVVENVIVHAEGDPYLRIDCERDASGVTVRI
FT                   ADDCPRIPDHERPMFDHGVETPLNHSTGVGLWLVQSVMESYGGDVTLAASEAGGNRVDL
FT                   TFPAAPSGDEERFSDRLRRAEH"
FT   sig_peptide     22433..22528
FT                   /locus_tag="Hmuk_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.678 at
FT                   residue 32"
FT   gene            23667..24218
FT                   /locus_tag="Hmuk_0029"
FT   CDS_pept        23667..24218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0029"
FT                   /product="GMP synthase, small subunit"
FT                   /note="TIGRFAM: GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; KEGG: nph:NP0620A GMP
FT                   synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46180"
FT                   /db_xref="GOA:C7NVR5"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR5"
FT                   /inference="protein motif:TFAM:TIGR00888"
FT                   /protein_id="ACV46180.1"
FT                   /translation="MTEIAVIDNHGQFTHLEQRALRDIGVDVELVDNDTPPGEIEADGL
FT                   VLSGGPDMDRIGNCPAYLDMDVPILGICLGMQLMADQLGGRVGAGEYGGYADVTVQIDD
FT                   DEDPLIGSLAPETRVWASHADEVKEVPDGFERTAQSDVCNVEAMSNGTDRFGVQWHPEV
FT                   AHTEEGEAVFENFLAVCNGE"
FT   gene            24302..26161
FT                   /locus_tag="Hmuk_0030"
FT   CDS_pept        24302..26161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46181"
FT                   /db_xref="GOA:C7NVR6"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1696"
FT                   /protein_id="ACV46181.1"
FT                   /translation="MTATQGNLAGLSRFIFRAPRWYTSVTFALVLAAVTGIAAFDSRFV
FT                   LDDAWQGVFFVGIPTVLASVGTAYVDNALGGQLTPNRASLLALFCELIVIAFVVGAGVV
FT                   SVLTAFDQEFVLDSLLVSLAAIFAFRLLVVIAVSRSSLPVAAIAASIQPAAAAALLAVY
FT                   TGTTSALLDDPTLRRFLSRPDQAPPELQFLQPVDFGVLALMCVLYAGAVWLFLVLLDRP
FT                   WRSSLGVSVLDFIQGFIGHIAEGSRELEDFFEELGEEALVPVTVLSVRRPDGEEKARFV
FT                   LPMIHPGPMGEIGGGNLPKRVATEADGLAFPPHATAGHDFNLVTEREVDSILSAARSAY
FT                   RELEFTDRATASRRVEEGDASLLGQAIGDDAVIVSTFAPGFADDVEYAVGLSAAAEARA
FT                   GSLDEILLVDAHNSNDGLEGEDLGHVVPGSERSFDMIDGAGKLGAELAAADRGQLRCGV
FT                   AWDETPWEPQEGIGPLGIRVAVFEVEGTRTAYVLIDGNNMEPGLRGDILAALDGIDDAE
FT                   VMTTDTHIVNTVEAENQVGSSIPDDELIALIAELTEQAIDDIEPVEAGMASEKATVTVF
FT                   GNDRTETLASTANAVVSLGGALAVTFILTVLTVSIGIFLVTGG"
FT   gene            26322..28106
FT                   /locus_tag="Hmuk_0031"
FT   CDS_pept        26322..28106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0031"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: hma:rrnAC3189 oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46182"
FT                   /db_xref="GOA:C7NVR7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR7"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /protein_id="ACV46182.1"
FT                   /translation="MSLPDHADRDEQYTWETGQIFATPAEWDRYRAELQADLDAADPPA
FT                   APIESTAAARELVDTVADWYQRIQRLELYATLRDCITDDPAASDRGGTARSLSTRVETA
FT                   VGEHLDRLHSTDAVTLDRIEEALGERRRYFASLRARAARRRSPAVEAVVEQFAEQCSSA
FT                   DRIVRAVKNDDFDAPTVETPDGDERTVTLGRYATELAASDRDYRRRVYESSLDGLATFE
FT                   GTLATAYDEKLTAASTSADAVGIDSIRERQLTNRSYPEGGIEFQFPTALHDRLIDAVGD
FT                   ATGPRERARERRARRLGIDAVRPWDTQVSVADAPEPEIEYEAAVGHVVDAVAPLGEAYQ
FT                   ERARRFFAQRRVDVYECADKRSDIPAFCPSSAEDGAFVLLNFQRDVRTVFHLCHELGHA
FT                   LHVEHHREGPAMYATGPRPISEVPSVLHEVLLTEHLAQQNGPLAAHARERLLQSLEMLL
FT                   YEQAANAAFKRRLAATVDGGERLTADRIADAYRETLARFDPALEPCDRTRFEWLTGALF
FT                   RDAFHHYQYVLGAVGALHVRESLRDGRLDPATYREFLRSTGRDDPVSLFERLGVDLTTS
FT                   APYERAAQAFEGYLDRWT"
FT   gene            complement(28156..28241)
FT                   /locus_tag="Hmuk_R0001"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(28156..28241)
FT                   /locus_tag="Hmuk_R0001"
FT                   /product="tRNA-Ser"
FT   gene            28365..29321
FT                   /locus_tag="Hmuk_0032"
FT   CDS_pept        28365..29321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0032"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: hma:rrnAC1698 methanol
FT                   dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46183"
FT                   /db_xref="GOA:C7NVR8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR8"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACV46183.1"
FT                   /translation="MNVTEASDVCSRVLDEIGSAVIGERAFFETVLLGVVGRGHVLLED
FT                   VPGTGKTLTAQTMAQTLGLSFSRIQFTPDLLPADITGTHVFDERERSFEFNEGPIFANV
FT                   VLADEINRAPPKTQSALLEAMEEGQVTVDGDTYELPRPFFVIATQNPVEMEGTFELPEA
FT                   QVDRFLAKTSIGYPDEDGEFELLQRRAGRVEQSPSVETVLSPEDVDELRALPESITVED
FT                   DVLRYVSNVARATREHRHVDVGVSPRGTQRLFEAVRARALIRGREFVTPDDVKAVAQPV
FT                   LAHRVVLTPEARVENVAEAAVVESVLDDVPVPTVARQ"
FT   gene            complement(29324..29845)
FT                   /locus_tag="Hmuk_0033"
FT   CDS_pept        complement(29324..29845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE1357F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46184"
FT                   /db_xref="GOA:C7NVR9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVR9"
FT                   /inference="similar to AA sequence:KEGG:OE1357F"
FT                   /protein_id="ACV46184.1"
FT                   /translation="MSTRTTDADAESIDARPGTASVAVAVAAALVTVLVSATTPLAGAV
FT                   GLCGLVVVPIGVRRGSRVLHRIGSAGLFGAVLLAGVAGSSPVPMLVAAGAAVVAWDAGE
FT                   HGIGLGRQLGHAAVSTRAQLAHVGVTVAVASVVAVVGYVVYDAASTGQPTTAIVLLLGA
FT                   ALLFTYALDR"
FT   gene            complement(29842..31197)
FT                   /locus_tag="Hmuk_0034"
FT   CDS_pept        complement(29842..31197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0034"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF58; KEGG: hsl:OE1356F
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46185"
FT                   /db_xref="GOA:C7NVS0"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS0"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACV46185.1"
FT                   /translation="MSFSSIPAAATRSADVTDEAAEFEIEPGTVVDRRTRRWYAVTVFA
FT                   LLALGAGVLTRESGLLLTSAFGIAFAGYGQVTSPPPVEVSVERSISDDAPDTDDTVAVT
FT                   VTVRNESDRTMPDLRLVDGVPPKMTVAEGSPRLATALRPGEETTFAYSLRARRGRHEFE
FT                   PTTILTRDASGATERRGTVDAPDTVDCEASLPSQSVSFPLRSQTTRHTGRFPADTGGPG
FT                   VEFYATREYRPGDPLNRVDWNRTARTGDLTTVQYRVERSVSVVLVVDARQAAYAAPAPQ
FT                   ARTALDAAVDAAGHAYVSLTDAGHDVGLTALSPTECWLSPGNGDEHRVRAREFLSTEPA
FT                   LSPSGPDAETSLYAAVQRIRRRAPTDAQIVVFSPLTDDRVAGSAIRLDANGHRTTVISP
FT                   DPTADDSVGHRLAGVRRSLRIADLRQRNIPVVDWDGTEPFPHALARWDGGSR"
FT   gene            complement(31197..31772)
FT                   /locus_tag="Hmuk_0035"
FT   CDS_pept        complement(31197..31772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE1353F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46186"
FT                   /db_xref="GOA:C7NVS1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS1"
FT                   /inference="similar to AA sequence:KEGG:OE1353F"
FT                   /protein_id="ACV46186.1"
FT                   /translation="MNRRRLLLAGATGAAVVGLVLAFAPDAVAVVSLPPLLPTVLAGLA
FT                   VLAGLYRAYQWFGRDPDAGSLPEPERGRPAAVPGDEFDAVLSQAPSFGVSGGDQRALAV
FT                   RSDLEDAALSVLTQYRGLSETEARRRLEAGTWTDDELAAEFFASASGAGSSLRESVTGT
FT                   FWGSGPFPRRAGRVAAELDRIVEDGGEA"
FT   sig_peptide     complement(31704..31772)
FT                   /locus_tag="Hmuk_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.651 at
FT                   residue 23"
FT   gene            complement(31769..32710)
FT                   /locus_tag="Hmuk_0036"
FT   CDS_pept        complement(31769..32710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsl:OE1352F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46187"
FT                   /db_xref="GOA:C7NVS2"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46187.1"
FT                   /translation="MTIDRIGPALVVVLGVLAISAAAAGLDSPETATAVGTGESEGAGA
FT                   GSSDGTGYTAEQMADTAAPNASSPFGNWVGPALQLLLVGGTAAYLAWVGYRLWREGASA
FT                   VPELLKHAVTTVVPAGVAWLVLFGSQLFTLSWGEPDTERSTSGSPEHLEGGGSASAVAT
FT                   DAVSDALPLVALVIGAVVLVAGLVVLASRLTPDGDASTGTVADAPGPSREPDTVADSRA
FT                   SGRFEDADAEATNAVYRAWRELASEVEDADRRTQTPAEIAARARVAGFDRDAVATLTDR
FT                   FREVRYGQRPPTSERETSARSALDRLRSEGDR"
FT   sig_peptide     complement(32639..32710)
FT                   /locus_tag="Hmuk_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.741 at
FT                   residue 24"
FT   gene            complement(32804..34399)
FT                   /locus_tag="Hmuk_0037"
FT   CDS_pept        complement(32804..34399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0037"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG: nph:NP2952A
FT                   N-methylhydantoinase (ATP- hydrolyzing) B 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46188"
FT                   /db_xref="GOA:C7NVS3"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS3"
FT                   /inference="protein motif:PRIAM:3.5.2.9"
FT                   /protein_id="ACV46188.1"
FT                   /translation="MTDDAVDAVDAVELEILRNQLESVAEEMGEVLIRGAYSPNITERR
FT                   DCSTALFDADGRLVAQAEHIPVHLGAMPRAVDAIRDRDPRPGDVFALNDPFAGGTHLPD
FT                   VTFVSPIGAGAGGRSRSGDRPTGDDDIVAYAVSRAHHADVGGMAPGSMPAGAREIQQEG
FT                   LRVPPVRIVADGTVVDDVLELVLANVRNPAQRRADVQAQLAANERGARRIGELLDDHGE
FT                   GLLAAFDAVVDYSRARMERELSALEPGTYEAAGTIEGDGVTDTAVPIEATVTVADGAVT
FT                   VDFEGTAPQVAGNVNAPLAVAESAVYYVIRCITDPEIPPNQGCYDPVTVEAPEGSLLNP
FT                   TPPAAVVGGNVETSQRITEVVFDALAEAAPDRVPAESQGTMNNLVVGGPDFTYYETIGG
FT                   GAGATPNRDGASGVQVGMTNTRNTPVEALEAAYPLRVAEYSLRSDTGGSGRHRGGDGLV
FT                   REIVVETDATVSLLTDRRQTPPAGRAGGTDGTVGENFVDGEAVASKHTRAVEAGTTVRV
FT                   ETPGGGGYGDPDGA"
FT   gene            complement(34396..36381)
FT                   /locus_tag="Hmuk_0038"
FT   CDS_pept        complement(34396..36381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0038"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: hma:pNG7164
FT                   N-methylhydaintoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46189"
FT                   /db_xref="GOA:C7NVS4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS4"
FT                   /inference="protein motif:PRIAM:3.5.2.9"
FT                   /protein_id="ACV46189.1"
FT                   /translation="MDETLLGVDVGGTFTDVVVVADGRLTTAKVPTTADQSEGVLDGVE
FT                   RACDRAGVEMTAVDRFRHATTVAVNAMLERSGATTALVTTEGFADVLAIGRQDRPSLYD
FT                   LDARGPTPLVPAARRYELDERATTDGVERPVDPDEVRALAAEIDADAVAVAFLHAYAHP
FT                   DNERRVAAILRSELDVPVSASHEVLSEFREYERTATTVADAVLTPVVDDYLDRLAERAA
FT                   DRGLPAPRVMQANGGIADPATVRERAVTTVMSGPAAGVVGAAAFEPDDADGVITFDMGG
FT                   TSSDVSLVRDGSVERTTEAAVGGHPIRIPMVDVETVGAGGGSIAGVDAGGALRVGPASA
FT                   GADPGPACYGRGGTEPTVTDAALVLGYLGPDTTLGADLGLDADAAVAALDDLATAADLD
FT                   GPVDAARGVFRVANATMTRAIRGVTTERGHDPRRFALAAFGGAGPMHAAPLADRLGVDR
FT                   VVVPRASGVLSAFGLLAAAEHHDAVRTHRTTLGDATRATIEDVYEDLRGRVRADVSDPD
FT                   AATYRRQADLRYVGQSHELTVDVSEPFRPADLRERFHAAHERARDYRLDDEPVELVNCR
FT                   VTATIEGTAPERSFEGGGEPRVGTREAVFGDGRRETPIYDWPALVPERSIDGPAIVEGG
FT                   ESTVVCPPGWTLVADDEGTIRLEGSA"
FT   gene            complement(36546..36650)
FT                   /locus_tag="Hmuk_0039"
FT   CDS_pept        complement(36546..36650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46190"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46190.1"
FT                   /translation="MATIVAKAQPDPEHREQGEDTAADGGVQISDRAC"
FT   gene            36847..37899
FT                   /locus_tag="Hmuk_0040"
FT   CDS_pept        36847..37899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:pNG7311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46191"
FT                   /db_xref="GOA:C7NVS6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46191.1"
FT                   /translation="MSRYYPPTPVLVAVLVGAALTGGVAAQTDTAETPTASFTHEETLT
FT                   VESGPNQQIRGTTSLEAGAEVTVRIRSANASDPFMARPTATVDENGAFTVTANLSNMSP
FT                   GTTFTAELRIDGEAYAETTGQVVECADDCDGTAAETQSPTETAASDTGTHTVTEREPLT
FT                   TDEPGFATAPRVLTVREGDSAELLVSTGSRDRVALVIGSEDANYRLNATLVDGDGDGHV
FT                   AAMFDTGAAGRPATTLTAASEGDRVVIDSETESGIELAEYDMDLYASRNHDDILALGTL
FT                   SVRSAGGESTENETSDSVSAQSETTVADTATADNRSATTASDGPGFGVFGALAGMILSI
FT                   GAGALRSKRD"
FT   sig_peptide     36847..36927
FT                   /locus_tag="Hmuk_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.925 at
FT                   residue 27"
FT   gene            complement(37923..39281)
FT                   /locus_tag="Hmuk_0041"
FT   CDS_pept        complement(37923..39281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0041"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: hma:rrnAC0837 menaquinone-specific
FT                   isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46192"
FT                   /db_xref="GOA:C7NVS7"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS7"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACV46192.1"
FT                   /translation="MSRQDAAETEPASVGAETYVSASRRIDVSPLAAAGAVPDRRRFCW
FT                   LHPEEPDLLAVGATAAVTVDSPDRFETADDRLTELFGAVDGPDAPEIAAPRAVGGFAFF
FT                   DGNTVPADTQSHWRDFDDGTFVLPRAQIVAGDDATWLTVTVPEDEHSELSSQLDGWADR
FT                   LTDAGTHDGTEPEATAFHWSLSREEWERTVDDVIGRIESDGLDKVVLAQELTVDLDAPV
FT                   PVAPVLSRLRETYPNCTTFCFSPTPGRTFFGATPETLVALADGHVQTEALAGTTDRGET
FT                   AAEDTDLADAMLGDEKYQVENRIVADTIADALRPVADDVTVAEPSIKRITNLQHLHRPI
FT                   TATVPSETSVLSLAERLHPTPAVGGSPRRAASDVIRDVEPFDRGWYASPVGWVDGDGDG
FT                   TFVVGIRAGLTWDERLALYGGAGIVTGSDPTTEYGEVRSRFEPILDALEVELP"
FT   gene            complement(39436..39585)
FT                   /locus_tag="Hmuk_0042"
FT   CDS_pept        complement(39436..39585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46193"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46193.1"
FT                   /translation="MSHTIELSDELSERIEAHKEDDESYEAFIEELVSVYETEGAFLQE
FT                   GYSE"
FT   gene            complement(39650..40717)
FT                   /locus_tag="Hmuk_0043"
FT   CDS_pept        complement(39650..40717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0043"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   hma:rrnAC2354 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46194"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVS9"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ACV46194.1"
FT                   /translation="MGTSDEHDDEQLREELRVFGLSDTEIDTYLALLACGEASTSTVSE
FT                   TTDVTQRAVYNIAERLEGRGLVRVNDHASPTTIRALPPAEAIENLSDRLDSIRPALEAR
FT                   FNETTPETPEIQMIKSRETALKRIKSAISAARQELLLAVPEHVFPEIESELRTAVDSDV
FT                   VVFLLIGGMDEVDGDGSEFAGIADVVRYWGESLPLVYTVDDASAMIGDSTIVSGTHTDD
FT                   VAVTVSEPQLSGSILGMYFSAYWPAATELYVTDPDPLPRTYDWFRQATLHATVHEQAGV
FT                   DLYAEVETESGTTVSGPVTEIRQAFIEPTTNDFTLENSFFIDTGDGIVSVGGKGSFIED
FT                   YQSRSVMLRRLDAVE"
FT   gene            complement(40859..41341)
FT                   /locus_tag="Hmuk_0044"
FT   CDS_pept        complement(40859..41341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0044"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: hal:VNG0743H
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46195"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT0"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV46195.1"
FT                   /translation="MFYADVTASTMSDALVVVEDIDRDRQLLDRARSFAAGSDSDLVVL
FT                   SLVTTDEYEEVAETLDAIGQVEHTTYDEGTILDGLASDVSDLAADVLGEHISYDVRVEV
FT                   ADENQADRIITLADETDCDHIFLPGQRRSPTGKAVFGDRTQRVILDFGGYVTVAMD"
FT   gene            complement(41508..41708)
FT                   /locus_tag="Hmuk_0045"
FT   CDS_pept        complement(41508..41708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46196"
FT                   /db_xref="GOA:C7NVT1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46196.1"
FT                   /translation="MTIVLRGFFVSSAVLLALLGLATPTIEPGTGTFVISVLSGAMLGA
FT                   VFLGSAACIYADWDPFEELLG"
FT   sig_peptide     complement(41640..41708)
FT                   /locus_tag="Hmuk_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.927 at
FT                   residue 23"
FT   gene            complement(41791..42930)
FT                   /locus_tag="Hmuk_0046"
FT   CDS_pept        complement(41791..42930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0046"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sth:STH296 oligoeptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46197"
FT                   /db_xref="GOA:C7NVT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46197.1"
FT                   /translation="MSDRATTTGTTRDDDVVMSLENVSVDFEKEQGVLESLFDEPETVQ
FT                   AVSDVSIDISENDVLALVGESGCGKTTLGKTIIGVQRPTEGTVSYRGQDVWDAKDGRGD
FT                   VTVPFDDIRRSLQMIHQDPGAALNPNRKVLTTLEAPLKKWDPEMSTEDRRARIFALLDR
FT                   VGMEPPEDYAHRFPHQLSGGEQQRIALVRALLMNPDVILADEAVSALDVSLRVETMNLL
FT                   LELQEQFNTSFVFISHNLSNARYLAQEAGGRIGIMYLGEIVEIGPPDEVLNDPQHPYTK
FT                   VLRWATADLDPTAQEMTDPPVRSIDIPDPVNPPSGCRFHTRCPEAREVCTTTAPELGEE
FT                   AATASERCAACHRTDPDHEYWESEPLDGVEAAESPTLND"
FT   gene            complement(42927..43982)
FT                   /locus_tag="Hmuk_0047"
FT   CDS_pept        complement(42927..43982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0047"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sth:STH297 ABC transporter ATP binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46198"
FT                   /db_xref="GOA:C7NVT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46198.1"
FT                   /translation="MQEQRTQGGPDSADPIIEARNVCVTYDLEHRDAMVLDDVSIDLRR
FT                   GEILGVVGESGSGKSMLANAMMDAVEEPGITTGEVTYYPEDGGEPVDVLDLSTEDLKEF
FT                   RWEEVSMVFQGALSSFNPTMSIRGHFEETLAAHDYDVEEGMERARQLLGDLYLDPDRVL
FT                   DSYAHELSGGMSQRALIALSLVLEPQVLLMDEPTAALDLLMQRSILSLLADIKAKYDLT
FT                   ILFITHDLPLVAGLADRLAILYAFELAEVGTATQIAHDSKHPYTRALLQAVPNLDAPTD
FT                   SMRPIEGTAPNPAHVPDGCHYAPRCPLATRECHEETPPWVDVEDDHRSACFHYDEAEDA
FT                   VPFDLSEVSDA"
FT   gene            complement(43983..45149)
FT                   /locus_tag="Hmuk_0048"
FT   CDS_pept        complement(43983..45149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0048"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sth:STH298 oligopeptide ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46199"
FT                   /db_xref="GOA:C7NVT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46199.1"
FT                   /translation="MSRTDRDDDSGETPGSDADFEAVGDALGTPERFTDEGRDPGRAPI
FT                   SGHARNGRVAADGGSSSVSEFQQMADVSMTDAERRRQWIDEKLLAPARIVWSDWRARTG
FT                   ALVVVFYVLMATVGLAIVTEPSPNQGGYLVGAFRTLEFPLGTTASGVSLLSQTVYATPS
FT                   MLTMIASGAVFTVCLGTAFGTIAGYKGGTVDRVLMIVTDIMMTIPGLPLTIVLASALQI
FT                   DGNPVIIGILITINAWAGLARAIRSQVLTLRDAEYVEASRIMGMETSTIISGDIIPNLM
FT                   PYITMNFVQQARAVIFGSVGLYFLGVLPYTSVNWGVMMNAAVNRAGATSSPAAFHWLLV
FT                   PMVTIIILALGLTLLAQGADRIFNPRVRARHAETVASDGDDDATTGEI"
FT   gene            complement(45136..46146)
FT                   /locus_tag="Hmuk_0049"
FT   CDS_pept        complement(45136..46146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0049"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cma:Cmaq_0683
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46200"
FT                   /db_xref="GOA:C7NVT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46200.1"
FT                   /translation="MSYVLKRIAQSVLTVYVVISASFGLVRLLPGGPLDYLRAQAVQQG
FT                   GSDLSMSEINARIAAQTNIAVNEPIYVQYADYMAAMLQGDFGVSTRYGDPVMSIIGPAI
FT                   PWTVFLTATALFLAFTVGVSLGAFMAYKEGSSFDVASTGVGLVLNSTPGYVLALLFISY
FT                   LGYRMELFPTGGRYASELTVGFNASFLGSVLYHGALPIASMALVGFGGWALSMRGNSIR
FT                   VLGEDYLRVARLRGLSTRRIAMRYVARNAILPMYTGLMIAIGTVFGGAVIIENIFAYPG
FT                   VGFYLIQGINARDYPLMMGGFIIITIAMVIGITVADLTYGVLDPRAKGGGSRESY"
FT   gene            complement(46154..48040)
FT                   /locus_tag="Hmuk_0050"
FT   CDS_pept        complement(46154..48040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0050"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tpd:Teth39_2187 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46201"
FT                   /db_xref="GOA:C7NVT6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV46201.1"
FT                   /translation="MANNHTDHEHQSILSRRRFVSGVSLAGIAGLAGCGGQQAEQTATE
FT                   TSGDGGDETDAGDTDTETETEVQATSEAQRKIQELAYITNQTLPVLPVMEKLAQSFQST
FT                   DDWNVPGTDSDAVQTYWPTEWLPREGQWTATDDSDDDRLTFAQWAVPQDSQYNPWNGQN
FT                   YGEARRLMFDRFMKYNLATQEYTGYAIQDWEVGEETVSLTVREGLTWHNGDAVTATDVA
FT                   NQVKLDIYNGGSLGNFVAPEDVGAVSDRVTAVDESTVEITLAEPASETILLAYLQPKRL
FT                   TAHDGSYGEFVTALDEAAGEDERASALSDLTNDTTPEPVGCGPFQFEDADSQRTLLTKY
FT                   EDHPDADNINVPEAEYLYKPQNQGRWNSLINNETDGSATLFMPQNRLNQLPDSMQVSLI
FT                   PRHWGMGLMFNFEEEPVDDVRVRKAIAHVVNRENAALNSGAGTQSKLAVTYPSGLTGEF
FT                   NDQIEGGWLDGVADEFETYGPGESQTEAAASLLRDAGYEKQNGTWQKDGEPLELPIKGP
FT                   SGFSDWVTGVETIVSNLKDFGIEAESVMLDNSTYWGSDYSNGDFVVGLQGWASYDHSYP
FT                   YFHFDWIFNSWDAKNAWNLPSEFESPILHDDERDGETVTPVDIVDELSTANQ"
FT   sig_peptide     complement(47921..48040)
FT                   /locus_tag="Hmuk_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.828 at
FT                   residue 40"
FT   gene            48422..50194
FT                   /locus_tag="Hmuk_0051"
FT   CDS_pept        48422..50194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0051"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: hma:rrnAC0224
FT                   alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46202"
FT                   /db_xref="GOA:C7NVT7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT7"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACV46202.1"
FT                   /translation="MSETVERTRSDRQWWEEAVVYQIYPKSFFDSDGDGIGDLAGITEK
FT                   VDYLDALGVDAVWLCPVYDSPQADNGYDIRDYRSIFDTYGDMADWERLLAELHDRNIRL
FT                   VMDLVVNHTSAEHEWFQHSRRGESEYADYYHWRDGRPAETADYDTDDGPADEVAPNNWD
FT                   SIFGGPAWAYDEERGQWYLHLFDESQPDLNWENEAVREDVYEMMRWWLDRGIDGFRMDV
FT                   INLVSKTPGLPDGDPESGLVGAEHFMNGPKVHDYLSELVAEAIPDDEILTVGETPGAGV
FT                   EDAQRFVGEDGLSMVFQFEHVNVGHEGDKWSLEDYSLVELKESLARWQNGLADEGWNSL
FT                   YLSNHDQPRTVSRFGDDGRYRRRSAKLFGTLLYTLQGTPFVYQGQEIGMTNAPFESKSE
FT                   LRDVESINFVEEAIESGAAESYEDVRDAVETVGRDNARTPMQWSDDENAGFTDGEPWLK
FT                   VNPNYDAINVERARADPDSVWHYYRELGDLRGNRDLLVYGDFELLAPGDEQVFAYTRTL
FT                   GDERALVVLNVSAEPATFAVPDDAGDDLELAIGNLNALETPGSTVELDPYEARVYLTPA
FT                   TDTDRPTTTNSDST"
FT   gene            50191..51924
FT                   /locus_tag="Hmuk_0052"
FT   CDS_pept        50191..51924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0052"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: hma:rrnAC0224
FT                   alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46203"
FT                   /db_xref="GOA:C7NVT8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACV46203.1"
FT                   /translation="MSTNTLTTLENVDREWWKEAVVYQIYPRSFSDTDGDGVGDLQGIV
FT                   DKVDYIDSLGVDLVWLCPVYGSPNEDNGYDISDYHAIMDEFGDMADWERLLDELHDRDI
FT                   RLIMDLVLNHTSSEHEWFQRSRRGEGEYADYYYWRDGRPATDADYDTDDGPADEVAPNN
FT                   WDSIFGGPAWSYVEEREQWYLHLFDENQPDLNWRNPTVRQAMKDVVSWWLDRGIDGFRM
FT                   DAVSHMSKTDGLPDGDPEGTPTGIEHFSHGPRLEEYLTELSADVLSDHDITTVAEMGHT
FT                   LIEQAADYLDDEAIGLDMIFQFSHMGVDGGWDPETVGEWDLPEFKRIMSERQDALADRG
FT                   WDALFLGNHDQPRIVSRFGDEAYHRESASLIGTFLLTMRGTPYVYQGEEIGMTNADFES
FT                   LDEIDDPQTVGRVEQYIADGVADSYEELREVVNARSRDHARTPMQWSDEPGAGFTDGEP
FT                   WLKCNADYTEINVAAQRDDPASVLNQYRRLIDLRQSTDVLVYGDYELLAPEDDQLYAYT
FT                   RTLDDERALVVLNWSSEPATFEGSEIEVDDPTVLYGNYDDAPTEPTNVSLRPWEAVVYR
FT                   L"
FT   gene            52274..53047
FT                   /locus_tag="Hmuk_0053"
FT   CDS_pept        52274..53047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46204"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVT9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0312"
FT                   /protein_id="ACV46204.1"
FT                   /translation="MDADGTTDTVVADPDGSEPSQPRALIHKKILDTAQSNPTAATAEI
FT                   ATEVSGASVELVEQVLQEYGDPAAEDDQPVESDDQDTVDDETSEPEDDEVEPPISAETG
FT                   PDEKGEDVDLTALDEKQRETLRAIHRQPTATQAEIADTLDVSRATIPKRVNDIPGFDWP
FT                   SRQAFVEALFETDAESDDDLAAFEESLTESLEELTARIETIETQLQTTTPATNVVHVEP
FT                   GLLHKVVHACMDADYISRDEELQLLHRLLSDAADD"
FT   gene            complement(53190..54239)
FT                   /locus_tag="Hmuk_0054"
FT   CDS_pept        complement(53190..54239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0054"
FT                   /product="cell surface glycoprotein"
FT                   /note="KEGG: hwa:HQ3468A cell surface glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46205"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU0"
FT                   /inference="similar to AA sequence:KEGG:HQ3468A"
FT                   /protein_id="ACV46205.1"
FT                   /translation="MRRWFLLCSVVLGALLGAGVLGAQSTADYSLSADASVDIPTQEVS
FT                   YDGDTFEISQTGVADPETTFIATASAPEDADYVVYVVDKGESIRQSNAGSGTGEVPLDL
FT                   GTLDPGTYAVTIKQDSTVAAMPLVVRGYDLSQDVPDETTAGTETEVSITADAIHEDAEF
FT                   EQIVLTLWDGSEEHDVTASRADGQRYTATIPAGTLDEGTYRVVSRAETGATAFDHNELV
FT                   GISETTTISVTESPTTTKSGAGGGGGQVSTATETATPMATRTNATASPTVTATPSSNRT
FT                   ATPVSTTERSTRTPDTATTPSETATTEPTASDAVTPSPTTGEGGSFSKLVFAALLAGVV
FT                   GSLTMRRRS"
FT   sig_peptide     complement(54168..54239)
FT                   /locus_tag="Hmuk_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.711 at
FT                   residue 24"
FT   gene            complement(54328..56388)
FT                   /locus_tag="Hmuk_0055"
FT   CDS_pept        complement(54328..56388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46206"
FT                   /db_xref="GOA:C7NVU1"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46206.1"
FT                   /translation="MITLISFPLVDMLRIRYMNGAISDGQQTVLAIVLTVLMLGAPIAG
FT                   AVSAESLDDYVSGSDVEQSASAQFERTAPTPSIMVTSGQTPGSGGVSAKIDDEGYIVNP
FT                   DDTISVHAFAPARLRPNENTKSLAPTSVQSADVTATARSDGWETELDLQKEELNVYNKN
FT                   TEIEYKFTSQMGVSGDGDDYQLVAARLGADVSRPESVDELPSLLTDNPNVEAEVVDTYR
FT                   DQDEPILDEEAVVYEPSKSGRYVVGLVQIEDSADTDRTGFQQKGNGDGNIEAKDEVTII
FT                   GADSLLVQEGESSINAPSSIAPGSTRTLSVDAGEDLKSIQDGKDVSHTVLLINEDRLSQ
FT                   QSIHATGNEDDLITSVDSSIEEVKADTDLSSGAEPFGTSIGTSETSDTIDVTTLLEDVV
FT                   DPDKVTTDGGETLYAAVGSTVGDAKDEVTITVPEGTPPDTYTLVHVATIDGETRSSTTT
FT                   IKRQVGEPNMKVSPSDTIDFGKVTRGNDRTKEFTIENTGTAELTVTDITTSGSYSESFT
FT                   VGETFHKIGAGNSKTVHLTFDNAKSFDNGELTIETAHGTTKTITIEATVTRRSDDGDDD
FT                   DDDDDSDNDDDDPTDTPTDTPTDEPDTPTDEPDTPTDEPDTPTDEPDTPTDEPDTPTDE
FT                   PDTPTDEPDTPTDDDDDDDDDDTTTGDGPGFTPVMVLIALVATLAILRRRA"
FT   gene            56517..58259
FT                   /locus_tag="Hmuk_0056"
FT   CDS_pept        56517..58259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0056"
FT                   /product="putative sodium/phosphate symporter"
FT                   /note="KEGG: hma:rrnAC1030 putative sodium/phosphate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46207"
FT                   /db_xref="GOA:C7NVU2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1030"
FT                   /protein_id="ACV46207.1"
FT                   /translation="MNAAGRRRRYALLVGAVFAVALAARLGTLHWSPLPSTLDGFLYVW
FT                   RAQETIQTGAFPLDRFRADSFVFTTLVTTAGLITGEQPLHVIQPVVAITGGASCLTALA
FT                   LARRLGWRLGWDPGRTALTAGIAGFGLAVSGFYVRRSGTADEEALAFLLVPLFAIAVHR
FT                   LFTRDRRTGRWLAVSALFFVTFPLLHTFSSLVAGLVVTGILGAYLASVPSRRGVAAAGL
FT                   LIAGFWTYLWGYYEVAERLGLFVPYVNRVTAYPGLFLAWLIVLTVGVAWLQRSGATPQR
FT                   AGIGTAIGLWFVALAANVGQSVFPGTQTTPTLLLVAVAAFAVPFLFALVGLPAVSWERD
FT                   ESGPVVLGLLLGPIVVVYFSLTAALTPEYFDTAMRGHVFVYFPVFVLAAVGVGTLAVRG
FT                   RRHGTEAASEAGTPVASDGGTGRSRGTTVALVAIVLVSALVTLPVAFVHLDTLDAPAVT
FT                   TESEFAAVTFTAQRSTGPWATDHSLSRVAVHTYPDAPKASYQPVVAWLQGGEQPECPTL
FT                   AQDTWATSGAHLFPAPAERTSPRAYESWQSRNEVVYSTAGLDATVLVRPRSVGTNESGC
FT                   YSNN"
FT   sig_peptide     56517..56588
FT                   /locus_tag="Hmuk_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.587 at
FT                   residue 24"
FT   gene            58587..58823
FT                   /locus_tag="Hmuk_0057"
FT   CDS_pept        58587..58823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sto:STS208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46208"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46208.1"
FT                   /translation="MSKSIRLSEEAYERLNAHKREDETFSEVVLRLAGERSLLDLAGIL
FT                   SDEEADALRDAVDERRDRRGDELEETADRMRGA"
FT   gene            58859..59215
FT                   /locus_tag="Hmuk_0058"
FT   CDS_pept        58859..59215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0058"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gur:Gura_1138 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46209"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU4"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV46209.1"
FT                   /translation="MNGDEGAVEKARKLESDLVQQRLSSMTLFELCYGIARTTDSEAER
FT                   EKVEEILASKPIHPADTAVMRKAGRLSGKLQNDGSPVEDGDVIIGATADVVAEPVLTRN
FT                   VDDFERLDVEIETY"
FT   gene            complement(59278..59898)
FT                   /locus_tag="Hmuk_0059"
FT   CDS_pept        complement(59278..59898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0059"
FT                   /product="IS240-type transposase (ISH102)"
FT                   /note="KEGG: hsl:OE6115F IS240-type transposase (ISH102)"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46210"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU5"
FT                   /inference="similar to AA sequence:KEGG:OE6115F"
FT                   /protein_id="ACV46210.1"
FT                   /translation="MPENDRLIGNLDEINLELVEREATPRFLMKFSIQLYLAGLSLSNT
FT                   VSALEIVGVERARSTVHNWVHKAELQPESGRSPDQIAVDETVIRIDDEQYWLYAAVDPD
FT                   SNELLYTQLETTRTTAISHAFSAELREKHHVDDAVFLVDGATPLEDACSRYRLDFRYQK
FT                   HGTRNGVERIFRVVKRRTSSSSNRFSHVDPDTADDWLRTFSFA"
FT   gene            60000..60707
FT                   /locus_tag="Hmuk_0060"
FT   CDS_pept        60000..60707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hma:rrnAC1029 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46211"
FT                   /db_xref="GOA:C7NVU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46211.1"
FT                   /translation="MTESVLVGSDLVVTRSGEQILDGVSLSVASNATVLVQGPSGAGKT
FT                   TLFNVLGLLEAPESGTLHVDGRDASALSERERAALRRSTIGFVFQDFQLIGDLTARENA
FT                   ALPQEHAGEPDPEWLDTLFDRLGIAALGGQYPATLSGGEKQRVAIARALANRPEIVLAD
FT                   EPTGQLDPATADAVLDLLFGMQASAETALIVISHDPQLAPHFDERLQLADGRLVEHEHN
FT                   DEQPPQTPSSETS"
FT   gene            60716..63835
FT                   /locus_tag="Hmuk_0061"
FT   CDS_pept        60716..63835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0061"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   hma:rrnAC1028 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46212"
FT                   /db_xref="GOA:C7NVU7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU7"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACV46212.1"
FT                   /translation="MGYRNALLFRWSRRDRLTIVVVAVTAAFLVGTALLLFTATTYSET
FT                   FAEPLSNAGTISYETADGDRPASTERRVVLPLTTASIDGKSAPVVGIPPDAPRVIQNGS
FT                   ASWQQGRLPAMPSDADARGPVSRQRTRTLSGPDGQVTLSVVPRERSNSFLQPTWYVANA
FT                   SVVDAIGTTGYLVIDRDSEADSGNAIPETGVPLVSALLYVLGGIEQVLWALSIAVAAGG
FT                   LLVLVVVYSVTRMSVRDRTEAISVIRSTGAPGWHVGLLFTARAALLVAVGVAIGYAGGL
FT                   IAIKAIVNAAVYLGLPIALDVTVTGGSVGVVGGIAGLLVGMGVVAGAIAAYPAASRPPA
FT                   TLGHRRARLQSSTGASGGRLARLRSILKPTLLSWRSLVPTAATLSVFALTVLLVVAIAG
FT                   LASPLGGDAGGTGTITEADAPHPLNSRLDADYARALTASGTPASPEIIYAQVRDGQPYM
FT                   AHGADYEMFANVTNATVVEGRTPATADEAVVGTDLARTLDLSVGDTVTLGGSVAPGVRQ
FT                   FEVVGAYDAHGTLDDLLVVPLRSSWGLATARGQVHMIRVAGDVPSGAESGTPVGGESTD
FT                   QTGLAITEFTGPETVTQGENITLSVTVRNFGDTAGSRAVPVEYGNQRANRTVSVPAGGQ
FT                   TTVEVTVVAEQTGEVRARTGEYTHTVTVVSPNAIRIPAELPGTAPPGSGLYVPVVDGTG
FT                   DPVTDAAVTVDGVTVQTRDEGVAVVPLPRTEGNYTITAQHENRTATHALRIVAGSERRL
FT                   SGRLDVSPQSGNALTSPTVTVELGNPWQQQLTRTITVVGPTGTRERQVTLSPGNGTRSE
FT                   FTAAAGARTQPGEYAFRLSSNGTQLATADYTVTGDERLAAAVASSGQYASGTTIERSVE
FT                   GVFGNVQLVLVALVVLAGLSTVGSTTATFAQAVHARRQSIGIHRSVGATHGQILRIVLG
FT                   DVVRIAVPAALLAVAVGVAAMLALNRAGWLVFFGFRLSTPTPPLVLVGLALAGVGLAVL
FT                   GALAATVPYLTASPVSLLPAGDRVQLPTAERGRQSDGREQRPPPDASDDD"
FT   sig_peptide     60716..60847
FT                   /locus_tag="Hmuk_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.700 at
FT                   residue 44"
FT   gene            63908..64942
FT                   /locus_tag="Hmuk_0062"
FT   CDS_pept        63908..64942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0062"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="PFAM: Protein of unknown function DUF1616; KEGG:
FT                   hma:rrnAC1032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46213"
FT                   /db_xref="GOA:C7NVU8"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="InterPro:IPR014495"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU8"
FT                   /inference="protein motif:PFAM:PF07760"
FT                   /protein_id="ACV46213.1"
FT                   /translation="MADDVQWRALLPEPVRTLPADLAAVVAFTLFTAAAATVPGVSETP
FT                   LRVVLGLPFTLFVPGYAFIAALFPEAGTGPAEHDDADADRTEEGGIDGIERVALSFGLS
FT                   IALVPLIGLVLNFTPWGIRLVPILVGVGGFTLAATAVAARRRRELPAEDRFRVPYRTWL
FT                   ASARTELFEPETRTDAALNVLLALSMILAVGTVGIAVTVPGQGESFSEFYLLTEDDDGE
FT                   LIADNYPEEFVRGESKPVVVGIGNQEHEPTDYTVVMEIQNVTFTGPNGTQSEVRAEDEL
FT                   ARYRTRLADNETDHRTVDVEPTMTGRNLRLLFTLYRGDAPDDASIETAYRETHLWVNVS
FT                   ATNG"
FT   gene            complement(65217..65806)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0063"
FT   gene            65996..67267
FT                   /pseudo
FT                   /locus_tag="Hmuk_0064"
FT   gene            67296..67454
FT                   /locus_tag="Hmuk_0065"
FT   CDS_pept        67296..67454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46214"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46214.1"
FT                   /translation="MVPRSIVKPTAQFVTGKGSQIAASIDEKICLGENVSLGELIRNTV
FT                   PESAHGS"
FT   gene            complement(67456..67598)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0066"
FT   gene            complement(67756..67893)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0067"
FT   gene            67943..68578
FT                   /locus_tag="Hmuk_0068"
FT   CDS_pept        67943..68578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0068"
FT                   /product="transposase"
FT                   /note="KEGG: hma:rrnAC3387 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46215"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVV0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3387"
FT                   /protein_id="ACV46215.1"
FT                   /translation="MAEIARLSGNREWIDLDFVERERTPEWIMARGIQSHIAGLSLSNT
FT                   VELLEDLGVQRSRKAIHDWVQKADLQPKSGRSPNQIALDETVIRINDQQFWLYAAADPD
FT                   TNDLLHVRLFSTTTTALTEIFLRELRQKHDIETAEFLVDGAQHLQTALQRAGLRFQMCR
FT                   AGNRNAVERIFRELKRRTSSFSNCFSHVEPETAESWLQAFACWHNAPN"
FT   gene            complement(68587..68655)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0069"
FT   gene            68832..70007
FT                   /locus_tag="Hmuk_0070"
FT   CDS_pept        68832..70007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0070"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hma:rrnAC1015 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46216"
FT                   /db_xref="GOA:C7NVV1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVV1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV46216.1"
FT                   /translation="MKVVHIHDYVMPNMGYQENLLPPKILEEGIDIEVITSTAVPEKFK
FT                   EERNDFNSGIYNYKGVKYHRLNYLFKINSAGNIIMRGLLKKLNEIGPDIIQCRSLINTQ
FT                   AIKAARYCKQTDCQLYIDEHVDNGNFNLDSLFKSSSFHIFKILLFKYIDEEVELYLPVQ
FT                   QYSKEFLVDRFGIDEDRTELLPLGVDIQLFCPNEADRDKIRSKYRFPNDHKVIITAGNI
FT                   DPRKDIEVLLDALNEIESEYNWTLLIVGRPSGPRGKAYMERIKDLVSEYGLSSNVIFKD
FT                   FVPHDELSMYYNAADIGVWPGKLGITTVEAIGTGLPVIIPKSKATNYIVSNDNGSQFVR
FT                   GDSESLKLEMEKYINSPKKIKSHSEKSVEHARNVLSWEAIANKNISIYNSE"
FT   gene            complement(70050..71054)
FT                   /locus_tag="Hmuk_0071"
FT   CDS_pept        complement(70050..71054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0071"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mba:Mbar_A0237 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46217"
FT                   /db_xref="GOA:C7NVV2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NVV2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACV46217.1"
FT                   /translation="MEVSVALCTYNGEKYLSELLDSLVSQSRPPNEIVICDDCSSDSTL
FT                   QILKEFKSECELDVRLVSNSNRLGVNKNFIKCVNLCMGDAIAICDQDDIWDENKIEREV
FT                   NMMQKDSSTQVVFHNSTIADENLEPMGNLWEAVGYSHGELKDSRSTFQRLLIENVVQGS
FT                   TMLIDSTLIEDLPLIPEEWNYDHFIALYASLVTNICDIDEELLIYRQHENQKIGAPSAE
FT                   SRCIIPIMSFFDSLRGEPEDYRRQANMMKTITTLIESVEEDRLNISRKKALSSVHSVKS
FT                   FRERQAKIFDGSEHIKDRMYLVYKNYNEDMYRKYSQSNAVVVRDIIRSVYHKH"
FT   gene            complement(71133..71705)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0072"
FT   gene            complement(72002..72394)
FT                   /locus_tag="Hmuk_0073"
FT   CDS_pept        complement(72002..72394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0073"
FT                   /product="transposase"
FT                   /note="KEGG: hwa:HQ3472A transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46218"
FT                   /db_xref="GOA:C7NW77"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW77"
FT                   /inference="similar to AA sequence:KEGG:HQ3472A"
FT                   /protein_id="ACV46218.1"
FT                   /translation="MVSAVKSDARVTYSGERIRVDALGQRVDTVPRTIDGDTYHIWTQK
FT                   REVGRLGAVKLLITKKEPTEQDDEDDEPSVKYIVSNKIDAPASHLIELYAMRWRIETFF
FT                   RDTKQDLGLGDCGSGRPQVPVATGTC"
FT   gene            complement(72487..72639)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0074"
FT   gene            complement(72704..73811)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0075"
FT   gene            complement(73929..74144)
FT                   /locus_tag="Hmuk_0076"
FT   CDS_pept        complement(73929..74144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ3224A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46219"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW78"
FT                   /inference="similar to AA sequence:KEGG:HQ3224A"
FT                   /protein_id="ACV46219.1"
FT                   /translation="MLPLTSFLSCTAPIDELECFSTRQKYHAKTYVTGLVAASNKTVDG
FT                   ISTHMLPAKSERALNKFLTEYDWDED"
FT   gene            74259..75380
FT                   /locus_tag="Hmuk_0077"
FT   CDS_pept        74259..75380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0077"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cyt:cce_0126 putative glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46220"
FT                   /db_xref="GOA:C7NW79"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW79"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV46220.1"
FT                   /translation="MKVSVLCSDLSNNQLGRAYVIAKGLERGPFDVEVIGGLAQGTDVY
FT                   EPFSDEFDYKKVKIPANPISITSIPKILDKTTGDVVYAIKPRTFSFGVGILNKAINNVP
FT                   IILDIDDWERGLHIESKHNTDHYLIKSILDPNGYYSTKLLSPFITRADKITTVSQFLQQ
FT                   KYQADYIIPHARDTSWLNPKNTDQKKMKKKYGVINQRVAMFLGQPRTHKGVEIILQSVQ
FT                   RSKIPNIEVMMVNAENNKIKKLNREYENLTLIDPFSFSNLPQFLSMADVVIIPQEESPA
FT                   SVGQVPAKLIDAMAMKKPIISTNIGDIPEILNECGIVVEPENVSQVVGAIETILEDDEL
FT                   RNSMREAARKKCVNEYSMKNASDKLTEVISEVI"
FT   gene            75377..77059
FT                   /locus_tag="Hmuk_0078"
FT   CDS_pept        75377..77059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46221"
FT                   /db_xref="GOA:C7NW80"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46221.1"
FT                   /translation="MIPRSKTQALLLLSWAPLWIYTLFFRDSWPIFLISVAIAIIPPLL
FT                   YHITEDTVAKKVAVAQIVFISVILQFLLPLESGLRSLPGLDAYWELSAFISILDSGVWN
FT                   PNQLNHSTVGPYPMIHILSSQIHYITDIPPKTIIKSASVIMSLLILLFIYLVARTLING
FT                   DNLIVVVMIPMPFLYQIIVPSGYGRFPLSVAYFFMFILFLINIHRNWERRYMYLSMILI
FT                   FPLVLSHPFTRVYSAIAALSFSAGVVLSLKRTKIETRSKAIVGIIDPYRLVFLTLLILS
FT                   LSHIILVSFRSSNALFVVLQSLTQFGEPVVNAQANAQEFQHSILSWPSVRDYLFVYFQL
FT                   LLIGMVYIICVLGTRVYNNTMKNSVVILITSMLLLNIPIYIFDVVNIFRFTVFFWPIAI
FT                   IVSAPIVSKNLGRKLLALLIVVLVVSNIAGIYPHMYDNSLPSPSSNVESPPNYDRFTKD
FT                   HERAVTKFTVFKGKILANDYYKMLLLTGPGEVYSHPKSYSNLSSLDNYDWFLVGSKDSE
FT                   YIYMRSVDQQYNVTNHDRSNYQSATHMLKVYENGNSTAFKIPS"
FT   gene            complement(77104..77200)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0079"
FT   gene            77470..77583
FT                   /pseudo
FT                   /locus_tag="Hmuk_0080"
FT   gene            complement(77591..78865)
FT                   /locus_tag="Hmuk_0081"
FT   CDS_pept        complement(77591..78865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0081"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   hsl:OE6267F transposase (ISH8)"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46222"
FT                   /db_xref="GOA:C7NW81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW81"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV46222.1"
FT                   /translation="MRRLTTLFPSEFLEEHAEELGVVERDRDLQILILVWALVFDFATG
FT                   ENRTLAGFRRSYNSTGDETLSPGGFYQRLTPTLAAYLRDLVERGLDEVAVPNAVDADID
FT                   RFRDVMIADGTVLRLHEFLSEAYEGRHEEQAGARLHLLHNATDQTIERSDVTDEKTHDS
FT                   TLFKTGSWLQGRLVLFDRAYFKYRRFALIDENDGYFVSRLKQNANPVITAELREWRGRA
FT                   IPLEGKQIHDVVTDLSRQYIDVEVEAEFKRGQYEGTRSLDTKRFHVVVVRDEDADDYHL
FT                   YITNLSREEFLPADLATLYRCRWEVETLFRELKTQYELDEFDTSNPAVVEILLYAALLS
FT                   LLVSRDLLDLVTEQADDEIVFSPERWEATFRLHAQLILHEFGEYLGYSPPPLLERLIDD
FT                   AQKIHQQRPILQETLSTVTQLRCES"
FT   gene            78988..79126
FT                   /pseudo
FT                   /locus_tag="Hmuk_0082"
FT   gene            complement(79202..81013)
FT                   /locus_tag="Hmuk_0083"
FT   CDS_pept        complement(79202..81013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0083"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   hma:pNG7394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46223"
FT                   /db_xref="GOA:C7NW82"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW82"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ACV46223.1"
FT                   /translation="MNDFYSERSQSVGERLALGVFTAGRLQREQVLGILERKVRHALLP
FT                   RLPIDFDARYDAQVPNKLKLTAGPINENTRRLRDSLEPETKQRYQERLNHFENGQLSFI
FT                   GHEVSLDADRTIDWDDDQLEGIPLLWWLKYQSLEPLKWFLFSPEESIDRERVVREVLDP
FT                   WVRTMASTAQIGTPEYLRRDWIPHAVSLRVMTLSRYSAWLESEGMIASRQLVLEYLYKN
FT                   ALFLQNHIETDVGGNHLIENALALLMAGLIFQQADEWIRSGTELFERTAINQFLGDGSH
FT                   FEKSPMYHIMSLRRMLTSIGLLSKYGYSIPQTIQHSAEKATEFLTYLTPPDGQIPLLND
FT                   SQFYQVLSISEILLYADKIDITADNNPDQFGASGYYWLGSGADRMLVDGGCVGPPHLPG
FT                   HSHIDLLSILLWLDGNRVLTDTGVYQYADDVHRQYARSIKAHNSVQVGDCNPIKIGGQY
FT                   LMGRRTAPETTMSRNESFKQFEGKYEVEGFLKPLYTHKRRIQTNGKWWLVTDEVSSHGD
FT                   RPIISRLHFHPSIDLKKVDDAKFNIIYDSEYLLGYLQALHCESIVLDTSPYFPEFGTKI
FT                   SRKVLELRYESTPAGYVISKNEGSEVK"
FT   gene            complement(81010..82260)
FT                   /locus_tag="Hmuk_0084"
FT   CDS_pept        complement(81010..82260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0084"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hma:pNG7395 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46224"
FT                   /db_xref="GOA:C7NW83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW83"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV46224.1"
FT                   /translation="MSSSSLNVLVVSQKFPPEKGGNASRMGDLTSHMAEECEVTVIAPP
FT                   SCYPASDFDWSWDWETTEVRNGCEIVRLWAWQLRTVDPSFVDRLLYYFTFVAHALFWLF
FT                   QRRQKYDVIITTSPPIFTGMVALPFSMLGSLNWILDIRDLWIDVSSDLGFISEDGIITK
FT                   SSRRYQAATLRQADLITVTTHGTTTQLRERYDFETEISVIPNGVDTSVFTPEPSSNEVE
FT                   LIYTGNLGYGQDLETCIRALHYTESDVRFRIVGDGDLRPELVELAEKIGVSDQVDFMGL
FT                   VPREQIPQLLGTAAIGVAPLKEQDSLEYAVPTKLYEYWACELPVLALGQGTIEEIVSES
FT                   GAGVVPSGSPRTVAREIDALLSNKEHRKQLAERGRTFVVANYERQALAHEFVQLAHRVN
FT                   SPSGEISTAQARTEEAP"
FT   gene            complement(82267..83562)
FT                   /locus_tag="Hmuk_0085"
FT   CDS_pept        complement(82267..83562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0085"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase; KEGG: nth:Nther_2529
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46225"
FT                   /db_xref="GOA:C7NW84"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW84"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACV46225.1"
FT                   /translation="MSSVCVHGLGYIGLPTAAMLANYGHTVIGYDVDEELVNDLQAGQI
FT                   TFDEPGLQAFVTEALESGNLEVSDEVGPAKYHIIAVPTPFDEEAKVADISYIEAAGEAI
FT                   TPHLRPGDSVILESTVPPGTTVNTLQPVLEESGLAAGNDFALIHCPETVLPGNIITELR
FT                   ENDRIIGGVNGVSTEAAVRLYESFVEGDIHTTANATTAEFVKLIQNTYRDTNIALANEL
FT                   AQLARDYDIDSREAIHLANQHPRVEIHQPGPGVGGHCLPIDPWFLGQNSDNLDLISTAR
FT                   EINDGMVDYIVDLVGSTLGTLAGKQIAILGVAYKGNVDDIRNSPGLEIARQLQSLPSDT
FT                   ATPISADGGQEAGIQIKLHDPHVQDQTLDLDSLADATDDADAVIIATDHEEYTEIDPPK
FT                   LKSRMGSKLVVDTKAILEQSTWEDAGFTVIRI"
FT   gene            complement(83559..84668)
FT                   /locus_tag="Hmuk_0086"
FT   CDS_pept        complement(83559..84668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0086"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: mma:MM_1170 UDP-N-acetylglucosamine 2-
FT                   epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46226"
FT                   /db_xref="GOA:C7NW85"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW85"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ACV46226.1"
FT                   /translation="MTEQQPHIVIVLGTRPEIIKLAPVIRACEHQKLSYSVIHTGQHYS
FT                   DSLDTVFFDQLELPAPDYQLGVGSNTHGQQTAEMLAGLEEILLEETPEVVLVQGDTNSV
FT                   LAGAMAASKLEMQLGHVEAGLRSFDREMPEETNRVLADHAADYLFAPTETSRDHLREEG
FT                   IADDRIHVTGNTVVDAVQQNQELAATKSTILEELDIAEKNFGLVTAHRAENVDERDRFA
FT                   GLLEGVQRVGEVFDLEMIYPIHPRAKERLDVFDFETPSAVRLVEPQDYLDFIRLQKSAK
FT                   IVLTDSGGVQEETCILGVPCVTLRENTERPETVEFGANQLAGVDPQRILTSTREMLEKE
FT                   STWDNPFGDGQAADHILEILSPVGRGIQS"
FT   gene            complement(84759..86111)
FT                   /locus_tag="Hmuk_0087"
FT   CDS_pept        complement(84759..86111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0087"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   hma:pNG7013 dolichyl-phosphate beta-D- mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46227"
FT                   /db_xref="GOA:C7NW86"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW86"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACV46227.1"
FT                   /translation="MKQLDDSLQDVSTGVSQIDPAAVVRDRVEQNTTNTAIGLVARPDN
FT                   TEVLAWGTLWAQNQGHAVFLTYTSACDEEVLEFADGLGATVVDPESDETDPELLRQQLV
FT                   AAAHEDGYEHVFVNRDIMSSNHVGDGELRQDGHVDTGEATTPECLVAIPAYNEAGTIGD
FT                   VVGDCQAVADEVLVIDDGSDDETAVRAESAGATVVEHAQNQGYGAALQTAFEEADVRKA
FT                   DHLVIIDADGQHDPADIPQLIEAQQESGAELAIGSRFTGDGDTDAPLYRRLGLGVVNAL
FT                   TNLSMGVIRPRSRVRDTQSGFRAYDRTAIESLAVSDEIGDRMSASTDILYHAQHNDFDI
FT                   EEVGTTITYEVEDASSHNPLDHGLTLVKNILFTIERKRPMTVLGVPGFASALTGIGFSY
FT                   WTLSNFLNSGTFPVGLALVSSVFMLGGVFACFTGIILHALNTQVVHRLEET"
FT   gene            complement(86108..87042)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0088"
FT   gene            complement(87221..88156)
FT                   /locus_tag="Hmuk_0089"
FT   CDS_pept        complement(87221..88156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46228"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46228.1"
FT                   /translation="MNIDRRLLLKGVGATLLGSTALSSASAEGESEMDVLLSQTNGVHA
FT                   AADFTEDSRILGLSDAVSVESAPDPTRPGQGQSPDREVLHITSLPAESGRGGEGQGRGS
FT                   GGQGNGGNEDDDGDDHVTFDYGFSMLGLTNRELTVRDLATYGGGAGFSYEWLVTEENVS
FT                   AVGTDQETVGVGPDEAWLILRQPTATDRETALVDDALAGRLTAIIREFEQDRATDQWHT
FT                   RDVGAELDDDAEPAWQELSVASRQFEDLGTTPLSAYGDAEVLTVGVGRGDPYDGPSVLD
FT                   AYYRNLQVAGEAYSFPKAQVQRGRGRGNDG"
FT   sig_peptide     complement(88073..88156)
FT                   /locus_tag="Hmuk_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.573 at
FT                   residue 28"
FT   gene            complement(88345..90378)
FT                   /locus_tag="Hmuk_0090"
FT   CDS_pept        complement(88345..90378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46229"
FT                   /db_xref="GOA:C7NW88"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW88"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1031"
FT                   /protein_id="ACV46229.1"
FT                   /translation="MSNRWIVLCVACLCLACVGLTGVASDAAVAQSTATPNGTTNDTVQ
FT                   HEDPDSVSDSGDVQQLRRWLGDRLDEQLSSSTVALSEGEYERARDALGEDYDSRLEQYV
FT                   DVAGDTGDRGDDDAGETYREVTENQRNLTTQLQRFEQARERYQSARREGNTSEARAAAR
FT                   EMARLGDRINDTGTSVAQGYARLGNQTGIDTTVERTAVRNVTTNTTETATTVRRQTFVE
FT                   TNLTVLDATRTIAYDDPLRVSGRLTMANGTAVANERLLLTVAGRPRPVTTDADGRFDLS
FT                   YRPRTLPRNASEVTVQYVPDDASIYLGSNATLPVEVEQVAATLTVRNATEETSYGRPAG
FT                   GTALLEVQGEPVEGVPLTATLDGLSLGRATTDERGRVRLRSNLSARVSPGERSLLVSMP
FT                   LSNRAITTAGSNTTVDVSTTPTALSIDATESGQNVSLTGQLTTEGGEPVGSQTVSVTRG
FT                   DSVVTTVRTDEDGRFDASLPTDGSDATVDVGARFDGSGTNLESSRATVTISTDVNASES
FT                   GVVNWLFGDGRWFTIAAGVVILAGGGLFVRRRRTSEEESEDAVDRPTPTRTATPAADDA
FT                   LATALDRAERFLDGGAAGAAVRAAYAGVRDGYLDGSATGTHWDLLEQSESLGDAERTAL
FT                   ERIVEAYERAAFSPTGPDRDDATATLTAARSLLGRDEIESDD"
FT   sig_peptide     complement(90295..90378)
FT                   /locus_tag="Hmuk_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.576 at
FT                   residue 28"
FT   gene            complement(90491..90628)
FT                   /locus_tag="Hmuk_0091"
FT   CDS_pept        complement(90491..90628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46230"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46230.1"
FT                   /translation="MPETIPSTCPQCDALLDHMTAMPGGADAPTVVSCPSCEYEETFEK
FT                   "
FT   gene            90799..92220
FT                   /locus_tag="Hmuk_0092"
FT   CDS_pept        90799..92220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0092"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   hma:rrnAC1022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46231"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW90"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACV46231.1"
FT                   /translation="MQVTRRYWTVAALGTALAVWGVVVAGPLPVLGSGAIGAWLLVRQY
FT                   RFVRSATRVPQRVSVDLSTRDRVTAEETAELTVGVTLDTAMPVPLTVTVEPPVGATGDP
FT                   ATVALAPGEREAVASTAVTWPVAGSFTVDDVSLSISDADGLFAQVVDLDAGREVAVSPR
FT                   APDDLHVGEGGNPIATGFGEQASSQIGTGIEPAEIREYVPGDAVRQIDWKATARLDQPH
FT                   VMEFEGGADRQTILVFDHRASMGDGRAGTTKLDYARQLAVAIVDRARTDDDGLGYYAVG
FT                   DDGVTTAISPLVRTDAWATVRTKLLAAATTDGRSGGVGPGRSPNTRLASRVASDDSAFG
FT                   RTLEPFLSEGGAYQQRFDAQPLAGAIRTAEYPSDIVVRTVIVTDDSRPDELRAAVRRAS
FT                   RNGSTVAVFMTPTALFESSELTDLAGAYSDYVAFEEFRRELAGMEGVDAYEIGPGDRLS
FT                   AVLSAGRTRRRRESA"
FT   sig_peptide     90799..90876
FT                   /locus_tag="Hmuk_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.942 at
FT                   residue 26"
FT   gene            92217..92714
FT                   /locus_tag="Hmuk_0093"
FT   CDS_pept        92217..92714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0042 BrkB-like serum-resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46232"
FT                   /db_xref="GOA:C7NW91"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46232.1"
FT                   /translation="MSVEDGPEGLGGALAADSRTAPAVVGAGALLSVLTGWLVAGLGGA
FT                   LAGVVVVAAWLVVSPIVVLALGYVLLAAVLPENAPLATLGLAQAPMVVVFAGSVLDADR
FT                   PIRTLWQGVVALTALSLVVAGSIATFGTRWQVAAVLVAVVAVAGYGLHRYTVATLEVTD
FT                   EY"
FT   gene            92704..93633
FT                   /locus_tag="Hmuk_0094"
FT   CDS_pept        92704..93633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46233"
FT                   /db_xref="GOA:C7NW92"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW92"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1024"
FT                   /protein_id="ACV46233.1"
FT                   /translation="MSTDHATEHQQTTDESTPDDELSPELAARLETLRAENERLRSSYA
FT                   RARQSQYRQTAIGFAAVGLVATIGGVVFPSTRTILLALGGTGVFAAVLTWFVTPERFVS
FT                   ASVGDAVYEALARNHERLCRELGLTDRRIYVPTADPATGVRLFVPQQTPFEIPDADDLS
FT                   ALFVVTDEAATRGVALRPTGETLFGEFESALSGSLADTPDEIATQVRAAIVEQFEIADA
FT                   VELDLDRADGRLTVSVDDSVYGDLGRFDHPIVSIAAVALARGLERPIRAELAGEENVAT
FT                   LRWEPAQAGDDETAVDETSDSETDDDGE"
FT   gene            complement(93640..94668)
FT                   /locus_tag="Hmuk_0095"
FT   CDS_pept        complement(93640..94668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0095"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: hma:rrnAC1025
FT                   methanol dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46234"
FT                   /db_xref="GOA:C7NW93"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW93"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACV46234.1"
FT                   /translation="MAMTEPAALYETVRDEVGTVLVGHDELVEHLTIALLSRGHVLLEG
FT                   VPGVAKTTLAQSFARASGLAYTRVQMTPDLLPADITGTSVYRSQTGEFQLQKGPIFANL
FT                   VVADEINRATPKTQSALLEAMEEGHVTIEGETLALPDPFVVIATQNPIEMEGTFELPEA
FT                   QRDRFLLKLTVDIPDRDEERRVLDRFNDAPELDAESVEQVVDTETLTAAREVVSDVHVA
FT                   DSVREYVLDLVAATRDHPDVEHGGSMRASLGLLNVAKARAAIHGREYVIPDDVKALARA
FT                   VLLHRLVLTADAELSDVSPASVIDDVLADVTPPGGDSETELAAATEMADVEESATDGGS
FT                   VE"
FT   gene            complement(94655..95761)
FT                   /locus_tag="Hmuk_0096"
FT   CDS_pept        complement(94655..95761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46235"
FT                   /db_xref="GOA:C7NW94"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW94"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1026"
FT                   /protein_id="ACV46235.1"
FT                   /translation="MAVDYPRVVLAGFAVVVTLGLLVAGSTSGGAFGSYNPAWDGTSEF
FT                   RSLAADDAEELSIGQNTSVYDPADAEGTLAVILSPAEQYSERERRSIRRFVEAGGTLLV
FT                   AEDVGPNGNRLLRSVGAQTRFDGASLRDERRYENGPALPVATAVGLDNDSVETIVLNHG
FT                   TAVRAAGTTDTGAPNETMRAVRATNATVLAASSPYAYLDRNGNEELDDDETVARYPVAT
FT                   AERVGEGRVIAVSDPSVFINAMLERGDNRAFSHALLAGSDTVVLDVSHAGSLPPLQALV
FT                   LSLRGSALLQAVVGTALLGVLAGHVALLDAVSALRRRFGSDDPARPPRDRAAIVRGVTA
FT                   RHPEWDAERVERVTQAIMERRAEGDGND"
FT   sig_peptide     complement(95660..95761)
FT                   /locus_tag="Hmuk_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.588 at
FT                   residue 34"
FT   gene            complement(95763..96038)
FT                   /locus_tag="Hmuk_0097"
FT   CDS_pept        complement(95763..96038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46236"
FT                   /db_xref="GOA:C7NW95"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW95"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1027"
FT                   /protein_id="ACV46236.1"
FT                   /translation="MTTPRRQRFVVGQVAWMSATIVALALLGSLSLELFFVVSLIGFLV
FT                   VIELTAPFEVMPHWRARLKWLVLLGLLAFGYVVIRRILAILPPGVL"
FT   gene            96129..96722
FT                   /locus_tag="Hmuk_0098"
FT   CDS_pept        96129..96722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0098"
FT                   /product="putative membrane-bound metal-dependent
FT                   hydrolase"
FT                   /note="KEGG: hma:rrnAC0526 putative membrane-bound metal-
FT                   dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46237"
FT                   /db_xref="GOA:C7NW96"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW96"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0526"
FT                   /protein_id="ACV46237.1"
FT                   /translation="MWPWGHLAVGYLCYSLLARATDRRVSLVAVVAVAAGTQFPDLIDK
FT                   PLAWTVAVLPNGRSLAHSLITAAVVGVALVAVARAVDARDESRPLGADGGTTAIRPTAL
FT                   HLAGAFVLGYGTHLLSDGLHAIVDGDFAMLAYLAWPLVPAIEYGGPKSFVGHVASLELT
FT                   PFLALEFLLVGVSLLVWNADGRPGLGRIVQAIRR"
FT   gene            97066..98286
FT                   /locus_tag="Hmuk_0099"
FT   CDS_pept        97066..98286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0099"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   cma:Cmaq_1144 pyridoxal phosphate-dependent enzyme,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46238"
FT                   /db_xref="GOA:C7NW97"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW97"
FT                   /inference="protein motif:PFAM:PF03841"
FT                   /protein_id="ACV46238.1"
FT                   /translation="MGLSPDGRVEQTDIYRELGVREVVNAAGTKTRIGGSLIREEALEA
FT                   MNSAAEGFVELGDLQARASELIRDVTGAEAGYVTSGADAGLLLGAAAAIAGSDVQAMDR
FT                   LPDTDGLADEIVMPRTHRTGYDHALRAAGATIVDVGTNDFHLGTGATNVEPWEIERAIG
FT                   EETAAVGYVQKSYTQPDLETVVEIAHDHDVPVIVDAAAEVPPIDNLERFVETGADLVVF
FT                   SGGKAIRGPQTTGIVAGRKDLIQSIALQHLDMHVAREAWDPPRELIDPDSVDGVPRQGI
FT                   GRPMKVGKEELAGLIRALEVFVDLDYDALSAEWQRQAERAADALNAEDHLTATVSGGEG
FT                   ENVSPVTEVTLDETLSAVELVKALRDEDPRVYVGADGMGDNEIAINPMCLDDEELDYVV
FT                   ERIRDNL"
FT   gene            98365..99513
FT                   /locus_tag="Hmuk_0100"
FT   CDS_pept        98365..99513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0100"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: hma:rrnAC3069 mandelate racemase/muconate
FT                   lactonizing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46239"
FT                   /db_xref="GOA:C7NW98"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW98"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACV46239.1"
FT                   /translation="MEITDYELYGVPPRWLFLRLETDEGVTGWGEPVVEGRAETVRAAV
FT                   EEIMDSYLLGKDPRRIEDHWQAMYRGSFYRGGPILMSAIAGIDQALWDIKGKQYGLPVH
FT                   ELLGGRSRDKIRVYQWVGGNRPEELAAEADQLVDAGYTALKMDATHQMRHIESRETIEE
FT                   IVDRVEHVREAVGDHIDIGVDFRGRVSKSMAKTLTHRLSDLGLMFIEEPVLPENVEHLP
FT                   AIAAQTRAPIAAGERLYSRWDFKRLFDTGAIDVIQPDVSHAGGISEMVKIANTAETHDV
FT                   AVAPNCPLGPIALAASLQVDTYVPNFFVQDHGFDIHLPASDRTHQYVTDDPFVFDDGYV
FT                   EVLDDPGLGVNIDRSLVEERAEANVDWHNPIWRHEDGSIADW"
FT   gene            99552..100301
FT                   /locus_tag="Hmuk_0101"
FT   CDS_pept        99552..100301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0101"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR ; transcriptional regulator TrmB; Helix-
FT                   turn-helix type 11 domain protein; SMART: regulatory
FT                   protein IclR; KEGG: hwa:HQ1993A transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46240"
FT                   /db_xref="GOA:C7NW99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NW99"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACV46240.1"
FT                   /translation="MATGDTGGTLTALGKTFRIVEYMTETDGSVRITELATELDISKST
FT                   VYKHLNTLRSEGYVDKDDVAYRLSPRFIDVGEHVKDSFEPYAQAKPAIDSLAETTDETA
FT                   GLVLEHDRQAVDIYSTVGSHPEACSMTTTRHLHCSAPGKAILSTLSDESVDEILEEPLA
FT                   ALTPDTITDTGRLRSELRRIGERGIAFARGEQRADVNSVAVPIEFEDYQGAVYVAGTAS
FT                   RLSSKRLEEDVPGMVLSTVREIEAKIA"
FT   gene            complement(101143..102213)
FT                   /locus_tag="Hmuk_0102"
FT   CDS_pept        complement(101143..102213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0102"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: rca:Rcas_3568
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46241"
FT                   /db_xref="GOA:C7NWA0"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA0"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACV46241.1"
FT                   /translation="MGMGYFDDRPSVSTDFTYRGMDAAILENEHLRVLVLPGKGGDILE
FT                   FRDKRTDVDVLYHADYQWDPPGDRVIPSTEMTWNEHYPGGWQLNLPVAGGPMSIPGNHY
FT                   DHHGESALIPWDATVTRDDDDAVTLELSTRLRRYPFAVTRELTLPADESSLLVAESVTN
FT                   EGEYELEYAWQHHVALGRPLIGPDARLDVPAGESYIDDYPEGHETNRLAGDQHFEWPTA
FT                   EAVDGEDVDLTAFPPTDSEIHDQAYLLGVDEGWYAVTNSELDVGFALSYPAEHFESLWY
FT                   WQAFGGMDESPFWGRNYTAGLEPTTAYPGHSYPEAQRENGTMKTLEPGETVSVELTAST
FT                   YGGRERVTGVENGVVE"
FT   gene            complement(102661..103386)
FT                   /locus_tag="Hmuk_0103"
FT   CDS_pept        complement(102661..103386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0103"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: hma:rrnAC2049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46242"
FT                   /db_xref="GOA:C7NWA1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV46242.1"
FT                   /translation="MAVPSTVTTALADRPVEGRRCLEAGAGVGNATAGLLDAGAERVYA
FT                   VTNDRAHARTTRERVADGDTRSDRLAVLESDLRTLALADDSIELITAHGLCNVLDPAEL
FT                   SAVAATFRRVAAPGCHLVIDDYAPLPETAAVRELFAVENAAAELATGGPALTFYPPDAL
FT                   RRCFVGGGWSFDRERTLLDPVPWTADHLSAHAVAARDHAAGCPGDLGDRLAARADRLAT
FT                   AIGSESAGRMYSLAFRLSA"
FT   gene            complement(103387..104271)
FT                   /locus_tag="Hmuk_0104"
FT   CDS_pept        complement(103387..104271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0104"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hma:rrnAC2048
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46243"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46243.1"
FT                   /translation="METRPLGDTGQDSTVVTFGTIALNWLEQEGADQLVEHVLDYGVNH
FT                   FDVAPTYGDAELKLGPKLRQHREEIFLGCKTQERDYEGAWEMLERSLDRLGLDSIDLYQ
FT                   VHGLEYDDELDAITGDDGALRAFREAREEGLIDHIGLTSHSEPALVLDAIDRIDDLDSL
FT                   MFPLNPVVAAKDDGDHDYEAVLDRAHAADIGTLGIKAFAAGSWPDTDDLPEADRPFANW
FT                   YRPVTAPDEIRRRFDFAASQGLTSVVSAGDPKLVTMILEAAADYEEMDEAAQRSLIERV
FT                   RHDDSPVPEQLHH"
FT   gene            complement(104313..104387)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0105"
FT   gene            complement(104563..105372)
FT                   /locus_tag="Hmuk_0106"
FT   CDS_pept        complement(104563..105372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46244"
FT                   /db_xref="GOA:C7NWA3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46244.1"
FT                   /translation="MSFRQPSKRSFAVAVGTATAVLVGVPAAAVVPGTAFVAPVPISLA
FT                   LLCGIAATVLALRVPSLPISLVRARVHLGVLAVPLGVVVVAPFLFPALDLSGSPDDGLL
FT                   LGLLAVFVASGALYVATTNRYAVLLNAAHSPIAEWRARPDARYSRRVRVASFVGGIAAL
FT                   ALPLLVHLPGVRLLPGIGGVLIAQSIFYRRSRTYQLFDDGLLIRASGTVVYQFVPAGQL
FT                   SSVKRGPDAISIRRSLPWPFPIRCAVDELARPDELLSTLRDAIERRP"
FT   sig_peptide     complement(105283..105372)
FT                   /locus_tag="Hmuk_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.656 at
FT                   residue 30"
FT   gene            complement(105422..105928)
FT                   /locus_tag="Hmuk_0107"
FT   CDS_pept        complement(105422..105928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE1357F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46245"
FT                   /db_xref="GOA:C7NWA4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA4"
FT                   /inference="similar to AA sequence:KEGG:OE1357F"
FT                   /protein_id="ACV46245.1"
FT                   /translation="MTGIDRSPTRTGSALAVLAALVALAAVGAFSWIALAVGGVGVGLV
FT                   LAGVALARHDAVSTGAAALFVGVLAAGVQGAPVTALLVGAVATVLAWDSAGTAIDLGAQ
FT                   LGRSATTVRIELVHAGGTALVGGLAAAIGWSTYQLGLGSQSLTVPVFLLVAALCLAGAL
FT                   AARGR"
FT   sig_peptide     complement(105818..105928)
FT                   /locus_tag="Hmuk_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.652 at
FT                   residue 37"
FT   gene            complement(105925..107850)
FT                   /locus_tag="Hmuk_0108"
FT   CDS_pept        complement(105925..107850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0108"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF58; protein of unknown
FT                   function DUF11; KEGG: hsl:OE1356F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46246"
FT                   /db_xref="GOA:C7NWA5"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA5"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACV46246.1"
FT                   /translation="MSRGRLLAAVGLVAFAVGVGALAAPGVFGLGVQRYAVVVIGLLAV
FT                   AAAIRVVQGRRHSPRRRGETATPEELPAVASPGEELDAVLAAFDPTRYGTADRRRKQLR
FT                   RVATEVLTRYRGDSEATASEAIERGTWTDDPVAAEFLADERSRLPLTDRLRTRLGGQSA
FT                   YWQGIEHTARAIAETAGVDTDDRDGSPLPGLDGVVGSIDGRDAGLDRASAVADPTPTTR
FT                   STGHWRGISAAALAALGVGVLAERAGVVLVAVVGIAYAAAARQRTLSAPTLSVERTVEP
FT                   ADPEPDEPVTVTLTVTNEGEEAVWDLRLVDGVPPALSVVEGSPRLGTALWPGASATVTY
FT                   EVAAERGRHEFGPAQVLVRTLSGSVEREQTVEPATTTEITCVPPLRPIDEPVPLRRQPT
FT                   RHTGRVETATGGEGVEFFATRAYRSGDPLSRIDWNRHARTGELATLEFREERSATVVLV
FT                   IDRDEAAAVGPSQRGQTAVQRSVDAASRLFATLLDDGNRVGIAALGARDCWLAPGAGDA
FT                   HRVRGRELLATHPALAPGETPESVLPFGWLASLRSQLPGDAQVVLFSPLCSPAVATVAR
FT                   QLDAGGHLVTVVSPNPTTTASGAGQLATVARRFRIADLRAAGIPVVDWPWAQSLPVALA
FT                   RTRWSK"
FT   sig_peptide     complement(107779..107850)
FT                   /locus_tag="Hmuk_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(107847..108737)
FT                   /locus_tag="Hmuk_0109"
FT   CDS_pept        complement(107847..108737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsl:OE1352F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46247"
FT                   /db_xref="GOA:C7NWA6"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46247.1"
FT                   /translation="MSRDRLRDAALGLLAVVAVALTARTLPTARQREPGGDGAGGAGIG
FT                   EGGGIPARSTEPLPQLLDVPLLAELIALLAVLFALVALWGLYRHWRALFRVAVPVLVLS
FT                   LVLAVLLQGVPFDPLPKPSSGGVPATDNVSVGAGGGGSTATEPSVLSIALVVVIAVAVV
FT                   GVAVAANRRPADRDDRDDRTDPDDDGTRAAVAVGRAAGRAADRIEETAAVDNEVYRAFR
FT                   EMTARLDVADPETTTAREFERVAVESGLSADDVAALTDLFERARYDDYEIDGDDERRAV
FT                   ELLRRIESRYAEGEP"
FT   sig_peptide     complement(108666..108737)
FT                   /locus_tag="Hmuk_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.775 at
FT                   residue 24"
FT   gene            108932..110350
FT                   /locus_tag="Hmuk_0110"
FT   CDS_pept        108932..110350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0110"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   hma:pNG7117 sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46248"
FT                   /db_xref="GOA:C7NWA7"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA7"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ACV46248.1"
FT                   /translation="MATRDSWVSNVGFVLASVGSAAGLGNLWRFPWLTAGNGGSAFLLV
FT                   YLLIVVGVGVPGLLAEFVLGRLGRQTPVGALRSLTGSRWGSVLGGFNVLTTLVILSFYS
FT                   VVGGWILRYLLVSPVGAYFDQPQQYFGAVNYGLEAVGFHLLFLGIVAGIVFFGVSGGIE
FT                   RVSKVMLPGVVLLLVGLAAWTATQPGTADGYAFYLGFDADYLAANFLGVLGPAAGQALF
FT                   TLSLGAGVMLTYASYLDEDASLPRDTLVIAISNTVIGVLAGLVVIPLLFSQGIDPGQGG
FT                   PGALFVALARAFASLPGGTVVATVFFAAVLMAAVTSAISLLETPVATLVDTVGVPRRRA
FT                   TALITALLAATGSGLALASSVFEFVSGTLADLLLTVGLFAFLAIVAWLLRGEALAEFRA
FT                   GAGRFDALAVPWLLTVSWVLPVVVLFSLTNTLATLAGVSLGLGGRAGVAVLGTVGCRLA
FT                   VGTRSGDETSVVDG"
FT   gene            complement(110369..111157)
FT                   /locus_tag="Hmuk_0111"
FT   CDS_pept        complement(110369..111157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0111"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: hsl:OE2970R
FT                   putative inositol-1(or 4)- monophosphatase /
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46249"
FT                   /db_xref="GOA:C7NWA8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA8"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACV46249.1"
FT                   /translation="MSDPDALALRAARAGAERAHDLFRRDLAVETKSGKTDVVTRADRE
FT                   AQAAVAAVVDDADADATLVGEEAAAAKSVPETGRAWVVDPIDGTHNYVRGGRCFTTSVS
FT                   LVADGEPVAAANVLPAMDDTYRTVDGGVALNGTPVTTSDRTDPERAIVCPTIWWPMDRR
FT                   EEYARATRAIVERFGDLKRPGSAQAALGRVAAGELDGVITNVETNPWDTIAGVHLVREA
FT                   GGRVTDLDGDRWTHDARGLVASNGPLHDAVLDAARAIDGA"
FT   gene            complement(111154..112668)
FT                   /locus_tag="Hmuk_0112"
FT   CDS_pept        complement(111154..112668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0112"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: nph:NP0766A dipeptide/oligopeptide/nickel ABC
FT                   transporter ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46250"
FT                   /db_xref="GOA:C7NWA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWA9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46250.1"
FT                   /translation="MTAREDPVVSVQSLKTYYHDDSIVGAKPPVRAVDGIDLDIREGET
FT                   VGLVGESGSGKTTLGRTIIGLADATDGVVEADGQDVTEFDAEQARDWQRRVGMVFQDPE
FT                   ESLNDRMTIGEIVQEPLKAHDWPVLTVAVEGDATVRGSGVRPAEPDETVDLTVGLDGDV
FT                   TVRDELPLSADAVTAAVDRSGDAPTVDVTVEKSRAEIRRDRAFDLLDRVGLSEEHFYRY
FT                   PHQFSGGQRQRIGIARALALEPEFVVLDEPVSALDVSVQARIINLLEDLQDEMGLTYLF
FT                   IAHDLSVVRHIADRVAVMYLGNVVELGPTESVYADPHHPYTVSLLSAIPGSGSPWTGER
FT                   ITLRGSPPNPRDPPAGCPFATRCPAKIRPDDYDLPERTWRALDELRVVFRTRARAEASA
FT                   AETIKRLIGLDVAGQDLRETVSDLLADHDLPPAAQSTVDAAVELAAGGDDDAAAEQLRE
FT                   AFGSRCDREHPEPYDGGEDRTSQCLRQEAEYDGVAETIRARQEDEP"
FT   gene            complement(112665..113651)
FT                   /locus_tag="Hmuk_0113"
FT   CDS_pept        complement(112665..113651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0113"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: hsl:OE4302R dipeptide/oligopeptide/nickel ABC
FT                   transporter ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46251"
FT                   /db_xref="GOA:C7NWB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46251.1"
FT                   /translation="MSDEPLLSVRDLEVVFHTEREQIHAVDGVNFEIREGQTVGLVGES
FT                   GSGKSVTARSILGLVDEPGRIEGGEILYRGEDLTEDNWADHRGDIAIVFQDPTNSLNPV
FT                   YTIGNQIEEALRIHQDLRGRAATDRAIELLEDVGIPDAPRRVDEYPHQLSGGMAQRAVI
FT                   AMALACDPDLLVCDEPTTALDVTIQAQILDLLAELQAEQDLAILFITHDMGVIEDATDW
FT                   VNVIYAGEVVERAPTEALFDHPAHPYTRALLESIPGRTDPDERLPTIEGEVPTPTGPAT
FT                   DCRFAPRCPEAFEDCRSVAPEHVSLDGDRSAACLLHDPARSDGGERQ"
FT   gene            complement(113648..115129)
FT                   /locus_tag="Hmuk_0114"
FT   CDS_pept        complement(113648..115129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0114"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC3297 oligopeptide
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46252"
FT                   /db_xref="GOA:C7NWB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46252.1"
FT                   /translation="MAGAHGPSSDAADDEVTPETASTILPTESPTLVWVGLGAGLLALE
FT                   VGALATFLVAILSDTLAAASLPGVGFVEGIEAAARQLPTLLSRETVPNEGYWNGQRWVG
FT                   TFLGLRPEVAWGIRVALIYLYALAVAGWAVLGYRLYRREYRAADWTPRDDVIDRFRNHG
FT                   WGLFGLAVVFMFVVMAVFAPALGPTTVDKNMRNSYDNELTYWDAETDSVETILVGEANL
FT                   ASQSRGDGEERVGPMEYDDFGRFHPFGTLPTGRDLFTFIAVGSRISLVIGLLSVGLSVG
FT                   VATSLALIGAYYKGRVDLGMVLVSDGVMAMPQLLLLIMLTTVLKDTWVAGLYSGAFLLA
FT                   LIFAFTGWTYMWRSLRGPALQVSERQWIDAAKSFGQRPRTIMRQHMLPYITGYLLIYGS
FT                   MTLGGAIIAIAGLSFLGLGVSPPTPEWGRAVNLGQEYVDTGSWHISLIPGLLITLVVTG
FT                   FNALGDGIRDAIDPRSDAAGSDADDGAAAGRGGGA"
FT   gene            complement(115131..116150)
FT                   /locus_tag="Hmuk_0115"
FT   CDS_pept        complement(115131..116150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0115"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC3298 dipeptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46253"
FT                   /db_xref="GOA:C7NWB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46253.1"
FT                   /translation="MSRLRYIAKRVALSVPVVWLGTTMTWAIIYLGPIDPATRLLSEGQ
FT                   TQNPAAYEAARTQLGLDQPPLQHYFDWMGSLLTFDLGQTWLLYQGSDVNALILDFLPRT
FT                   LWLGFWSVLIAVCIGVPLGFYAGMRSNTASDYVASMGGIVWRAMPNFWLGIMLLAVLGS
FT                   SQAIFGFDWQSLWIELDALTGSPDLSRLHTVEGFLAATKKVLPAAIVLGSASMGNEMRI
FT                   GRTAVLEVRNEDYVDLARAKGVSERALVWKHIFRNALIPLVPIITSEAFLLIGGSVLVE
FT                   TVFSINGIGLLFFNAATQGDLPLVGTLMYVFILLIVGVNLLQDVLYTVIDPRVGLEGA"
FT   sig_peptide     complement(116067..116150)
FT                   /locus_tag="Hmuk_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.665 at
FT                   residue 28"
FT   gene            complement(116229..118151)
FT                   /locus_tag="Hmuk_0116"
FT   CDS_pept        complement(116229..118151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0116"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hma:rrnAC3299 dipeptide ABC transporter
FT                   dipeptide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46254"
FT                   /db_xref="GOA:C7NWB3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV46254.1"
FT                   /translation="MPEDTTRRGFLTVAGAGAATALAGCSSGPSEESTATDEPTDSTDD
FT                   GGDESAEPSDASDDSTSSVSNTLQMMSPGPVQTLDPINAKGSGVGFNQYGSSLLDFPNG
FT                   EYPPEGAVIEDYSMSDDGLTYTFQLKQGVSFHDGTELTADDVVYSFRRLAGSENSRNRD
FT                   DIIGETMTIDHEKDASRTEPADEESLADYVPGSLAVDAVDDYTFEFTLASPFQYTLSQI
FT                   AGGTFAILPAGSVGDVDGYDGEYEYNEFFSTAGDGPAYAGLGPFEVDEWNKGDALRLTA
FT                   FDDYYGEGPELDGVTITVVESANTRFSRFQNGNADLMQEDISTAAFNPESVSIEETSGS
FT                   RSVGTYTFDDGTTVNYGEIPALRTEYIVFNCLEVPLPVRRAFAYAMNQDEIAKNVYKGT
FT                   GQPAYHMTPPAAYPTFEDGVSSAETYDRHAENGYQSVTEFGADGYPYGYGETLLDEARS
FT                   VMEQAGYGENDRYEITATTIAGDSAYGSVFTRLQSKLRSAYIDMSIEESQFGTIISRAI
FT                   NGDMEVFGLGDGMEYPGPQNFLRFLWGNNPGSQFTRWGAEGSFYTEEYRQTAMDAWENK
FT                   YQPDDSTQQSRNEAFQTVEEMNWASVQELPTVNPVAQRFWQEYVDVEMHGVMGNQTFDQ
FT                   VTKGE"
FT   sig_peptide     complement(118053..118151)
FT                   /locus_tag="Hmuk_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.526 at
FT                   residue 33"
FT   gene            118303..118767
FT                   /locus_tag="Hmuk_0117"
FT   CDS_pept        118303..118767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE4296F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46255"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB4"
FT                   /inference="similar to AA sequence:KEGG:OE4296F"
FT                   /protein_id="ACV46255.1"
FT                   /translation="MSENANEWGRTLETATEMADELRSEGWSVETVRAAHVAPEPPSHG
FT                   ETDRFGFVYLAQGEVADDVRSAVAEGEFDGYELFTHRDGSDLYAVTRLTDRDRDLAVLL
FT                   VGAIDLTTAGELAAVARDRGEMYSHVKLVDGTHLATFRHDDADPFFPEDV"
FT   gene            118764..119702
FT                   /locus_tag="Hmuk_0118"
FT   CDS_pept        118764..119702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0118"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ter:Tery_3391
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46256"
FT                   /db_xref="GOA:C7NWB5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV46256.1"
FT                   /translation="MTEFDDAGPVVARLDEPRGDHTRFAVLADPHVSTRESGTSKLFEH
FT                   TLDHLEAAVADIGRRDVDAVLSPGDLTKDGEPWNYDAVDEALSELDVPFYAVPGNHDVP
FT                   KVRDEHDPLSVEAFADRYGPGELPYHAEVGGLDVIGLNTAGTADRLYESHEGRVTEATL
FT                   DWLDETLAEAETPVVLLHHNLPSVSDQIDAHREIEPEMVEIPAMADADPLAETLADGGA
FT                   QLLLSGHYHLPATGEYHGLREIAAPTTCSFPQSYLLCETTPEGTTVRLVPIADEVGLET
FT                   AHARRSGDSATAKGLTAIAAARLASFPLVSE"
FT   gene            complement(119792..120397)
FT                   /locus_tag="Hmuk_0119"
FT   CDS_pept        complement(119792..120397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46257"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2249"
FT                   /protein_id="ACV46257.1"
FT                   /translation="MSKVARLIDEWELDGVGQQLEEYWLGTGDEQYSLRELADWFNQRL
FT                   LAAAHDRADEAYVDGEIENTYELLTDDDVGTGTRAEVETRLEQRGIDLESLRASFVSHQ
FT                   SIYTYLTDERGVSKPSEERSDSSQIEKTAESIRRLVSRTQAVVRNNLESLHNTDRITIG
FT                   NFSVFVDVQVFCQDCGTQYSADELLTNGGCDCQDEPET"
FT   gene            120533..121666
FT                   /locus_tag="Hmuk_0120"
FT   CDS_pept        120533..121666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0120"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: hma:rrnAC3069 mandelate racemase/muconate
FT                   lactonizing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46258"
FT                   /db_xref="GOA:C7NWB7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB7"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACV46258.1"
FT                   /translation="MTRIVDYELFEVPPRWLFLKLETADGTTGWGEPILEGRAATVRTA
FT                   VEELLEGYLLGEAAGRIEDHWQTMYRGGFYRGGPVLMSAIAGIDQALWDIEGKRTDRSV
FT                   ADLLGGSTREHVPVYKKLVPERVDRIPELATDAVEAGYETLKLLTTYQTAPLESGADVD
FT                   AICEHLSLARDAVGRAVDIGVDLHGHVSASMAPRVCARLAADDPAFVEEPVRPEHLRTL
FT                   DRSATHDVPVAFGERLYSRWEFRPHLEAGRVDIVQPDVSHAGGITEIAKIASMAETYGA
FT                   RVMPSCSVGPIAHAASTQLSHHLPNAVTQPDLGEHYVDAYVDNADELRSENGRVTLPDR
FT                   PGLGVDVNEAGVRDHAGTGSDWRPPVRRYDDGSFVEW"
FT   gene            121728..122423
FT                   /locus_tag="Hmuk_0121"
FT   CDS_pept        121728..122423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0121"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   hma:rrnAC1338 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46259"
FT                   /db_xref="GOA:C7NWB8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB8"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACV46259.1"
FT                   /translation="MADGDRIAATKTAFELLDVVYRSGGASAAELMDATGLSRGGVYKH
FT                   LRTLVEVGALANRDGVYELGPTVAEYGVAASASHAVLDQTDAVDRLARRIDAPANLWVS
FT                   DGEECHCRYTTGTDRAAYPRAVGDSERLVESPPGKVVLARLPTRQRTELVGTHNETLLS
FT                   QLETARERQFLEERLLSAPDWVSIAAPVLAPGGDAAAAIEAVVPSDRADQLDATTVGER
FT                   LVETAAEMQ"
FT   gene            123147..124301
FT                   /locus_tag="Hmuk_0122"
FT   CDS_pept        123147..124301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0122"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: hma:rrnAC3069 mandelate racemase/muconate
FT                   lactonizing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46260"
FT                   /db_xref="GOA:C7NWB9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWB9"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACV46260.1"
FT                   /translation="MSEITDYELFEVPPRWLFLRIETSDGLVGWGEPVVEGRARTVRTA
FT                   VEELMDNYLLGEDPSRIEDHWQTMYRGGFYRGGPVLMSAIAGIDQALWDIKGKHFDAPV
FT                   HELLGGKARDRIRVYQWIGGDRPSDVAEQAREQVEAGFTALKMNATEEIERVDDPATIQ
FT                   AAVDRLRQVREAVGDEVDIGVDFHGRVTKPMAKRLVEELAPYEPMFVEEPVLPEHNDAL
FT                   PEIAQHTTTPIATGERMFSRWDYKSLFENGTVDVIQPDLSHAGGITEVKKIAAMAEAYD
FT                   VAMAPHCPLGPIALASCLQVDATAANAFIQEQSLDIHYNETSDVLDYLADPAVFDYDDG
FT                   YVEIPDDPGLGVEIDEEYVREQAELDHDWHNPVWRHDDGSVAEW"
FT   gene            124525..125331
FT                   /locus_tag="Hmuk_0123"
FT   CDS_pept        124525..125331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0123"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mem:Memar_0926 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46261"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV46261.1"
FT                   /translation="MPADPTANAVPNRHADSVAVVTGSTRGIGAGVARRFAAEGASVVV
FT                   TGRSVEPGERVVAEIEDAGGEATFLQADMRDPAEIQALIEHTVEEYGRVDTLVNNAGVQ
FT                   TETTASEATLDDWAFVVETDFRSFWLCAKHAVEHMPEGGTVLNMSSNHARLTMPGLFPY
FT                   NAVKAGIDGMTRAMALELGPEGITVNTINPGWIEIERTSEELGEDYEYTEEIHPVGRLG
FT                   TPADVAGLATFLASDDATFVTGESILVDGGRSQVMQDDVYLDYRRE"
FT   gene            125639..126613
FT                   /locus_tag="Hmuk_0124"
FT   CDS_pept        125639..126613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0124"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; KEGG:
FT                   hbu:Hbut_0577 DHH family phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46262"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC1"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ACV46262.1"
FT                   /translation="MADHTAVAATLEGHDSCLLVVHAHADLDAVGAAVGLARTLDSDAR
FT                   IVAPDGLKRRARQLVEGLDETVHTPDGVAVGDADCLVVLDAPSSDRIEPVWGAMTPESL
FT                   VVIDHHEPDDLVEASTVAAVDTTAGATAALVADVIDALDGTAGSKARIALAAGLFDDTS
FT                   GLAGASPEEISRFGDLLADNDHVDVLSALLEHERSFGQRVAASKAVVRATGYRADRTLV
FT                   LTTTISSQQSVAAQALRATGAEIALVFSERDDQCWIVGRAESGSINLPEDLFEPLAETF
FT                   GGDGGGHAGAGVAKLETTALETIREETLAQLEATLGTALSALS"
FT   gene            126784..128421
FT                   /locus_tag="Hmuk_0125"
FT   CDS_pept        126784..128421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0125"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hma:rrnAC1977 medium-chain fatty acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46263"
FT                   /db_xref="GOA:C7NWC2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACV46263.1"
FT                   /translation="MTLHQFLWRAENVFGDQEIVSRTHEGIHRYTFADYGDRVRKLASV
FT                   LDRRGYGEGDRIATFAWNNHWHHELYFGVPCQGAQLHMINILLPDSHVQHLVDDAEDAV
FT                   LVVDPTMLDALEAAYDEAAFDSVELFVVMGDTVPETDLEPVTDYESFIADGDPDYEFPD
FT                   VSEDQPAGMCYTSGTTGMPKGVEYTHKMYWGHTMGLLTGELGLTARDTAMTVVPMFHVS
FT                   GWGRPFATLASGAKQVLPGPNPEPEDLARLVESEGVTQSAAVPTVWRGLLQYASEADPD
FT                   LDSLEYVLSGGSATPKGLIERYREDLGIELVSGYGMTETTPITHLAETIPSNVDADGDE
FT                   RTATRAHAGLPLPGVQLKVVDEDGAEVPWDGESLGELLMKGPWVTTEYFNAPDKTERSI
FT                   TEDGWLKTGDIARVTENGYTDVVDRLDDLVKSGGEWISSVELENRLMGHEAVAEAAVIP
FT                   VEHPTWDERPAAFVVVEDDATADDDLRETLRSFVAEEYPSWWVPDTIEFIPAVPKGATG
FT                   KFSKIDLEDQYVDDELRARVREQAPGQR"
FT   gene            128506..130719
FT                   /locus_tag="Hmuk_0126"
FT   CDS_pept        128506..130719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0126"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   hma:rrnAC1951 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46264"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACV46264.1"
FT                   /translation="MLTEGEGETSAPTVPAPVTPDDPNAWYAPDVRDQDEIHPGVVVTV
FT                   TETAAGFEYDLRDPLLSVDDADALATVEEYFADAHVDRPRTREGAIERVESGLDEKHQR
FT                   VIDRLVDCSPASRRRLDYHALCSLACLGELTPYALDDRIDVADLGSGSVRVHTDDFAPA
FT                   ETDLDPDTEFLDRFASERLEQHTVTFHEFEIPVIVYRENVLGDDPFTTKYAVREPDQLP
FT                   GDEELIEACKTRVWEASIDGVLEDEVAFVRDRARTLLSRQLTIRNTRAWFDAARYRLRT
FT                   ALAEYDLTVPPVDRRFADDRLEDLLYYVLRDLVGYGKLTVPVRDPTLEDIEANRVDERI
FT                   KVVPRLDVGHNERVPTNLCFESERAFVNVVTKLAADDGTELNASTPSAKVNLSPEGVEE
FT                   TIRCAVALPTISEDGPHISIRKQSPDPMTPVDLIERDALPTELVALLWLLYEHHGVVLF
FT                   CGPTGVGKTTLMNAHMPFIPYRDRPISIDEGSREVFIPHETGVSLTTRDHERDHRRVTM
FT                   ADLMTECNYLNPDVEVIAEVNTAASFETFAETLNTGHGLLGTTHAEDVETLVNRVVEQG
FT                   LPPYLLQEIDLLVFPKRVGEDRFVGEVVEIVDETTYRALDRDADRCGVVRKADATVYWN
FT                   TVCTRDRNGEFELAGLVGEGSDPIHAFERLADQTDQTVDGVEAMFERRHRYVQYLVQEG
FT                   ITDADELFALLADLKTDEAATVERLHRQRADEPTVRGEEIDGD"
FT   gene            130709..132601
FT                   /locus_tag="Hmuk_0127"
FT   CDS_pept        130709..132601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0127"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   hma:rrnAC1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46265"
FT                   /db_xref="GOA:C7NWC4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACV46265.1"
FT                   /translation="MATETPRQLNPLDRGLYALFAQHADSGRHDGDRVRYRAADLDASF
FT                   ELYLARTYGLAWVAGLAGCLFVLVVTAAVPPAVLAEVVAFFQNGVPIVNQVHWPVVPRP
FT                   VVAVGAGLVGGGTVRLLVLRAGSTYLRWVGKARRSDIEATLPGAVRYLRVLASGEHDQR
FT                   AMLGRVADQDAYGETAVAFQRILNRAALTGSLDEGLEHVASETPSRDLLAPFLLKFREH
FT                   ANQSADALEGYLQMEGRLLSHEQSRRHERATGFLELLAELFVVLLVLPALLVLIVTIMG
FT                   VLSPGLSEQVATPAGPMTVRSVLVYGSAGFVLAAGASASLLVAAIRPHSASAPSYTAPA
FT                   SLRSIVETASRNPASAARVLAPTVPVVVAVLAGLGYRPVNVALLAYVAYGLPVGAVAVR
FT                   RAKVDDAKDREIQDFVHAVSGHVSLGRPFSEAVERVAEEVDLGALQSDVDQLAFTLGLT
FT                   ASPDDDATDGRAAALDRFVERVGTPMAEQTIGLVVGALDAGSDAEDVFETLQTEIGKLY
FT                   HERKALRSSLLVYVAVGWTTALLVVGIVVAVNAYVLDGFAQLSTVSSGPGITIDPTAVD
FT                   PPRDRYRFYVVTQATMLGCGWFAGTASRGRYEALLHSGALVAVAYVVFTGAGMV"
FT   gene            132598..133305
FT                   /locus_tag="Hmuk_0128"
FT   CDS_pept        132598..133305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP0156A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46266"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC5"
FT                   /inference="similar to AA sequence:KEGG:NP0156A"
FT                   /protein_id="ACV46266.1"
FT                   /translation="MTERAQSHVVGVVLLLGLTAIAMGGLTATIGTIVDDQTASADATR
FT                   VADDLDAALRPVETTGHRSATVSFADGTLGVEDRELRVLDSSGVVATVETDAVVFESEQ
FT                   RRVGAVAGAITRGRGDNTWLRATPPITSGPDVLVVGAQRLNGSGSVGGTGGVTTTLRTN
FT                   VTHDRQALGSGEYRVAIETATPGAFERFARERGLDATVRDLDGDGVPSAVIEFEGTRTA
FT                   YLVVHDMRLEVGT"
FT   sig_peptide     132598..132684
FT                   /locus_tag="Hmuk_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.469 at
FT                   residue 29"
FT   gene            133302..133751
FT                   /locus_tag="Hmuk_0129"
FT   CDS_pept        133302..133751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46267"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1948"
FT                   /protein_id="ACV46267.1"
FT                   /translation="MNDRAVTPVVEKTITIGLVALFLAGVTTSLFGGAVPAARDAAGGS
FT                   IGDRTLATATERVEQAIPPNVANVTVRERVRLPATIRGSGYAIEADGRSLVLDHPEPAV
FT                   GGRSRLVVPPSVQRVSGSWESGSELVVVVRTANGGLSVALQEGRP"
FT   gene            133748..134446
FT                   /locus_tag="Hmuk_0130"
FT   CDS_pept        133748..134446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46268"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1947"
FT                   /protein_id="ACV46268.1"
FT                   /translation="MSRQSRASCGRAQTGLPALAIALLVLTMVTGISLALADGAIGAAD
FT                   REPGERRVAVSLAAGLVAPESPLTERANVLGEERLSNVDQRQLRTAFPVTDETAVRVEL
FT                   DGDPLVTTGTPRTGTTIRRLVVVEERTTERVEPSLGWQRRVTLPQRGAGARLTLVPPAG
FT                   TNVTTVRANDRVVLHDEDGLAGTYEIDLSRFETTTLQFSASGPLPDGSVEVEYDAIRTH
FT                   KATLAVTADG"
FT   sig_peptide     133748..133861
FT                   /locus_tag="Hmuk_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.950 at
FT                   residue 38"
FT   gene            134439..134843
FT                   /locus_tag="Hmuk_0131"
FT   CDS_pept        134439..134843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46269"
FT                   /db_xref="GOA:C7NWC8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1946"
FT                   /protein_id="ACV46269.1"
FT                   /translation="MDRAQLPVSLLEAALGVVVILAVALGFVVGVPTPDTREPQLTAYA
FT                   NDAATILVNEPPEHRDATRLAEILADEQSFQRERDKLRDRTGAILPDNLMFRVETPHGA
FT                   VGFPVPGGVTTGEATVTTVEGALTIRVWYA"
FT   gene            complement(134897..135514)
FT                   /locus_tag="Hmuk_0132"
FT   CDS_pept        complement(134897..135514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:pNG7166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46270"
FT                   /db_xref="GOA:C7NWC9"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46270.1"
FT                   /translation="MADLPELYAKPSGQYEAVVGPVASVRVLSRFGISPVGVSPKLSLA
FT                   GKQLDLLQGSVFVLVVGVAIAGYGAYEYQQQAQTLSDTTTVEATITDTGVETIPQRRGR
FT                   TDYEPTATFEYQFDGTTYTGNDIRPSSIATDYDTRSAAEDALSEYEVGETVTAYVNPAS
FT                   PGQAFLENEPSDGPAKFVVVGGVTALVGAASALRSGGDADHG"
FT   gene            135563..136111
FT                   /locus_tag="Hmuk_0133"
FT   CDS_pept        135563..136111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46271"
FT                   /db_xref="GOA:C7NWD0"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1945"
FT                   /protein_id="ACV46271.1"
FT                   /translation="MLSRRPDARRGQLVLVAAVVVAVALIPIVVAYLQLGYHADVRASG
FT                   DYDDPTADATRTLTRALATASADVPAEHGWTDRDDAATTVRDRLEPRIEHVERARLDAG
FT                   TARSLSYNATDAQRWAASSCPSGDGRSFGRCVAIDGVVVQERADRTHVLGVAVDLTVTS
FT                   ERGRTVATVRVPTVAGRES"
FT   sig_peptide     135563..135658
FT                   /locus_tag="Hmuk_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.846 at
FT                   residue 32"
FT   gene            136176..136985
FT                   /locus_tag="Hmuk_0134"
FT   CDS_pept        136176..136985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46272"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1942"
FT                   /protein_id="ACV46272.1"
FT                   /translation="MTDREVMSDLQFLTGSRHRATMLAALSEEPLRPTELCDRVEATRT
FT                   TVQRILAGFRERTWAEKIDGRYRATLTGQRVHERYRTLWETVERADRLAPLATHLDRFD
FT                   EPLPVEAFDRGSITEATEQEPLAAVDRIVEWLRDSQGDHIETTTPIVANTFNETVSGLL
FT                   ETDLSVEMVIDENVLERSMTDFETALERGQTHECVDVWVAPEPLTDGLMVRSDRAAVVA
FT                   YDETNNVRAVLESDDETVVGWGRRQFETTKDRARPLADVLSESSVEE"
FT   gene            137202..137435
FT                   /locus_tag="Hmuk_0135"
FT   CDS_pept        137202..137435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46273"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1941"
FT                   /protein_id="ACV46273.1"
FT                   /translation="MSPPGREVEYTESDVIEVFKDRDDYAEPLTASEVAELLGCSRRTA
FT                   LNKLHDLQESTDLTSKKVGGRSRVWWIPVRMD"
FT   gene            complement(137432..137983)
FT                   /locus_tag="Hmuk_0136"
FT   CDS_pept        complement(137432..137983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46274"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1940"
FT                   /protein_id="ACV46274.1"
FT                   /translation="MNVPEGRLVHSRVVADPRDPLAAALDRSLTGYAVFEPQETLLLDA
FT                   GGHGIVTFRDGVPEQAYYTGTDRGGPSALADLGMPGPYHVELVALDDTALDQIGDHAEL
FT                   AVPPGMPAERLAGDPALAASTRRAAPADRETETPADDDGPDRSDAGAVEAFLDDEAKID
FT                   AIKQQARAEAKRRAEEWGFD"
FT   gene            complement(137980..138747)
FT                   /locus_tag="Hmuk_0137"
FT   CDS_pept        complement(137980..138747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0137"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   hma:rrnAC1939 cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46275"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD4"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACV46275.1"
FT                   /translation="MVEAFAVASGKGGTGKTTSTLALGMALAEEYDVTVVDADTGMANM
FT                   LFHAGLADVETTLHDVLAADAPVEAATYERFGMTVVPCGTSLDDFRDADPTRLRAVVAD
FT                   LAAETDILLLDSAAALDSRSAVLPIVLADRVIVVLQPTIPALSDALKVQEYATSYGTDV
FT                   AGLLFNKVHDDDAIDEIAAKTEQYFDGPTLATVPASEAAREARRAGRPLLAHAPSSPPA
FT                   TSFRRAATRIDVRDRGSEAVADRFRSAVIPDSP"
FT   gene            complement(138809..141622)
FT                   /locus_tag="Hmuk_0138"
FT   CDS_pept        complement(138809..141622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0138"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; PT repeat-containing
FT                   protein; SMART: Integrin alpha beta-propellor repeat
FT                   protein; KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46276"
FT                   /db_xref="GOA:C7NWD5"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD5"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ACV46276.1"
FT                   /translation="MSNTSQIRLRIGRATVVVLIAAVVAASPIVASVTALGDDASISQR
FT                   TDDIVAQQSAPSGFSGETNLSEAETKYVGTAENDTAGWSVANAGDVNGDGIDDLVVGAP
FT                   ENDTGGTNAGAAYVFFGPADPGTVSLADADVTLVGAAASDRAGYDVSYAGDVNDDGYAD
FT                   VIVGAPGNDSTASNAGAAYVVYGGDTMADRISLADADVTLIGDSPGDRAGWSVSNASGL
FT                   DGPDGVAVGAPFANDSAGGAYLVSGEQLFGTVDLGAESTATLTGESPGDQAGWSISHAG
FT                   DVNADGTADVIVGANNYTAADGPAGSGAAYVVYGAVGGERDLGDADLRLRGVDGADRAG
FT                   WSVSYAGDVNNDSTADVIVGAPFTDPNGTVAAGSAYVVYGEPDRSGDVSLADADVRLTG
FT                   EGDRDRAGVAVSSAGSGDVTCDGVDDVLVGAPQNDSNGNASGAAYVVAGSESFSGNISL
FT                   SDADAIFRGEAAGDRAGRAVDDVGDLDDDSFDDIAVGAPRNDSSATDAGAAYVLNSDCA
FT                   VLETPTATPTETPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTD
FT                   TPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPT
FT                   DTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTP
FT                   TDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDT
FT                   PTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPQNLAAISFVAFCVPGEQG
FT                   SGNDPCPEGERLLVKFEDQGDGSFAPEGGDAMGVTVTPSEFKDNDPSEVVAVQWTSGQS
FT                   ISTVVVKSSTDECNYPGGSSGTAESCGPPSGQSSQSEPGGGGSGPLPPIFLAGLAATSL
FT                   VAVGRRD"
FT   sig_peptide     complement(141509..141622)
FT                   /locus_tag="Hmuk_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.521 at
FT                   residue 38"
FT   gene            complement(141893..142546)
FT                   /locus_tag="Hmuk_0139"
FT   CDS_pept        complement(141893..142546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0139"
FT                   /product="ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /note="PFAM: ATP:corrinoid adenosyltransferase
FT                   BtuR/CobO/CobP; KEGG: hma:rrnAC1936 cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46277"
FT                   /db_xref="GOA:C7NWD6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD6"
FT                   /inference="protein motif:PFAM:PF02572"
FT                   /protein_id="ACV46277.1"
FT                   /translation="MSEDTDGGPRAEPITASAPDDFGLVQAWWGDGKGKTTAALGMAMR
FT                   AAGHGYRVHLLQFMKGGTSSVEDVRGEYNAIAALPGFSYENAGHYGWHGFLDGSDDDEH
FT                   AARARGALARAEELIEAAIVADLSAPLALDGPPEDGLHMLVLDEILYAANRDLLAPADV
FT                   IELIESAPEDLELVLTGGHERPAFLTEYADLVTNVAKERHPLDDGQGARKGTEF"
FT   gene            complement(142539..143264)
FT                   /locus_tag="Hmuk_0140"
FT   CDS_pept        complement(142539..143264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0140"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105; KEGG:
FT                   hma:rrnAC1935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46278"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD7"
FT                   /inference="protein motif:PFAM:PF01955"
FT                   /protein_id="ACV46278.1"
FT                   /translation="MLEARIRDGVCQCRSDGSRWLGTGPAGGYRRADAVYNVTVPEGFD
FT                   RTDLSSYVTERRRRAGFEIDGPGLLTGVDVTHARCATVGPVTVLATVGLSNPAALPLDS
FT                   TSREGRGSADADDAWRPGTVNLVVGTDRALDDGTLAELLATCVEAKAATLSRLVGVPGT
FT                   TSDAVLVGAATDGDPADFAGSATTVGSAGRACVRDAVRASFRARYADDDPPASVADARY
FT                   GVTTDRQADVFAPRNYEYE"
FT   gene            complement(143257..144315)
FT                   /locus_tag="Hmuk_0141"
FT   CDS_pept        complement(143257..144315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0141"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /note="TIGRFAM: L-threonine-O-3-phosphate decarboxylase;
FT                   PFAM: aminotransferase class I and II; KEGG: hma:rrnAC1934
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46279"
FT                   /db_xref="GOA:C7NWD8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD8"
FT                   /inference="protein motif:TFAM:TIGR01140"
FT                   /protein_id="ACV46279.1"
FT                   /translation="MMCMLPDAVDELRESGGQNEAVDEQGRVPHGSADDPWVLDFSANT
FT                   NPCSPDGAARVYESSLASARRYPPDDYCAFRAAASTVVDCEAREVIPTAGGLAAIRLTL
FT                   QTSVEPGGSVLVPAPSFGEYAREVRLQGATPAFVDHDAILDADPAGHDLAIVCNPNNPT
FT                   GECYDAERLRAFAERCRDADTTLLVDEAFLGFTDEPSLAGTPGVVVARALTKLYGLPGL
FT                   RAGYAVATGRHRERLDTARIAWSLSGPAAAVGTHCLRDTEFVAATRERVSAERERMRTQ
FT                   LAGRFRVSPSDAPFLLLELDGRDTVEELLATVREHDMAIRDARTFRGLDAHVRIAVRMP
FT                   DENQQLLGVLDA"
FT   gene            complement(144354..144899)
FT                   /locus_tag="Hmuk_0142"
FT   CDS_pept        complement(144354..144899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0142"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolsynthas
FT                   e"
FT                   /note="KEGG: hma:rrnAC1932 4-diphosphocytidyl-2C-methyl-D-
FT                   erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46280"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWD9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1932"
FT                   /protein_id="ACV46280.1"
FT                   /translation="MAGGRGTRLDTDGEKPLSPVAGRPLIDYVLDALDASGVASVVVAT
FT                   SPSTPETAAHVSAPIVQTPGEGYVADLDAALADDRLARPTLTVAADLPLLTGAVLDRLR
FT                   RAHESGSLTVAVPAARKHELGVSVDTTFDHDGRTVAPTGVNVVGGEPSRTLVVDEPRLA
FT                   VNVNRPGDAAVAREWLRS"
FT   gene            complement(144899..145660)
FT                   /locus_tag="Hmuk_0143"
FT   CDS_pept        complement(144899..145660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0143"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: nph:NP5306A
FT                   cobalamin (5'-phosphate) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46281"
FT                   /db_xref="GOA:C7NWE0"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE0"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ACV46281.1"
FT                   /translation="MIGAAFRGALGFLTRLPVGHGERAFDAFRTTPAAFPLAGYVVGLL
FT                   LAPAVALPVPAPTVAFSLVVGVVLVTGVNHADGLADLGDAAVVHGDAERRREVMADTTV
FT                   GVGALLALGVDLVGIALAGLALAALPVAGAVVVVLASEVGAKLAMATLICRGTPSHEGF
FT                   GSSFLNEADGRDLWLPVVVALPAVALGWLAGGSGLLATGSALIGAVAVALAVERWAAVT
FT                   LGGVGGDVLGAANDLARLAALHLGVIAWTLW"
FT   gene            complement(145657..146598)
FT                   /locus_tag="Hmuk_0144"
FT   CDS_pept        complement(145657..146598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0144"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: hsl:OE3253F
FT                   cobalamin biosynthesis protein (adenosylcobinamide
FT                   biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46282"
FT                   /db_xref="GOA:C7NWE1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE1"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ACV46282.1"
FT                   /translation="MIAPFTVLTAAALELLAAEPPARAHPVAWLGRAVAPLDRAWRRPR
FT                   LVGAVGALAVPLTAAVAVAVLVVAAGRASTWLAAAAAGGALFVATSLRMLLSEARSTIG
FT                   ATSTDLDAARGSLRALAGRDAGPLSAGQVRSAAVESAAENLADGLVAPLAAFVAGVVVG
FT                   QAAALSPVPALALGAGGAAWVKAVNTLDSMLGYRSKPVGWAPARLDDAVMWLPARIGAL
FT                   LIAAAARDPAALRRARPWLDGVPSPNSGWPMGVLAAAHGVRLEKPGVYALDGGEQLPST
FT                   EISLRSVRTVAVAGGLAYALAVVTTAAVGGLP"
FT   sig_peptide     complement(146545..146598)
FT                   /locus_tag="Hmuk_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.597 at
FT                   residue 18"
FT   gene            complement(146595..147239)
FT                   /locus_tag="Hmuk_0145"
FT   CDS_pept        complement(146595..147239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0145"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: hsl:OE3249F cobalamin operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46283"
FT                   /db_xref="GOA:C7NWE2"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE2"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACV46283.1"
FT                   /translation="MVVSFDCFGTLVDADRPEEPWAAVADALAARDVTVPSDWEAAYRS
FT                   SHREYERGAEAPLDEHVRLALASRGVDIEGEAAHDATLAAFDSPVTVRDGARIALASAR
FT                   EYGPVAVCSNCSVPGLVERTLDRADLAVDSVVTSVGCGWRKPHPTIFERTAAALAVPLD
FT                   ELVHVGDDARTDGGADRVGATALVLDDVALSAVPEWLAAAVADAASGEEPP"
FT   gene            complement(147532..148515)
FT                   /locus_tag="Hmuk_0146"
FT   CDS_pept        complement(147532..148515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0146"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sme:SMc01702
FT                   putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46284"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46284.1"
FT                   /translation="MRHRPLGTTGIDVTEVGLGTWNVGGDWGDVSDEEGREAIRAALDA
FT                   GIDFVDTADVYGDGRSERHIAHVLDERDEDVTVATKAGRRLDPHVAEDYDYEHLSTFVD
FT                   RSREYLDQDTLDLLQLHCPPTDAFYQPETFAALARLKDEGALDHYGVSVETVEEGLKAI
FT                   QFPGVETVQIIFNPFRQRPADLFFEEAKRRDVGVIVRVPLASGLLTGALSRDDTFPEND
FT                   HRNYNREGEAFDRGETFAGLSFERGLDAVEALREHVPEDLTMAQTALRWILDFEAVSTV
FT                   IPGSTSPEHIRQNAAASQAAPLSHQTHGAIRDIYEKYVFDDVHHRW"
FT   gene            complement(148812..148970)
FT                   /locus_tag="Hmuk_0147"
FT   CDS_pept        complement(148812..148970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46285"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46285.1"
FT                   /translation="MGVFDKARNVSHLGDADGDRPYLCMRCEATFQVQYHSCPACGGYD
FT                   VRRAEWV"
FT   gene            149473..151326
FT                   /locus_tag="Hmuk_0148"
FT   CDS_pept        149473..151326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0148"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: hma:rrnAC2119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46286"
FT                   /db_xref="GOA:C7NWE5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE5"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACV46286.1"
FT                   /translation="MDEDLLEALASLPTFHHATVSPDGNEVAVYYDETGRNELHVVDVA
FT                   TGERTRWSDGEVPRNARWHVEWGADGDRVFFHLDDDGNEQNDVYAIARDGSVEPVVQLD
FT                   GQTVLQDVGEDGETLLVGSTASGQMQLYRHDCATGETTQLTEYDRAVGAGVLSPDCERI
FT                   AYATNETDTFENTDTYVADADGSNQRNLEIGETGAEVGPVDWGPDGDRLLVTDNTADLG
FT                   RCGVYDLSTDEVTWYGGEFDEDAESFLPGGDRFLAVRTRECAKEVVVYDARTGAATTLD
FT                   LPSGVASLGRAGSAVVDEERIVCSHTTPDRRPELLCYDLATDETEQLIAADYGDLDPDR
FT                   FVDAEYFTFDSAGVAEFDDRAGQGVESDPASREIEALLYDSGERPSPAIVNPHGGPRGQ
FT                   DTRGFDLYTQFLCSQGYSVLKVNYRGSTGRGREFAQAIYDDWGGNEQADIATGTTILAE
FT                   KEWVDDDRIAVFGGSYGGYSAYCQMTMYPELYDAGVAWIGVTDLRDLYENTMPHYRTEL
FT                   LEKNVGSPEENPALYDERSPITHAENLAAPLLVLHGVNDRRVPVSQARLFRDRLDELGY
FT                   EAGEDGDYEYVELGEEGHASTDVDQKIRTFRTLADFLERRL"
FT   gene            151375..152448
FT                   /locus_tag="Hmuk_0149"
FT   CDS_pept        151375..152448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0149"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mes:Meso_2880 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46287"
FT                   /db_xref="GOA:C7NWE6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACV46287.1"
FT                   /translation="MRSVVVALVYETRATADGASPETATVERDEPGPELSVVVVTYNEA
FT                   ARIADCLDAVFEACRGVASFEVLVVDSNSTDGTVAIADDYDATVLRIPDDALTTPGAGR
FT                   YVGTQRARGDAVLFVDGDVVLTQGDWLVEARETLASDSSIAGVDGHLNERQTEAPTSVD
FT                   YLHGVALYDRESLAEVGGFHPFLTAWEDVDLGFQLTLAGYELCRLPTVVGTHPVPESSL
FT                   DQFRRWRRGYYRAGGQVCRKALRRPALCWRWLWYFRDKIATTAWLGLGALLAVVQPLLA
FT                   AGWLLATIAAAGLVCQRLGVDGGLRRAISAILFPLGFALGFEAVPDRDAFPLDAVETVR
FT                   RGSVCDAEASPRPSPTD"
FT   gene            complement(152553..153884)
FT                   /locus_tag="Hmuk_0150"
FT   CDS_pept        complement(152553..153884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ote:Oter_2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46288"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46288.1"
FT                   /translation="MSEIVVADVSIGERSIEYTVEYSRDLRRFFDRSTFSVSYDVDVSE
FT                   VPLGVATIPVLAQVCPVAWATDSTVVVEAVDRQFLDSLDAVRDTLSRMYPAFIDGGAIR
FT                   AERITEHRHEPGSFEGTAQLFSGGVDSLATYVRHREADPALIAIQGWVIGVDEDDRWER
FT                   AMGHVDRFAKREDCPTHGVTADISDFLDHTMLNVHYKHHTDGGWYSGVGHGIGLLGVCA
FT                   PLAYSQGYGVVHMGSTHWDGFELESITWPGRGSPWGSHPDIDDNVRWAGTRGHHDAFDI
FT                   TRQDKLELLADYARETGSPFVIRTCTYDDAGGNCNRCEKCVRTATGLLVAGVDPNDFGY
FT                   RVDEEWYDYAIERFETNDWALDEHVRYYWEDIQAHLPVEEPPDYDGTEEFLAWLADNDF
FT                   ADNVERSTQPAWVKLLRVGARNAPYEFYEYLYPVYDRLRPKPYN"
FT   gene            complement(154076..154930)
FT                   /locus_tag="Hmuk_0151"
FT   CDS_pept        complement(154076..154930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_1575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46289"
FT                   /db_xref="GOA:C7NWE8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46289.1"
FT                   /translation="MATIKSFVESFGVLRRNPILFAIGALYAVIVLPQTALSTFGIPIV
FT                   PWLFQIVTFFITPFVIAGLLAMAYEGRVRDTSFETFKKVGKDRYAPVLIGNLIQAVFSF
FT                   VYGIIAFIVAIFVVGFGAMAMADGGTGGTSDAMLGGLGIVSIVLIAGLVLFFLLVMFFI
FT                   QFYATAIVVDDVGVVDGFRNSVSVVLNNILEALGFGVINLVIGLLVAAPVFGLFLVPIL
FT                   TGGMGSGGMGSASAMDATQTGGLGATLLAQGGIVVYSLLSQLVLTPFRSAFSVSFYDNH
FT                   TEG"
FT   gene            complement(155038..155382)
FT                   /locus_tag="Hmuk_0152"
FT   CDS_pept        complement(155038..155382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP5336A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46290"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46290.1"
FT                   /translation="MRIPGDGTHAHRTETIEQAAERWHCNKTTALVQSAGFSRRIDERI
FT                   REVLARDDLTVRQRREAAETLRVPGTTRSTSRRRLLSIRSVSTSMATAMTADTIGYLPE
FT                   FIVVHRSDRR"
FT   gene            155706..156353
FT                   /locus_tag="Hmuk_0153"
FT   CDS_pept        155706..156353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46291"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46291.1"
FT                   /translation="MPYYGDISGDFRNLLNEDCEVVVVAVVGGTHHDCYRCPKRAVRNA
FT                   PQMDEAKWYDMKTVEKRRFMECLGENSPPLEFGYAVFELDDFTNLRSHYKLFQDVSFPP
FT                   IWDIAIRGIAYTEILYELSGDTNIEFYPDQFRSGVQTDKLCEVIENRLKKAEIECVSSE
FT                   QVDGVQAADCLAGAVAEEQKGGTPWLEHTNAESQIAECSSWTLIELERLLVS"
FT   gene            156685..157338
FT                   /locus_tag="Hmuk_0154"
FT   CDS_pept        156685..157338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46292"
FT                   /db_xref="GOA:C7NWF1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46292.1"
FT                   /translation="MYGKIDIEDALFGTIFAASAFVTNGIATINILGNDLGAAVWTVQG
FT                   TDITFAFLLTLVALFGAYATNRVNRSNGKSYEIDTDLANIARREGRRRDVPRARDGVAG
FT                   PRDWTERPRLTRRVGATGRRPATCPACDSGFRGTSPESGSADRMAEARANTALAVCHSS
FT                   AENGIRPPQFEQMPDVPARSLRSLRGSATGVFESCREMVHCSLSFAGKIRPPRP"
FT   gene            complement(157382..158431)
FT                   /locus_tag="Hmuk_0155"
FT   CDS_pept        complement(157382..158431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0155"
FT                   /product="integrase-like protein"
FT                   /note="KEGG: nph:NP5368A integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46293"
FT                   /db_xref="GOA:C7NWF2"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF2"
FT                   /inference="similar to AA sequence:KEGG:NP5368A"
FT                   /protein_id="ACV46293.1"
FT                   /translation="MSDDLEPLSPSEAVDLYIEARDDATEQTLQGQYYRLQAFIQWCDE
FT                   EGIANLNELSGRDLYAYRVWRREGGYSDEGKELKTVTLRGDMGTLRAFLRFCGDIEAVP
FT                   EALYEQVPLPKINPGQDVSESTPDPDRALEILDWLERYEYASRRHVIVLLFWHTGCRTG
FT                   GLRALDVGDCDLDGDRPGADGPAVHFVHRPNKGTPLKNKEKGERWNAISPHVAQILKDY
FT                   IDGPREKETDDQGRAPLVTTKSGRVSRSCCRDTLYRVSPPCWRGEECPHDKDPDTCEWT
FT                   HYSEMSKCPSSRSPHDVRSGRVTAHRLADEDRSLVSDRMNASEEILDKHYDRRNDRQKA
FT                   EQRRNFFEL"
FT   gene            complement(158428..158688)
FT                   /locus_tag="Hmuk_0156"
FT   CDS_pept        complement(158428..158688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46294.1"
FT                   /translation="MLEKKKTVRIESRSDRWRFVCPRGHRSWEPTNHHFWCASCARTEG
FT                   VDGEFHELHDRKTGNLREREQVRLVTPVGPYDRDLDGGDDE"
FT   gene            158912..158998
FT                   /pseudo
FT                   /locus_tag="Hmuk_0157"
FT   gene            159103..159354
FT                   /locus_tag="Hmuk_0158"
FT   CDS_pept        159103..159354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0158"
FT                   /product="phage PhiH1 repressor protein"
FT                   /note="KEGG: hsl:OE2445R phage PhiH1 repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46295"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF4"
FT                   /inference="similar to AA sequence:KEGG:OE2445R"
FT                   /protein_id="ACV46295.1"
FT                   /translation="MHRRVEWLKPSDRVIVAELAEYGGWMKPSSLALNISYTRRHIARR
FT                   CQVLAKHGLLERHDETAGYRVTEHGHQFLQDKLNEDDL"
FT   gene            160045..160563
FT                   /locus_tag="Hmuk_0159"
FT   CDS_pept        160045..160563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46296"
FT                   /db_xref="GOA:C7NWF5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46296.1"
FT                   /translation="MAAVSKSETKVLDPHIPKGEQLIEAYSGNEKTVAVTDRRIIDLWH
FT                   HEDDRSQETELRSTLLTNDYIVGTEYEREQESNTPDLERLIGFLLGVCGVGGILYGLDG
FT                   TGGAIFGGFVLLALSALIIYLTDTTESGEVEITLYRAGEVPNRTWTFPKGETGVPRAIS
FT                   EQVATLHRP"
FT   gene            160609..160866
FT                   /locus_tag="Hmuk_0160"
FT   CDS_pept        160609..160866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnB0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46297"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF6"
FT                   /inference="similar to AA sequence:KEGG:rrnB0123"
FT                   /protein_id="ACV46297.1"
FT                   /translation="MASATRDDRTDGVVFEQEADGSITAKDLETGLARGGDTRAEALAQ
FT                   LAEVLELEAGGGEPVTDDDLEAMGLDPDDEGDEELPDFMQ"
FT   gene            160873..161118
FT                   /locus_tag="Hmuk_0161"
FT   CDS_pept        160873..161118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0161"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: nph:NP7004A
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46298"
FT                   /db_xref="GOA:C7NWF7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF7"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACV46298.1"
FT                   /translation="MVRTTFSGREVVKVLRNHGFSPKSRTGSHVRLRYEHPETGEVRNV
FT                   DVPQHDEIHIGTIRSIADQCGANDFEAWCEWIDENS"
FT   gene            161297..161848
FT                   /locus_tag="Hmuk_0162"
FT   CDS_pept        161297..161848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46299"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2403"
FT                   /protein_id="ACV46299.1"
FT                   /translation="MLQSQNLFIGDEFSSKAGGSGKDGYLTRQKIGPLVYKIRKYNGLL
FT                   IYIAHDESSIHPLLWRLGVITKKVSKKKAVVADHVSNGQLRDKRFEVEGVPPTDWRYND
FT                   KEASSWSWTDEEDGEEPDPDEVAYDVALWTVRECKQDGLTHRETAQYVPFGKSWVGDRW
FT                   SEIQDGKHSGAMDRVRAITA"
FT   gene            162009..162401
FT                   /locus_tag="Hmuk_0163"
FT   CDS_pept        162009..162401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46300"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46300.1"
FT                   /translation="MSRSHKANHYGTLVERQAAERYNLELDRCSWHDAKRSDGTPVEIK
FT                   AAMHRHSDGQPGTFKLYDQYHEQLREANGWYVFFVYRVRGLGVEVLRWEMGHSSRLPKL
FT                   VWHGGGDHREAKQAKIAISLLTQNQK"
FT   gene            complement(162443..163075)
FT                   /locus_tag="Hmuk_0164"
FT   CDS_pept        complement(162443..163075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46301"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46301.1"
FT                   /translation="MADSIHIDLLYPADHEDEIIDTAAEIAESKNEYELFEKGVDLTGT
FT                   LRIIFARNDFDIELRATASPGRHQNGTVATFYVEGGRLDDATKLAEADNLASLIGAVKD
FT                   IYSAIESPPVMCYGVAPNQPLAAPTPDSRYPSSPRRFISWLDLYPPTEVEQIGRDTLLS
FT                   APAPRVEELDDGSILIVSKHPFSDDAIEDVADHIGIPFWGDDPGLVS"
FT   gene            complement(163870..164058)
FT                   /locus_tag="Hmuk_0165"
FT   CDS_pept        complement(163870..164058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46302"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2296"
FT                   /protein_id="ACV46302.1"
FT                   /translation="MYDAIEYADGGRDRFRDLRNVFANGRRTADKIDERRRWEQARDGF
FT                   DFEAWMEAGCPPDWSKG"
FT   gene            complement(164123..164368)
FT                   /locus_tag="Hmuk_0166"
FT   CDS_pept        complement(164123..164368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46303"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46303.1"
FT                   /translation="MVGVSQRATADAQLDTDQGVRNRSQYADTLHRQDPDSDEPRPACP
FT                   EADTRDEADFTDVPIAAYRPHYQLCGNPECFGRDWR"
FT   gene            complement(164535..164608)
FT                   /locus_tag="Hmuk_R0002"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(164535..164608)
FT                   /locus_tag="Hmuk_R0002"
FT                   /product="tRNA-Tyr"
FT   gene            164820..165413
FT                   /locus_tag="Hmuk_0167"
FT   CDS_pept        164820..165413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46304"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2001"
FT                   /protein_id="ACV46304.1"
FT                   /translation="MSKITFRADDDLIDQLEEFDASKSEVMREALREYLEAPDESPGAV
FT                   DASSGDGGDDSIDDLIVDRVDAIIEERLNGRLQPRSPQDVNVNITLEGENASREAVSDD
FT                   QSAVSHDRRRESSHASTDRKTAGREDDGAPTAGRKTCGQCGENVTGDHVYCPNCGEKAA
FT                   HRVFCDCGDELRSDWGFCPSCGRRTPAADVLENS"
FT   gene            165641..165829
FT                   /locus_tag="Hmuk_0168"
FT   CDS_pept        165641..165829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0168"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: hma:rrnAC2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46305"
FT                   /db_xref="GOA:C7NWG4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG4"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACV46305.1"
FT                   /translation="MERVTLRIPKQQIEEVERMVETGEYPNRSEAIRSAVREMLAEQEG
FT                   GKERPSEKRERRTYVRA"
FT   gene            165832..167025
FT                   /locus_tag="Hmuk_0169"
FT   CDS_pept        165832..167025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0169"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   hma:rrnAC2004 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46306"
FT                   /db_xref="GOA:C7NWG5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG5"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACV46306.1"
FT                   /translation="MQDIVKEALERDEAEQQQLSDADVDGFGDPRIVIVGCGGAGNNTV
FT                   NRLYNIGVDGADTVAINTDKQHLKMIEADTKILVGKSLTNGLGAGGDPSMGERATEMAQ
FT                   GTIKEVLGDADLVFVTAGMGGGTGTGAAPVVSKIAKEQGAIVVGMVSTPFNVERARTVK
FT                   AEEGLERLRNEADSIIVLDNNRLLDYVPNLPIGKAFSVMDQIIAETVKGISETITQPSL
FT                   INLDYADMTSIMNQGGVAVMLVGETQDKNKTEEVVKDAMNHPLLDVDYRGASGGLVHIT
FT                   GGPDLTLKEAEGIAQNITERLEASANVIWGARIQEEYKGKVRVMAIMTGVQSAQVLGPS
FT                   TQKQADKSREAIQEVGDDTSFDASQNVEEFDDQGGQSYGHTDGGRDTKEKNNGIDVI"
FT   gene            167226..169337
FT                   /locus_tag="Hmuk_0170"
FT   CDS_pept        167226..169337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE3178F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46307"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG6"
FT                   /inference="similar to AA sequence:KEGG:OE3178F"
FT                   /protein_id="ACV46307.1"
FT                   /translation="MVTDTTPSMTAVEAPYGLRLADPIEGAQFTLLTQRPVTPASIDPS
FT                   TFAPPVDTAAVITATTLETPYQVDALVRDDELSIVAECTSSERTAVGPGEYYVELSSAK
FT                   MKLYLYVEGEVVFEPGTDQVRLSFPGASELRVGVRSLHEQPAATITTTDDLEALATALS
FT                   QLGSALKTTSCERSFPTLRGHPPLIERGPELSVPAALSAPETGVTIEVPPRLDALLPIT
FT                   SLAYYLGATVEIGSRPMLHADGWSHSLDGDDGFETTVARVLKQVFLLDCVTRTEGMYDV
FT                   PLYERDRVEAAVDLDFPALYDQPLAEQVRQYLQVPYEAVAEAVPTWKLTADVVPESSAL
FT                   PVLPFLADELAVVRCPDDPTATDGAKADLSPKVTSFFDTSDRGGEAFVRSTATRSETAT
FT                   RGLDQTVFTPEPADSIEQTYVGEGIPLGASKMSVEEYDRRLEFDASSRERTRILVVCND
FT                   PQMSDENVVGDIYGTREWIEFDITTREQVTTDELADLLAADADFFHYIGHVDPDGIRCT
FT                   DGHLDAETLTEVGVNAFLLNACQSYSQGRALIDAGAIGGIVTLTDVLNKTATEIGRTVA
FT                   RLLNQGFSLLSMLGLLKKRNRLAQRYMVVGDGNETLVESESGTPISANITQDTSDGCRV
FT                   SVNAYPTKSYPMGSLVRPYITGEQKCYLNSGELNTFNVSVERLNDFLEMQLFPVISNDN
FT                   LYWSDEYSV"
FT   gene            complement(169341..169478)
FT                   /locus_tag="Hmuk_0171"
FT   CDS_pept        complement(169341..169478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46308"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46308.1"
FT                   /translation="MSQTQSVKDTLASHPKLIGMIFAVLLLLTQAGAAAGAAAATFAGP
FT                   "
FT   sig_peptide     complement(169359..169478)
FT                   /locus_tag="Hmuk_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.622 at
FT                   residue 40"
FT   gene            169716..170300
FT                   /locus_tag="Hmuk_0172"
FT   CDS_pept        169716..170300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46309"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46309.1"
FT                   /translation="MTENFDLGPAVADATNVLLVAPGVGDTADRLCCDVLTADGLPEHV
FT                   VGVTISDGPEEKATRWRELLGPAPSLSMLGIDGVTRSAAVQQAPTADDTTIEYLDSSEP
FT                   IRELGERIATKIHRETDTAVCFDSITDLQECMGRETAFEFLHVLGSRVRAGGATGYYYI
FT                   DRTVHDEETMTLYSTLFDAAIEVGSDTDGGN"
FT   gene            170353..170931
FT                   /locus_tag="Hmuk_0173"
FT   CDS_pept        170353..170931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0173"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: hma:rrnAC3308 HoxA-like transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46310"
FT                   /db_xref="GOA:C7NWG9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013971"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWG9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3308"
FT                   /protein_id="ACV46310.1"
FT                   /translation="MSNAAFDISVTDNVVLVCIDDDGCRQRVTAVLREEWPVRTAIDAE
FT                   AALDSLDEAVSVVVVDARDGIEQSIPRPQRDERPFELAALVDESVDGTDRAVECVTKPI
FT                   SPETLRATVERLQRRVEYDQLLGRYYAVASEYAAAASGHQREPEAVSELKGRLSAMRTR
FT                   LDELADGLDDHDAFSVALGAPDETEPPDE"
FT   gene            complement(170933..171202)
FT                   /locus_tag="Hmuk_0174"
FT   CDS_pept        complement(170933..171202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46311.1"
FT                   /translation="MVLVDGSNEILINRKASGGGTERLTGVSAMKAPLTTADVDGDCAT
FT                   EIVYVGTTNGKLRFVDDPLGTPSVEVLSDESANGVDGSDETGAT"
FT   gene            complement(171414..172412)
FT                   /locus_tag="Hmuk_0175"
FT   CDS_pept        complement(171414..172412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0175"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: hma:rrnAC2005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46312"
FT                   /db_xref="GOA:C7NWH1"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH1"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ACV46312.1"
FT                   /translation="MECDKCGAPAVMHAAYSGLHMCEEHFCRTVEKRVRRRIREDGLVP
FT                   RDATPEDPETWVIGLSGGKDSVVLTQILQDVFAEDPRIELVALSIHEGIEGYRDESLDA
FT                   SVTLTDDLGIRHEVVSYDEEFDVRMDEVVEDDPEGMAACAYCGVFRRDLLSKYADELDA
FT                   DKLLTGHNLDDEAETALMNVLEGDVTQIAQHFDSSLGPFDADGDGPADRERPETDQHIP
FT                   RAKPLRDIPEKEVALYARFEELPAHITECPHAEEAYRGEIQDLMLGLEENHPGTRHSIM
FT                   AGYEKLAALAAEAYRSEDDRDADFGECENCGAPTGRDRCRKCNLLDALEAV"
FT   gene            complement(172451..173155)
FT                   /locus_tag="Hmuk_0176"
FT   CDS_pept        complement(172451..173155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46313"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2006"
FT                   /protein_id="ACV46313.1"
FT                   /translation="MEFHTFGEASDPDCLFVLGWGNRPAHEPVRWLIDRIAADGWQVHT
FT                   ATLPPHVTDVSEQWVRPVESYAADLDDPAVLAHSAGGLTVAHADLDAVTTTYLSPWWGD
FT                   PPSRQGPIVDLFASIPGNAKLLPSGVSDRSLIGEHATDEQLADGPDRVSPAFLRATKRA
FT                   HRTLPESDDEAVVFCSLTDRVVSTRAIGQRMPAARTVLYDGGHELFSSRSRDEHVPTLL
FT                   SALERGRDAVVS"
FT   gene            complement(173222..174283)
FT                   /locus_tag="Hmuk_0177"
FT   CDS_pept        complement(173222..174283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46314"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2007"
FT                   /protein_id="ACV46314.1"
FT                   /translation="MTDLREPFLDLAEWTADTSPLYERLCRIVADEPELLTLAETVPAD
FT                   RAVANVFLAAVHCVVRRGVDHPLANYYSSVTDDPRPPDGDLGPALRDFCRTYAGALRPL
FT                   LTDRRTQTNEVGRCAVLYPAIAHVTAQTEGQIALVEIGPSAGLNLALDRYGYAFRGRDL
FT                   DEDVRRVGRSDAPVTIRATVEEGTPPLPVDPPGVHSRVGVDLNPMDVTDEADVEWLGAL
FT                   TWPEHDQRRAALSDAVAVARRDPPRLIEGDAIDELPRILDTIPADVPVVVYSTLVLYQL
FT                   PDEVRANLRDLIATRARERQLHWLTGSGAFDDPGDGLDLRWHRSVAGTLTTDRLARYHP
FT                   HGQWIEWHADGDR"
FT   gene            complement(174347..176020)
FT                   /locus_tag="Hmuk_0178"
FT   CDS_pept        complement(174347..176020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0178"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG: nph:NP0142A
FT                   signal-transducing histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46315"
FT                   /db_xref="GOA:C7NWH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46315.1"
FT                   /translation="MSAVVAPLFMCSVAKLPTMRLRRRFLVAFLVLTVVLSVLSLAGFT
FT                   LYRDATIAQEEAALERVSETMASQLDVLLTEKGQTVGLWTETPALADHHSQEQAESVRS
FT                   FVLSTSFSGASVIAANGTMTALYSEGTAPAQSRALVGQQFGNREYFQRAMAGETYVSEP
FT                   VSAESGNRIVTISAPIHSDGSIVGTFNAAFHVRRGDFLAPIRQEQSTASGVLVAANGTT
FT                   LYQRGPQPGDEGAVAVANATVDRTDWTVSTTRTESAVRSELQSITLLGLGTLGLVLASL
FT                   SVFGWWLYREYVANFERLQGGLNALVAGEYGTTVSLSGPTEWTNVAKHFNELSETLARR
FT                   RVEVTVLNRVLRHNLRNAMTVVSGTAARIEESAEEERLIEDATLIKRRGESLLKLADHA
FT                   RIVETSLRTDRSESPPRPIGPLVEETVADLRAEYPDATVATESSSETALVPDGDLVSVV
FT                   ADELIRNAIIHDCAEPTVSIDVTTTPERVSITVDDDGPGLPDVERRVLTESFVETPTDH
FT                   GSGLGLWVVKWVVEWLDGTIAVTVDDGTTVTITLPRVREE"
FT   sig_peptide     complement(175892..176020)
FT                   /locus_tag="Hmuk_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.744 at
FT                   residue 43"
FT   gene            176049..176702
FT                   /locus_tag="Hmuk_0179"
FT   CDS_pept        176049..176702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46316"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH5"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2009"
FT                   /protein_id="ACV46316.1"
FT                   /translation="MSELAREAAIDRAVEIVDAVAEQTMPVPVREVWVYGDVALGLDPI
FT                   DRLDVYLTKDILLRDDADREPEFRERLGVEGVGKTVRAAWADEYPEYVRANASGHAAPE
FT                   QCLAAHLLEASEPIHLEVCNASFEDNVTQRLKGARARGNYKQLLDPRGVCLWAEGQRSD
FT                   SAVRKLRESELAFPTLSGALETLGMDPAEADEAADAVREYRERQDGRTVRGDVV"
FT   gene            177228..177644
FT                   /locus_tag="Hmuk_0180"
FT   CDS_pept        177228..177644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46317"
FT                   /db_xref="GOA:C7NWH6"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2011"
FT                   /protein_id="ACV46317.1"
FT                   /translation="MSQSLHLAIRTVHVLAMALLVGGAAGLWAAARRRVDDLHVLAKRY
FT                   EWLFWAALGVLVLTGVGNLGALGAPGPGTRWGQTLLAKLVVVALFVLGSAVRTLALTRT
FT                   DRSTPLAAWSRRAYGLTTVTLLALVVLAEVLAHG"
FT   sig_peptide     177228..177317
FT                   /locus_tag="Hmuk_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.991 at
FT                   residue 30"
FT   gene            177637..178161
FT                   /locus_tag="Hmuk_0181"
FT   CDS_pept        177637..178161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46318"
FT                   /db_xref="GOA:C7NWH7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2012"
FT                   /protein_id="ACV46318.1"
FT                   /translation="MAETAAASRRTRETIGRPTTTLTAWTLATTNTVGFVLAVLVPAYA
FT                   SGGLSDVLPSLNTAVGVAGFLALWLVVGATTHWLLGHVDPSSDSPVRLTLWAGSCGALA
FT                   GIVFLVGIVVGLGVPAAVVGSFGLQTVVLLAATGTPVAAIVGAVVGIAAGLLDVVLLRI
FT                   ADRVTPPSDRQ"
FT   gene            complement(178136..178927)
FT                   /locus_tag="Hmuk_0182"
FT   CDS_pept        complement(178136..178927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0182"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: hma:rrnAC2014 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46319"
FT                   /db_xref="GOA:C7NWH8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV46319.1"
FT                   /translation="MRRFDADYLERTRRGMWGDSREALADLELDTAQRVLDVGCGSGEL
FT                   TAVLREESPGDVIGVDADETLLSTVPQPVVRGDATRLPVADDAVDIVVCQALLINLPEP
FT                   AVALAEFARVASDRVAVIEPDNSAVSVESTVDAEPTLARRARRLYLDGVDTDVALGARA
FT                   ADLFPDAGLDVVSTRRYDQRLTVTPPYSEAALTAAQRKATGAGLADRADVLAASVPDDE
FT                   FDRLRDAWRSMGRDVIDQMGAGEYERTETVPFFVTVGLTGE"
FT   gene            complement(178965..179708)
FT                   /locus_tag="Hmuk_0183"
FT   CDS_pept        complement(178965..179708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46320"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWH9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0793"
FT                   /protein_id="ACV46320.1"
FT                   /translation="MTVDTEVFERDAILDRVRELADSAVSEVALSVPHTVLPELDATLS
FT                   AAVDRGLLVLVLVWDPPHDERSKHELPSLAGRSTVARRSQDIAPVFCCVDNERGLIGNG
FT                   SSITDDGSDDVATTFDFQEVAHGLYRDFVTNFWMFASEIHARAVPELPVAYDGIRHAVT
FT                   NVALCLRDEVAIRCRATGRDPETGAKRTVDGRVLNVHQRMVYPASSSLPIENSILVEDD
FT                   GRQWIGGPHAVLEDVAAERLSLRRA"
FT   gene            179801..181336
FT                   /locus_tag="Hmuk_0184"
FT   CDS_pept        179801..181336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0184"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: hma:rrnAC0794 HTR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46321"
FT                   /db_xref="GOA:C7NWI0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46321.1"
FT                   /translation="MDEGTTVLYVGGYGSTEPRDHLEAAGFEVESVVGAADARAAVREN
FT                   RSIEVCVTRYEVPRADGIEFQGGLAVVDAVEAERPSLPVILFTRMANRDVAREVSGRDL
FT                   FDYIPIQSGDAPYDRLVRRTRTAASRYRTDRRVEQLSRINEIVRDVNRELVRADDRAGV
FT                   ERAVCEELTQRGAYEFARFEGGEETTAHGDEADGETVDPDALANHLGASGPGVVDLDER
FT                   WQPYTAGIVVPVAIDGVEYGRVLLCTTRPDALDETEQEVLGELGETIADALDAIETQQQ
FT                   LAVRERELAEQNRRLERFASIASHDLRNPLQVADGYVQQLREESDDERLDEISQALGRI
FT                   GTIIDDVLALARTGDGAMTKTAVDLTAAVERAWETVDTGGATLECAVSGTVRADEDRLA
FT                   RLFENLFRNAMEHGFTASATQNRRDGESSRDLTVRVVPTENGFAVEDDGVGIPREKRES
FT                   VVELGHSEGGGTGLGLAIVARIAEAHDWTVTVEESDAGGARFVFAVGEPVSGA"
FT   gene            complement(181462..182292)
FT                   /locus_tag="Hmuk_0185"
FT   CDS_pept        complement(181462..182292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0185"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: hma:rrnAC2015 endonuclease IV; TIGRFAM:
FT                   apurinic endonuclease Apn1; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46322"
FT                   /db_xref="GOA:C7NWI1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI1"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACV46322.1"
FT                   /translation="MRVGAHTSIAGGAYNAVDEQVDYGGNCGQIFSHSPQVWQDPNIED
FT                   EEAEQFRERSDEHGVGPWVIHSSYLVNLCTPKDDLRAKSIDSMQKEVDAADTLGVEYVN
FT                   VHLGAHTGAGVEGGLDNAASALDELTIPDGVTVLVESDAGSGTKLGGEFEHLAEVLDRS
FT                   EQDLEVCVDTAHAFAAGYDISTADGVAETIAEFDDVVGLDNLACIHLNDSKHECGTNKD
FT                   EHAHLGEGYIGEEGMAALLTHEALEDVPFVLETPTEDGRGFEWNIERARELGNA"
FT   gene            182373..182663
FT                   /locus_tag="Hmuk_0186"
FT   CDS_pept        182373..182663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP4084A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46323"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI2"
FT                   /inference="similar to AA sequence:KEGG:NP4084A"
FT                   /protein_id="ACV46323.1"
FT                   /translation="MPADALPPDVYAVLDQLLTEASRAVASGDHETASSAVDSAATVTE
FT                   NKVPPGPQRRLLDHCCETVTDLLEAEDTDAALIREYLRATSERLVVEAGGS"
FT   gene            complement(182750..183580)
FT                   /locus_tag="Hmuk_0187"
FT   CDS_pept        complement(182750..183580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0187"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   hma:rrnAC2019 lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46324"
FT                   /db_xref="GOA:C7NWI3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI3"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /protein_id="ACV46324.1"
FT                   /translation="MTDLGDLSWRFVDERAHDGATNMALDEVTAEMVADGGLATVRLYR
FT                   WEPSTLSLGYNQDPATIDWDYCERQGITVTRRPTGGGAIYHDTDGDISYSIVVPGDAVP
FT                   GDLLACYELLCEPILDAFEGIGVDAAFATDERPAVYQPACYLRALHPAHDVVGPDGRKI
FT                   SGNAQYRQRDAVVQHGSLTFETTPARHCACFTGEPEPDAFADRVGGIEEYVDRSRSAAV
FT                   ATLRDTLREWVETTLGGTVAETSWPEEISSRARERASEKFETDAWTHERTDPTA"
FT   gene            183697..185328
FT                   /locus_tag="Hmuk_0188"
FT   CDS_pept        183697..185328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0188"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   hma:rrnAC2023 NADH dehydrogenase I chain C D"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46325"
FT                   /db_xref="GOA:C7NWI4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI4"
FT                   /inference="protein motif:PFAM:PF00346"
FT                   /protein_id="ACV46325.1"
FT                   /translation="MQRATRASTEPLSVLPESAVVGTEDHENAPAIVVRADAVESVLST
FT                   LKTEAGYDHCACVTAQEYGDRFETIYHLRTYDDPTDELSVVVPTLHDDPHSESGAGVYE
FT                   TAAWHEREAYDLLGITYEGHPDLRRILLPETWQGHPLRESYNQDKPQIVPFREHERILE
FT                   DRRSGPDTMHLNMGPHHPSTHGVLHLRVTLDGETVADVTPEIGFIHRCEEQLCQQGTYR
FT                   HQIMPYPDRWDWSGAGLLNEWAYARAAEDLIGVDVPEYAQVIRTMSAELSRILSHFLAI
FT                   AAYGLDVISEFTAVFQYGIRDREIVQDILEDLTGQRLMFNYFRLGGVAWDLPEPRETFC
FT                   ETVRSFLDDLPQKLEEYHDLLTGNEILQMRTVDTGVLPPETAKAYGCTGPVARGSGVDC
FT                   DLRRDDPYGYYDELDWDVVTEDGCDNFSRVLVRLREIEESAKIIEQCVDLLEEWPEDDR
FT                   TIQGNVPRTVRPDRDAEIYRAVEAAKGELGIYIRSDGTDTPARFKIRGPSFSNLQSLPE
FT                   MAEGEYIPDLVASIGSLDTIMGEVDR"
FT   gene            complement(185306..185752)
FT                   /locus_tag="Hmuk_0189"
FT   CDS_pept        complement(185306..185752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46326"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46326.1"
FT                   /translation="MDTKPVCPLGFVDQMVQLGEAILERPEILAQIPAMMAQQIREQQA
FT                   DRNPFDRGEQYFAEFAAGWSLGYSAGTILPAAASGGGSLAGKVAGQSRKFQKLLDAADL
FT                   AVPDRVPNGVRLGVLRRAGVIDDRLFECSGTSRLPRTLTGRLRP"
FT   gene            185771..186301
FT                   /locus_tag="Hmuk_0190"
FT   CDS_pept        185771..186301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0190"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: hma:rrnAC2024
FT                   methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46327"
FT                   /db_xref="GOA:C7NWI6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI6"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ACV46327.1"
FT                   /translation="MSEPQTATVAGGCFWCTEAVFKQIEGVESITSGYAGGHVADPSYD
FT                   AVCSGETGHAECVQVEYDPDVIDYGDVLTVFFATHDPTTKNRQGPDVGSQYRSAVFYHD
FT                   EAQRETVEAMIDDLGDQYSDPIVTEVEPLETFYPAEQYHQDYYERNPDQGYCAVNIDPK
FT                   LEKLNEQFRELLA"
FT   gene            186298..186720
FT                   /locus_tag="Hmuk_0191"
FT   CDS_pept        186298..186720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0191"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   hma:rrnAC2032 thioesterase of unknown specificity"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46328"
FT                   /db_xref="GOA:C7NWI7"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACV46328.1"
FT                   /translation="MSFEFTTTVDVRYNDLDTYGHVNNALYGTYVEEARVDYLETVVGG
FT                   AAADITGSGEETGMVVANLQLDFERPIRLADEVTVGVRVPRLGEKSFPFEYEIRTADGE
FT                   VAATGETTMVAYDRGQGSSVPIPDSWRESIGEFEGL"
FT   gene            complement(186717..187070)
FT                   /locus_tag="Hmuk_0192"
FT   CDS_pept        complement(186717..187070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP4922A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46329"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI8"
FT                   /inference="similar to AA sequence:KEGG:NP4922A"
FT                   /protein_id="ACV46329.1"
FT                   /translation="MTLPAERRPVNGPDDTEPPSNDPTISCRRCGREWDLGEELDAVGN
FT                   QAFEQFALDHRHHTGHFPDGVATWRVECRHCPETVERIEEGGAKRWAHTHVRHTNHAVT
FT                   IHGTDGTERVLEP"
FT   gene            187126..187797
FT                   /locus_tag="Hmuk_0193"
FT   CDS_pept        187126..187797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46330"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWI9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1636"
FT                   /protein_id="ACV46330.1"
FT                   /translation="MDERSSRFRVYRVVEAVPHINLFDTDGTRLYTTYQQGYGERQPAI
FT                   DGLETGDLIEGRVAGDPTDEEEAWTLREFDRIDGVDMGFATDVELPQIARETWDTQSRG
FT                   PAHSVIEADGQPVGECWVQPRSPLPGGSFVPSVLAGLLPMEEKLTTVVSADAPTTDAVF
FT                   LDPDPVDAASFSQPYGVLLLFSERAGARRERYRERFDCPRGTDSRPEYDPYDPSTGGFG
FT                   P"
FT   gene            187915..188340
FT                   /locus_tag="Hmuk_0194"
FT   CDS_pept        187915..188340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0194"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: hma:rrnAC0758
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46331"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ0"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV46331.1"
FT                   /translation="MDSTNGRDILGHVLVPVATDDDALATARALEPYDPDDVTALHVVE
FT                   KGDGVPDKTSVEQSEEVAEASYAAVRSVFPDADEHTAYGRDVVQAIFAAADEVDATSIA
FT                   YRSRGGNRLMQFLSGDVSLKLVTKATRPVIALPHNDE"
FT   gene            188333..190570
FT                   /locus_tag="Hmuk_0195"
FT   CDS_pept        188333..190570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0195"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; UspA
FT                   domain protein; KEGG: nph:NP0042A transporter system 1
FT                   (substrates cationic amino acids), subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46332"
FT                   /db_xref="GOA:C7NWJ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ1"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACV46332.1"
FT                   /translation="MSEEELAKDLGPLAALTIGVGTMIGAGIFVLPGEAILKSGSLAPV
FT                   AFVLGGVIAMFTALSASELGTAMPRSGGAYYYVNHALGPLFGSVAGWANWLGLAFASAF
FT                   YMVGFGRYIARIFGLSGSVGVGPVSITVVKLTALAGGAFFILINYVGAKETGRLQNVIV
FT                   VLLIGILTVFTFLGTLRAEPSNLPAATDVVTTLETTGLIFVSYLGFVQITSVAEEIKDP
FT                   GKNLPRAVIGSVVIVTVIYALVLVIMSAAVPQGFIADIISSDAENPIAVVEVGNYIQGA
FT                   LMGGALLFGGLLATASSANASILASSRINFAMGRDRIVTPALNEIHPRYGTPYRAISIT
FT                   GGLILLFIVIGDITLLSGAASGLHLIIYGLLNLALIVMRYVNPEEYTPEFVVPLYPLLP
FT                   ILGVVFSFALLVFVAEDALLLSFGIAAAAVLWYGLYARSRTEKQGILSKHIISRSDEMP
FT                   DAAVSAAVGVQPDGGQYRVMVPLANPENEQDLITLASAIAKQRGGTVVATHIVTVPSQT
FT                   ALAAAADRSDEIDKTSERLLANAREDAETFGVDVETNTIVSHKSYEAIFDAARSQTADL
FT                   VVMGWGPDAHGSPGRAESAMDELTESVPCDFLVFRDRGFDPSRILLPTAGGPDSELSAT
FT                   VAKLLQAEYDSEVTLLNVDENREAGAQFLEEWAVEHGLTDAERLVKSGDIETAIRNAAD
FT                   DATLLLIGATEEGLLRRLVSKSLVLDVVDDVECSVLLAETHRDRGLLERLF"
FT   gene            191012..191917
FT                   /locus_tag="Hmuk_0196"
FT   CDS_pept        191012..191917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0196"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; RIO2 kinase,
FT                   winged helix domain protein; SMART: protein of unknown
FT                   function RIO1; KEGG: hma:rrnAC2036 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46333"
FT                   /db_xref="GOA:C7NWJ2"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ2"
FT                   /inference="protein motif:PFAM:PF01163"
FT                   /protein_id="ACV46333.1"
FT                   /translation="MVQNVAREMADLEPEDFHLLSGVEQGMRFSEYVDREKLPQFSRLT
FT                   AEDVDYRLDRCEDRGFLERKTMQYEGFKLTFEGYDALALHALVERGTIEGFGAPLGVGK
FT                   ESDVFEVSSYKPMALKFHREGYTQFREVNKEREYTADRDHVSWQYTARKAAEREYDALE
FT                   TLYPDVRVPQPIDTNRHAIVMEKIDGVELSRTKLDDQQVRPVLELILTEMGTAYDDGYV
FT                   HADMSEYNVFVGTDGITIFDWPQAVPADHANADELLARDVENILGYFQRKYPRFVDDIE
FT                   VDAVADALLAGEFESLSDHD"
FT   gene            complement(192531..193415)
FT                   /locus_tag="Hmuk_0197"
FT   CDS_pept        complement(192531..193415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46334"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3098"
FT                   /protein_id="ACV46334.1"
FT                   /translation="MELRDAALKAGVFVAVFLVVATLTGLGSIPVPVDGNETAPLTVQS
FT                   HQPEAILADSSAEAGEIEPDATASEKTVVIDQSHNNSVAPGDISPLVTSLTAAGHDVQF
FT                   YTDAMADRQSLGETLSDADAFVVIAPNDQYNESERRRVEQFAEDGGRVLLVNEPPRQAA
FT                   RGATASTPMTNLAGVFGLGFDGGYLYDLREYDTNHRAVYATPASETALTEGVDRVTAYT
FT                   ARPVVGGSSLLDTNESTALSTTRRQARYSVLARQGNAVALGDRSLLGTDYAYTADNEVL
FT                   IGNLIEFLVSGSR"
FT   gene            complement(193402..194325)
FT                   /locus_tag="Hmuk_0198"
FT   CDS_pept        complement(193402..194325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0198"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; Enoyl-CoA hydratase/isomerase;
FT                   peptidase S14 ClpP; KEGG: hsl:OE1934R proteinase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46335"
FT                   /db_xref="GOA:C7NWJ4"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ4"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACV46335.1"
FT                   /translation="MANPIDNYVKTLLTSYTVIIVVALLIGAAVGPAVSSALFQSDDEG
FT                   TIAAVTIQGPISGPTADEVTRQLRTLRTDDSIDAVVLRIDSGGGSVAASEAQYRAVKRL
FT                   AREKPVVTSVRGVAASGAYYTALPSDEIYATPGGLVGSVGVRALIPQPDGVPRSVTTGP
FT                   DKAGGLTGDDIRGQVETLKRSFVDSVYAERGDRLSLSRTELTNAKVYSGAAAVDNGLAD
FT                   EIGGLETAIAAAAEKAGLDSYDVVYRSTTPGVLSLLLGSDANSTDAGQVDRASLLTTRG
FT                   IERPQYLMLWGDLNTSAREVRASGAA"
FT   sig_peptide     complement(194218..194325)
FT                   /locus_tag="Hmuk_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.332 at
FT                   residue 36"
FT   gene            complement(194377..195342)
FT                   /locus_tag="Hmuk_0199"
FT   CDS_pept        complement(194377..195342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0199"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: hma:rrnAC2056 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46336"
FT                   /db_xref="GOA:C7NWJ5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWJ5"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACV46336.1"
FT                   /translation="MSEVLVSDDPMLDPSALADALPDATIRTEPLPDEHAIVEAARDAA
FT                   ALVVDVNTPVPAGVFEQLPALQIVARAGVGFENVDVEAAAEHDVVVTNVPEYCTDEVAT
FT                   HGLALLLDCVRKIAEYDRATAAGEWAWEDGRPVHRFPDTTLGLVSFGPIARRLRERVRG
FT                   FDLDVIAYDPYVDPEEMAAADVEGVSFEELLARADHVSLHAPLTDETEGLIDADALGAM
FT                   RDHAIVVNTARGGLIDEAALTDALADGAIGAAGLDVSRREPPADDSPLRALDNCILTPH
FT                   AGWYSVEAREELNETVARNVAAALDGETPPNRIDPDLDWL"
FT   gene            complement(195496..196827)
FT                   /locus_tag="Hmuk_0200"
FT   CDS_pept        complement(195496..196827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46337"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2239"
FT                   /protein_id="ACV46337.1"
FT                   /translation="MRRVAALALLVVLAGCLGAVNDLNPADRDRQADEDQIGWEDGYWY
FT                   DDSVSVTTADGLNASERAAVLARSKARVERIRDREFDGNVSVEVISRAEYRNQSRGPGG
FT                   TGPDDPWNDQVWEALLLVGEDSGTSEAMGETYNSSVQGYYSPASDNITIVSDSPTPTID
FT                   RSTLSHELVHALQDQYDNLESSPETQDRQLAQQSVTEGEANYVQWTYEDRCENRWQCLS
FT                   PPGGDGSGESSGGGAPTDGVFVTIYQPYATGPGLIDQQYGRNRWDGVERLYENPPDSTE
FT                   QVIHPDRYPDEEPVNVTVPDRSSDEWERFDHEPVADTAGEASIFAMLYTNDAVEPEQWF
FT                   RYRSDASAGWGGDSIVPYRDGSGGYGYVWTIEWDSPGDAREFEAAYTSILDDKGAARPT
FT                   ETVYRVPDSDAFGDAFRVTRSGSRVRIVNAPTVDDLDDVHERPS"
FT   sig_peptide     complement(196762..196827)
FT                   /locus_tag="Hmuk_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.492 at
FT                   residue 22"
FT   gene            complement(196820..198277)
FT                   /locus_tag="Hmuk_0201"
FT   CDS_pept        complement(196820..198277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46338"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2237"
FT                   /protein_id="ACV46338.1"
FT                   /translation="MYRAALLAALLVLAGCQAPSAGPSAASPVHETTGTDAPEPTATPT
FT                   SVDTDDGPPDPETDRIGWENGYWHNESLDVTNSDGLNESEREAVVARSMARVESVRERE
FT                   FDETVPVSVIDRSTYRNRSTPASNATSARFDNGKFEALFLIGEDRDALAAQNAALSQSV
FT                   LGYYSPARDEIVIVADSETPQLDGEATLAHELVHALQDQQFDLTNGTVTTRDAYQGRNG
FT                   IVEGDASFVERRYTANCGATWSCLDSADSTQSGGGDSHFGLNFLQFFPYSDGPGFVEHR
FT                   YEAGGWAAVDAAFADRPDGATEVIYPEQYPEWEPATVSLPDRSNDEWERVRPPGRADYA
FT                   VVGQSAIAASLAYTVTDDYEDASVVRARDVINFEADGKVDGDDPYNYDVPAARGWAGGK
FT                   LFVYENGERSGYVWRTRWTNESEAAEFASTWSAVVRHWGGEETEENVWTIGEDSPFTDA
FT                   VRIERSGATVTVVDAPDAAALEAVHDA"
FT   sig_peptide     complement(198197..198277)
FT                   /locus_tag="Hmuk_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.586 at
FT                   residue 27"
FT   gene            198362..198934
FT                   /locus_tag="Hmuk_0202"
FT   CDS_pept        198362..198934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0202"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: hma:rrnAC2236
FT                   isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46339"
FT                   /db_xref="GOA:C7NWX4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX4"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACV46339.1"
FT                   /translation="MEFEPARTALVVVDMQNGFCHPDGALYAPDSEAAIEPCRELVERA
FT                   REAGASVVFTRDVHPPEQFEDAHYYDEFDRWGEHVIEGSWETELVAQLEPAEDDLVVVK
FT                   HTYDAFYETQLEGWLDAHGIDDLVVCGTLANVCVLHTASSAGLRDFRPVLVEDAIGAIE
FT                   DDHREYALDHADWLFGEVTERGEITFA"
FT   gene            complement(198935..199777)
FT                   /locus_tag="Hmuk_0203"
FT   CDS_pept        complement(198935..199777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX5"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2234"
FT                   /protein_id="ACV46340.1"
FT                   /translation="MAVTLPADVCHQYDRFSLYNSPFVAHDDGRAIDLYPSGAVAPSPV
FT                   AGTVVETKQVRAPPQPYAAEHDYLLLIDTGEWMARLLHVEPSVVPGDEVGVGDPLGETV
FT                   RAGFFAPWVPDHVHLEYRDHETNPYRADGSEPLAVAVDVEPLPWDGTGTVVDTGATWAR
FT                   LDAPAHPAPGERFVGLANGGPDDGRGGVVDGGLAHYDAGGLLGHSPSDATERAVVVAGA
FT                   PVGTATGRTVAWDDVTVLANGDPITGLALFCARDRFGVKLVGDGVDFQEGEDVTVECR"
FT   gene            complement(199979..201061)
FT                   /locus_tag="Hmuk_0204"
FT   CDS_pept        complement(199979..201061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0204"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2346 maltose ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46341"
FT                   /db_xref="GOA:C7NWX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46341.1"
FT                   /translation="MSLLSTVGRKLVEDTRNVLLTPVEAARDIRYTVRGVRNGEIPPTD
FT                   PLKTVGATVGALLLVLLLLFPVYWILQAALSGTGASLYSSNGLSLLPEDPTLQPFIWVI
FT                   GDLVVPAYNVTVDIPLTGQSLVFSTPELTFLDASAHGVDRPSQFKHFLWNSVTVAIPTV
FT                   IISMCLIVPAAYALSRREFIFRRKILFLYVLMTQVGGGLGIALLIGLYAIYVQFGLNDS
FT                   KLALAVYYAATAVPFNTWLLKTYMDGIPVSYEEAAVVDGAPPWRVVTEVIIPLSTAGLA
FT                   TVLIFTFLTGWTEFVVAQTLLTTENYTLPVGLYALIDEYSIPWARFSAFALTFATPIML
FT                   VYLFAQRYIEGGLSFSGMEG"
FT   gene            complement(201058..202023)
FT                   /locus_tag="Hmuk_0205"
FT   CDS_pept        complement(201058..202023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0205"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2347 ABC-type
FT                   sugar transport systems permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46342"
FT                   /db_xref="GOA:C7NWX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46342.1"
FT                   /translation="MRTVSRLTQRVERIPFIEQEDYSLLFVLPGLFVFAAFMLFPVLYL
FT                   VGLSFTDAAPANLFAGEGSFAVLTFGEATFVGLKNYTDVLADPEFWNSFGVTWLYVATS
FT                   VALKLGLSISVAMVVTSDRVRGRRIMRSLIILPMGLPAIFTITVWRSMFSSADFGLINQ
FT                   LFEQFGAEPVAWLSTRWPAFFAYNVTEMWLAYPFMVIITVSALQDVPEELHEAATVDGA
FT                   GFLARFIHVTLPSIKRPVLFAAILTAAASFQQFLIPFVFNQGGPARANELIVVYGYREA
FT                   LSFSQYGRGAAISLIAVVFIGVFMWINVKRGKLADGVSDE"
FT   gene            complement(202032..203333)
FT                   /locus_tag="Hmuk_0206"
FT   CDS_pept        complement(202032..203333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0206"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hma:rrnAC2349 maltose ABC transporter maltose-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46343"
FT                   /db_xref="GOA:C7NWX8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV46343.1"
FT                   /translation="MYDYFINRISMGFDRRTLLKHIGATGTIAAVGGCVGVEEQGTDAD
FT                   AGGGESSNGTDSTTEEPAGSATAWYGLSDTELELREDIIAAFNEESSHTIKGGNIAEMQ
FT                   DRTTSAIPAGQGPETFQWAHDWVGDYYERGFVVDQSDELSVDLDQFTSAAAGAVQTDDA
FT                   IVGLPFSAETVTLIYNADIVDKPPETFEEMAASMEAYHDSANGKYGLAMPFNPYFISGI
FT                   AQAFGGRYFDPESDPVVGLDSEETVRGFEFMLDNLVPYMPNDPGFEPQQATFAEGNAAF
FT                   AVNGPWYLATLNDSDINYEVTTFPSMDGGEFTPLSGIKMWYFSKAMEEGDVDATAGREF
FT                   IEWFVTNEDHLLTRAEEQGHIPVLSSLAGSDDLPGPVRAYSEAVDQGIPMPTDPRMSDV
FT                   FAALEEPVVQIFNGSQSPAQALAGAADEARSNWE"
FT   gene            203552..204679
FT                   /locus_tag="Hmuk_0207"
FT   CDS_pept        203552..204679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0207"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: hma:rrnAC2352 sugar ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46344"
FT                   /db_xref="GOA:C7NWX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWX9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46344.1"
FT                   /translation="MATLRVDSLRKEFDNGRIVAVNDLSLDVADGEFVTVVGPSGCGKS
FT                   TTLRMLAGLEQPTDGKIFIDGEDITDVHARSRDVAMVFQNYALYPHKTVRQNMAFGLRM
FT                   STDLSSDQREEKVRETAAMMDIEELLDDKPNALSGGQKQRVALGRAIVREPDVFLFDEP
FT                   LSNLDAKLRTTMRTEIQRLQDELGTTSIYVTHDQEEAMTMGDRIAILDNGILQQVGSPK
FT                   HVYQNPVNEFVGTFVGSPAMNMLDVSVSTGDSVCLTNGDRFAYSLDGPVAQAVADAEVD
FT                   SARLGIRPEDVAVSREPAESDIRAVVEVVEPIGSDNYLYLDLGESFIARVAADIEPTRG
FT                   DTVGVQFDESDIHLFDTYGFSILSEKETERSPVTA"
FT   gene            204904..205962
FT                   /locus_tag="Hmuk_0208"
FT   CDS_pept        204904..205962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0208"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   hma:rrnAC2354 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46345"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY0"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ACV46345.1"
FT                   /translation="MDDSTLSERLMQLGLSEKEVDTYLTVLEQGELTASEISDVTGVSK
FT                   RYVYSISESLEERGFVDVDDHVVPTKVRARNPSEVIELLTDELTEMEPALSERHSQTER
FT                   NLQRFDVLKSRQTMIKRIRSYIADASNEITLSISYEQLPEVEDELRAAVDRGVLAMVLV
FT                   TGVPANSLEAAAFDGIATLVRTWDQITPLTLTVDQQYSVLAPVDMMVRSNSELRAISLV
FT                   QRQLVPILTGSFFGNYWPIAAEVYVDDPRSLPAEYGCFRHAVLDATLHLRDDRPISIDT
FT                   AVTPCRDTEDRQSIEGTVIGTHQGLVEPATNDFPVENSLVVKTNNRRVTVGGPGAMLED
FT                   FEAKDTVTLTAD"
FT   gene            206125..207888
FT                   /locus_tag="Hmuk_0209"
FT   CDS_pept        206125..207888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0209"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase family 13 domain protein Ig domain protein region
FT                   domain protein; SMART: alpha amylase catalytic sub domain;
FT                   KEGG: gtn:GTNG_0610 neopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46346"
FT                   /db_xref="GOA:C7NWY1"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY1"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACV46346.1"
FT                   /translation="MTVCREAITHRPKSNFAYAVDEETIQLRLRSKRGDLDDCQVLVAD
FT                   KFDWPNRERLDMQLVRRDERFDYWQVEVEPEHRRLCYAFLLTAGDETLWFTEWGFESAD
FT                   KNELPTAGTDRSLHYFEYPFLHAGDVIDPPDWVSDAVFYQIFPERFANGDPEIDPDGVE
FT                   EWGGRPAHDSFFGGDLEGIIDTLDYLADLGITALYLTPVFESLSNHKYNTADYEQIDPH
FT                   FGDTETLSRLVDAAHDRGIRVMLDAVFNHCGRQFEPFQDVIEHGRESEYVDWFHIHEFP
FT                   IQFEPRPSYDTFGFESYMPKLNTENPEVQSYLIDVATHWIEETDIDGWRLDVADEVDHQ
FT                   FWRAFRQAVKDVKPDAYILGEIWHDSRPWLRGDQFDAVMNYPFMYAVDGFLSDGSLDAA
FT                   TFADKSNRFLARYPDQINEVLFNLLGSHDTARLRYRYDGDEHTVRLALLLLLTFRGTPC
FT                   LYYGDEIGMTGGDDPDCRRPMIWDEARQDRELHQYVSDLIGLRADHRPLRRGSLTFSRD
FT                   RCGDGVVVYRRSDESSDDSLTVAINRGDAPISVPIAGDGEAGTVLFTTDGDVTVGESEI
FT                   ELTGQSGAVWR"
FT   gene            complement(207969..210194)
FT                   /locus_tag="Hmuk_0210"
FT   CDS_pept        complement(207969..210194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0210"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase starch-binding; alpha amylase all-beta; cell
FT                   surface receptor IPT/TIG domain protein; SMART: alpha
FT                   amylase catalytic sub domain; alpha amylase all-beta; KEGG:
FT                   tpd:Teth39_0672 alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46347"
FT                   /db_xref="GOA:C7NWY2"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY2"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACV46347.1"
FT                   /translation="MKTLGTAAAAFGMSRSVEAEINGYHTLATEDNRLGPVTPRDTVYQ
FT                   ILTDRFYDGDTSNNDFEDFDSSLYDGSGEDLKLYQGGDWQGIIDKIPYLEEMGVTAVWI
FT                   SAPYDNRESKIEDYQDDGTVDVWTSYHGYHARNYFRTHRFFGGMQDFYAMRDALHNNGI
FT                   KLVIDFVSNHTSRWRNPTKNNEPEEGELYEPDTDADGNYVFDENGDAVGENLLADPHDD
FT                   VNGWFHGLGDRDGDSSKFGYRHKELGSLADFAHENGGVVDHLERATQFWKSKGIDGIRH
FT                   DATLHMNPAFAKNLKTATDSSQGGPITHFGEFFISRPDPKYEEYRTFPDRTGINNLDFE
FT                   FNRAATNAFGDFSETMSDFGDMLIKTHGDYTHEHQTITAVDNHDLTRFRYIQPNDKPYH
FT                   AAIAALMTCRGTPKIYYGTEQYMNPGSSGANAGRLFMQTDSDFDTSTTAYQLISDLAQL
FT                   RRDNLALAYGQTSILHSTDDVIVYERTFYDHVVVTAINRQPDQSESVPSVGTSLPDGSY
FT                   GDYLSGDLYGQGISVDSGALDSFTLGGGEVSVWTASPDLGNAPKIGTTVSTMGQAGDSV
FT                   HIYGSGLDGDVSVTFGGTPANVVSNSATRMTATVPDGPAGLVDVVVEKNGQTSNAAKYD
FT                   ILTDEPVQVIFHVEAETEPGETIHVVGDPPELGSWDALSGSESFMNPDYPEWFLPVSVP
FT                   KDTTFEFKFVKIDESDNVTWESGSNRTFTSPTDSTETEDTPLYYWQS"
FT   sig_peptide     complement(210135..210194)
FT                   /locus_tag="Hmuk_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            210542..211243
FT                   /locus_tag="Hmuk_0211"
FT   CDS_pept        210542..211243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46348"
FT                   /db_xref="GOA:C7NWY3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2235"
FT                   /protein_id="ACV46348.1"
FT                   /translation="MRVLCGRAVDPDADIERTRRLADEVADSRVPALRVWRPHRQVAFG
FT                   RRDAREDGYERAREIATKRGYAVLERAVGGRAVAYTGRTVAVALAVPTDGGRSGIQRRY
FT                   DAASDRFRAALDTLGVDASEGEPPESFCPGSHSLQAAGKVVGIAQRVRQRVAVVAAIVI
FT                   VADHGEVADVLAPIYDALDVSFDPDSVGSVARAGGPSEPDRVIDAVVETFADGHDTTVE
FT                   RVDSTSGLRDT"
FT   gene            211268..212539
FT                   /locus_tag="Hmuk_0212"
FT   CDS_pept        211268..212539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0212"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: hma:rrnAC2232 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, multifunctional complex type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46349"
FT                   /db_xref="GOA:C7NWY4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY4"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ACV46349.1"
FT                   /translation="MLIRNATLADGRTRDVRVRGETIDAVDEDLDPADEDTVDAADRLL
FT                   LPGAIDAHVHFRQPGYGHKESWASGSRSAAAGGVTTVVDQPNTDPPTVDGAAFDQKAEL
FT                   AGESLVDFGINGGVTGEWEPAELLDRPLFALGEVFLADSTGDMGIDADLFEDALVAAAQ
FT                   RDVTVTVHAEDASLFNRAARDRDDADAWSAFRTARAEAAAVERACEVAAEHDARIHIAH
FT                   TSTPEGIDTASDAGMTTEVTPHHLLLSRSDLDELGTHGRMNPPLRSEKRRREVYDRVVD
FT                   GTVDMIATDHAPHTREEKDASIWDAPSGVPGVETMLPLLLAEARTGDLTYERVRDLVAA
FT                   NPADVFDLPEKGRIAEGNDADLVLVDTDDVREITGDGLHSNCGWTPFEGFEGVFPKWTM
FT                   VRGTVVYDRSDDEFTDQQGENVRA"
FT   gene            complement(212540..212923)
FT                   /locus_tag="Hmuk_0213"
FT   CDS_pept        complement(212540..212923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46350"
FT                   /db_xref="GOA:C7NWY5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46350.1"
FT                   /translation="MDTRAKIVLLDGFLGVVQIIAALVLAETGTLVEHWWLVVATALGT
FT                   AGFAIAGDRGYTPDDSTWGFTAVAVAVVAASLLAVFVVNPPVSTVAALQFGVGSGILTN
FT                   RLLFGVVRPVPTSRIDRSRDGIV"
FT   gene            complement(212970..213326)
FT                   /locus_tag="Hmuk_0214"
FT   CDS_pept        complement(212970..213326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46351"
FT                   /db_xref="GOA:C7NWY6"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2231"
FT                   /protein_id="ACV46351.1"
FT                   /translation="MAVGRTATDWARPRARIVGSALATGALAGPIAVAVLALYAEGTLF
FT                   GTRKAFALGALAFGFGLLGWSGSVLAGRGVEAMQRHLDAAGDWTEADSRRAMARVTGFG
FT                   FGAMLGVSATAALL"
FT   sig_peptide     complement(213222..213326)
FT                   /locus_tag="Hmuk_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.622) with cleavage site probability 0.346 at
FT                   residue 35"
FT   gene            complement(213326..214255)
FT                   /locus_tag="Hmuk_0215"
FT   CDS_pept        complement(213326..214255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0215"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2230 oligopeptide
FT                   transport system permease protein OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46352"
FT                   /db_xref="GOA:C7NWY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46352.1"
FT                   /translation="MSTETRRRGAVDRLRASPFLSKLLSNRLALVGLTIILGMLAIALY
FT                   ARITLDPQALASSRLGTAVPDRAPPGWTGTGPADQYLFGTDSAARDIYERCLYGAWLAL
FT                   QFGTITVGTSTVVGVGLGIVAAYYGDVTDNVVMRTMDVLLAFPPLLLALALVAIFPREL
FT                   GLWRAVAALTLVYTPRFARVIRGAALTVLEDEYVDATVALGATDPRVLVRHVLPNTLAP
FT                   ITVQSTLNFGLAIIDLAALSFLGFGAQAGTPSWGLMLSRGVDNGLLTGRWWLSFFPGLF
FT                   LAVTVLGFNLLGDGMRDALDPRMREAID"
FT   sig_peptide     complement(214115..214255)
FT                   /locus_tag="Hmuk_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.648 at
FT                   residue 47"
FT   gene            complement(214252..215295)
FT                   /locus_tag="Hmuk_0216"
FT   CDS_pept        complement(214252..215295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0216"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2229 dipeptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46353"
FT                   /db_xref="GOA:C7NWY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46353.1"
FT                   /translation="MVSIRFVLKRIALLVPVLFGVATVVFAILHLAPGDPARVIAGQRA
FT                   SAEQLEQVRRELGLHRPLWIQYLSFLADAAQFDFGQSYSISRGAPVRSVLLDRLPVTLE
FT                   LAILGQLAGIFLGLPLGILSAIRQDSLTDHVTRIGALTGISVPIFWSGPLLILAFATYL
FT                   DWFPTSGRIDSTLFLPDSWLLLGRELPLTGLVTVDSLLLGNWTAFTSAVHHLFLPALVI
FT                   GIYSTALISRMMRSSMLEVVRQDYMRTARAKGQGARITVLKHGFRNALIPVVTIIGIQF
FT                   GTLLGGAVLTETVFGINGMGLTIVTAIGALDYPVVQGTVLTFALLFTLVNLVVDITYGY
FT                   LDPRIQQ"
FT   sig_peptide     complement(215212..215295)
FT                   /locus_tag="Hmuk_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.566 at
FT                   residue 28"
FT   gene            complement(215308..217074)
FT                   /locus_tag="Hmuk_0217"
FT   CDS_pept        complement(215308..217074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0217"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hma:rrnAC2228 dipeptide ABC transporter ATP- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46354"
FT                   /db_xref="GOA:C7NWY9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWY9"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV46354.1"
FT                   /translation="MQSDDPLGRRDFLRAAGAGAVTVTLAGCAGDDGDDETPTEGGDEQ
FT                   METDEAATTAEGDDGGDDTAGDQTLVYARGDHPENYDPQQTTSGEVAKVTNQIFDTLIQ
FT                   FAAGSGGELEAGLATDYSLEGTTATLTLREDVTFHSGEPFTAEDFEATFRRFTDPEYDY
FT                   YLGDANRSGYGPFTLGNWIESVDASQDGELTIELSQRYAPFLRNLAMFAAAVLSKAQIE
FT                   SFDASPDAQVGLGTEPIGTGPFAFDQLDNPNDRIRLTANESFWGPGPNVGSVVFKTISE
FT                   NSTRVQDVINGASHVTDNLDSDGFQRADSSDTATLLRKNGINVGYMAMNMERMEPFRDR
FT                   RVRRAVSLAVNTEAIVNQIYQGFATQASQPLPPDVLGHNDGLDPYPTDKDEARSLLEEA
FT                   GYGDGFEFELATFSNPRGYNPSPVQTANQVRSDLQDIGLSVEINQFSDFGPYLDYTDQG
FT                   RHDACFLGWYTDNADPDNFLYVLLDPQVPLDDVPDGQDWISFDTDGYNTLNVSAWANTE
FT                   YMELVREAQSTYDTNERDTMYQEANKLAHDEAPWVFVDYAETLRAINEAVVEDTYTVSS
FT                   VGGPYLNTVELQ"
FT   gene            complement(217175..219892)
FT                   /locus_tag="Hmuk_0218"
FT   CDS_pept        complement(217175..219892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0218"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: hma:rrnAC2227 dipeptide ABC transporter ATP-
FT                   binding; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46355"
FT                   /db_xref="GOA:C7NWZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46355.1"
FT                   /translation="MRDLLTLSNLQTHFETERGTVHAVDGIDLSVRAGETLGLVGESGS
FT                   GKSVTALSAMRIVDEPGFLAGGDVHFGAVETVDRLARQYPRGVATADHDGYLHLDAVDL
FT                   DRSRLPDGVDRSLDDDELARRFVRSEPATALGPVGSTGEHETDRGTTPSGTGSDSAQLR
FT                   TAPVTIRDGYVDLRAAPERVLRDVRGGDMGMIFQDPMTSLNPALTVGQQIAESLLLHRY
FT                   GRQRSDSWVNALREILPVVGGNAVTGRVREDVLELLDAVGIPEPTTRIDEYPYEFSGGM
FT                   RQRVLIAIALACRPKLLIADEPTTALDVTIQAQILDLIDDLQAELGMAVLFITHDLGVV
FT                   AETCDRVAVMYAGEIVEEGPVGEIFHNPSHPYTYTLLESIPRADTERLTPIGGSVPSLI
FT                   DMPEGCHFAPRCPWATDDCRRGEIPYLQHGPEGVDHRSKCIFESFDADAYGGDADGVAA
FT                   SETTRTDRTLVEIDGLKKHFSRAEDLFDKYLGRVPDAVRAVDGVSLDVYEGETLGLVGE
FT                   SGCGKSTTGRTILRLLEPTDGTVLFAGDDLAGLDSDALRGKRRDMQMIFQDPLSSLDPR
FT                   MTVRQTITEPLQIHDLPDADDERSKRQQRRERVEELVAAVGLDVAQLDRYPHELSGGQR
FT                   QRVGIARALAVDPDFIVCDEPVSALDVSVQAQIINLLEDLQGEFGLTYLFIAHDLSVVR
FT                   HICDRIAVMYLGEIVEVADTPALFDDPKHPYTKSLLSAIPVADPDADSDRVILKGDVPS
FT                   PIDPPSGCRFHTRCPSVIPPEDIEIEQATFREVMDYRQRVENERIDLDAAWDAAAGETS
FT                   ATVADGGRPHERASRSAFKSALFEDLFEHPPTGRNREVVAESFEHLATEDWDGAETVLR
FT                   DRFESVCERSHPELGDRAHPAACHLVENGDIDRS"
FT   gene            220092..220610
FT                   /locus_tag="Hmuk_0219"
FT   CDS_pept        220092..220610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46356"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2226"
FT                   /protein_id="ACV46356.1"
FT                   /translation="MSDPAQRANTPFDRVVGPWERVIDEMHATAERHREDGKRVIDCHP
FT                   GDVATLTGDPRTDAASTGDIEPDRRVGLDAVLPGSEFEAVQAVLRDRDPDRVEVFRARG
FT                   NGLVFLLLSLSCGDSVVLLPLYYEREDADALRSIARDSGFPVHVRPLTDGERVRVTVDD
FT                   PELCVPSRS"
FT   gene            complement(220752..221432)
FT                   /locus_tag="Hmuk_0220"
FT   CDS_pept        complement(220752..221432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46357"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2224"
FT                   /protein_id="ACV46357.1"
FT                   /translation="MTDGASPDETDEQRSRAEPSSTEPDAADGSEPADDESLDAADGDS
FT                   LETDVPADVRKYDRFKKIDGGTYDRANEFLRERTYVTAREWAIARLCADFRTETGVEMT
FT                   KIGENLPELVPFMTDTYTPQAVNQARASFEEKVRKAGATFLYGAMCDFFTAEELDDVMY
FT                   EATEVAKFLLEVEGVELSVEEELETEDQISEVMRDVREHSAALRHDEVSCPECGHDIDV
FT                   GEET"
FT   gene            221568..221936
FT                   /locus_tag="Hmuk_0221"
FT   CDS_pept        221568..221936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0221"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: hma:rrnAC2223
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46358"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ3"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV46358.1"
FT                   /translation="MHVLLGVGGSDLSYQALDETIERAREAGDEVTVAVFDGHETDAGG
FT                   DEVQERVRERLDETGFEAEIRLLSGDPGSRLVDVAESEGFDRIVLGSGERSTLGKIQLG
FT                   SIAEFVLLNAQTPVTLIR"
FT   gene            221933..222457
FT                   /locus_tag="Hmuk_0222"
FT   CDS_pept        221933..222457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0222"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hma:rrnAC2222 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46359"
FT                   /db_xref="GOA:C7NWZ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV46359.1"
FT                   /translation="MTRRYPDEPAGTFPAPPRQVTDREGRSIQLRRADATDRTALIEMY
FT                   KQFDPADRAQGIPPARETAIERWLENILDTDRYNVVASHEGDLVGHATLVPDDDDGYEL
FT                   AIFVLSAYQGAGIGTELVETLLGHGQSEGIEQVWLTVERWNDPAIALYRKVGFETSNSE
FT                   RFEQEMAIRLA"
FT   gene            complement(222720..223166)
FT                   /locus_tag="Hmuk_0223"
FT   CDS_pept        complement(222720..223166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0223"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: hma:rrnAC2221
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46360"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ5"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV46360.1"
FT                   /translation="MDIDLVLAPVDGSNQSEAAVEYALAIADAYDAEIHLLFVLDETLI
FT                   RAIEADEVDADAIADQHQVFAAEMQSRLDDRGHEAGLNHSTAAGFSPTRLRQSPGSVIL
FT                   DVAEDLDADFIVVPREPGSDDSVDAIGRAALYVIEYASQPVLSV"
FT   gene            223234..223689
FT                   /locus_tag="Hmuk_0224"
FT   CDS_pept        223234..223689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0224"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: hma:rrnAC2220
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46361"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ6"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV46361.1"
FT                   /translation="MFDTVVIATDGSATAERAVTAALDLAGQFDATVHALYVVDSGEVA
FT                   GSPEAVREEFEQALATTGGKALTFAREAAEAEEEEDAVVTTVREGDPAKEICRYAEEID
FT                   ADVIATGTRGRHGEHGYLLGSVAEGVVRRAEMPVLTVRQLEEATNGL"
FT   gene            223733..224812
FT                   /locus_tag="Hmuk_0225"
FT   CDS_pept        223733..224812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0225"
FT                   /product="RecJ-like exonuclease"
FT                   /note="KEGG: hma:rrnAC2217 RecJ-like exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46362"
FT                   /db_xref="GOA:C7NWZ7"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2217"
FT                   /protein_id="ACV46362.1"
FT                   /translation="MDDWLIDDERLSLERKSILPGEGFFLPDSIEEEEQEREAAEQMES
FT                   TEVVVIADPDADGLACVALVREALGSGSLVPAGPHELDEALEWAAEYVEADATLVICDL
FT                   CPDSESDIAALDDLTARVDDVRWYDHHQWNEDLGAAVDDSGVDRTVGDSDEVCTADVAL
FT                   AQLEYDFDDRFAELAAVTRDHDLWIRDDERSDDLADLSYWIEPEEYIEAVLEHGPDLSP
FT                   EWHEFIEEKRVEKEALIEKAVERAQLRDVGEWTVGVTYGRCSQNEVAEALREQGADAAV
FT                   IVKPAGSASIRGTETFERCHEVAAQVNGGGHPRAAGCKPDVYDDMLDYAHHWSTRGAVA
FT                   KQAIVDAFKRLPEEPEAAE"
FT   gene            225009..225464
FT                   /locus_tag="Hmuk_0226"
FT   CDS_pept        225009..225464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46363"
FT                   /db_xref="GOA:C7NWZ8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2216"
FT                   /protein_id="ACV46363.1"
FT                   /translation="MSPALPAWLPDRPAITDSLTRAIFVGGTLYVVERSLSYAATAGLA
FT                   FLALQLLADTAENVVGDYADSVVLGTLILGATGYVAVLGSALGTLVGGVAAGGWFLADG
FT                   VQHLRHGVTRDEVGVQYTHEGSALTGLPKALLARLAEPLLLETRDRQ"
FT   gene            complement(225472..225903)
FT                   /locus_tag="Hmuk_0227"
FT   CDS_pept        complement(225472..225903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46364"
FT                   /db_xref="UniProtKB/TrEMBL:C7NWZ9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2214"
FT                   /protein_id="ACV46364.1"
FT                   /translation="MSKRTEFLAGERIEDVAFFLHEDAVGNADALAEYAEDVEDGMVLV
FT                   IDGDQGRSAFQSATGIDPMGLAREAMATDGEIADDLTGGVCPNEDEEPDENHTAKFVFA
FT                   FAEEQNEEVGGIYEDGDVIHAYAVCPCGEKYSEKWVIGE"
FT   gene            225996..226157
FT                   /locus_tag="Hmuk_0228"
FT   CDS_pept        225996..226157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46365"
FT                   /db_xref="GOA:C7NX00"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46365.1"
FT                   /translation="MVFELIAGFVALVAASYIGTTMALRGYFGATSFDRVQRRESGEPN
FT                   DDDSSADD"
FT   sig_peptide     225996..226067
FT                   /locus_tag="Hmuk_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.579 at
FT                   residue 24"
FT   gene            complement(226337..228085)
FT                   /locus_tag="Hmuk_0229"
FT   CDS_pept        complement(226337..228085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0229"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   hma:rrnAC2183 flagellar assembly protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46366"
FT                   /db_xref="GOA:C7NX01"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX01"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACV46366.1"
FT                   /translation="MASNEAENSLNLTLSEIFDDLLDAYRQMHIPLQRYLFFILLPAIA
FT                   FFLLSAVAALVLDLPMMIRAPIPMLGFLAMAAAIFYPKILISQRRSQLNNRFHLLVTHM
FT                   TVLATTKIDRMEVFRTLAQEEEYGELANEMHRIVELVDTWNQSLDDACRRRAKEVPSAA
FT                   VSDFLDRLAYTLGAGQSLEDYLLSEQEQIIQNYTTVYEGTLDNLEVMKDLYLSMVLSMT
FT                   FALVFAVVLPVLTGTDPTMTVSAVIVMYIFVQSGFYLAIRSMAPYDPVWFHPDDYPSDV
FT                   ENRIEKATYVGVALTAVLIFISLGGMFGVSPITVGDLLFFLDRVPLSMYAAIPITPLLI
FT                   PGIVIRQEEQRIKGRDDQFPSFIRALGATEGAKQSTTSMVLRTLREKDFGALSPNVDDL
FT                   YKRLNMRIEPAEAWRYFTADCRSYLIQTFSEMYLIGREMGGSPKLLGELIAANMNEIQA
FT                   LRTQRNQAATTLIGLLYGITAASTFAFFIGLQVVNILSSMSLNLSSNAGFDASTLINTS
FT                   VYNIPLIEFLLIIIIMFGAMLSALMVRTVDGGHKGNTYMHFVLLAWIGSVTSIATKWLV
FT                   TQFIGI"
FT   gene            complement(228085..229758)
FT                   /locus_tag="Hmuk_0230"
FT   CDS_pept        complement(228085..229758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0230"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   hma:rrnAC2184 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46367"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX02"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACV46367.1"
FT                   /translation="MTDHGRPKPSDELRQVAARRPHLRDHLKKFKQITGEFPEFIEEAD
FT                   DDYESDRPNVLYPVGGPIFCHVYGDIGQDMKYYAIEPELDEDESVVFSKVRNKLLQKSV
FT                   NKPAPQNENEYDDRIEELLQESTKIRDEDGNDGVLTRIANLGSVGQVEVTESTYENILY
FT                   RLNRDIVGLGPLEPVMRDPANEDIHVIGRQECHVDHEVYGMLETTVEWESEAAFDQWLR
FT                   NMGERMGDPVSDSDPIVDSTLPDGSRLNLIYSDDVSAKGPSLTIRQGTETPLSIFQITK
FT                   WNTLSPELSAYLWLALENEQTVFVVGETASGKTTTLNSIMSFIPRDSKIYTAEDTAEVL
FT                   PPHDTWQKLLTREGEDEGTSVDMFDLVAAALRSRPDYIIVGEVRGEEGRMAFQAAQTGH
FT                   PVMLTFHASDIVSMIQRFTGEPINVPETFMDVADIALFQNRVKQGDDVLRRVTSVQEIE
FT                   GYSKEMDGVVTRQAFNWDPVEDEINFQAMNNSYVLEEQIATLLGYEDTREIYGELEFRA
FT                   NIIRRAIQENIVGYHEVNQLIEDFQRDGVEGLPFTIARPD"
FT   gene            complement(229758..230519)
FT                   /locus_tag="Hmuk_0231"
FT   CDS_pept        complement(229758..230519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0231"
FT                   /product="flagella-related protein H"
FT                   /note="KEGG: hma:rrnAC2186 flagella-related protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46368"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX03"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2186"
FT                   /protein_id="ACV46368.1"
FT                   /translation="MSIARNDLYSLGLDDHDRLNKELGGGIPPGSIILVEGDYGAGKSA
FT                   MSQRFSYGLCEEENDVTMLSTELTVGSFLDQMHSLSYDVVDHILDENLLFLHADIGDGN
FT                   TFSGNEEEQDRKELLRRLMEAEVMWESDVIIIDTFDAILRNDPKFEALVRQNEERQAAL
FT                   EIISFFRDVISRGKCIMLTVDPSTLAEEAIGPFRAIADVFIELEMVEVGNDVRRQVSVK
FT                   RFAGMGEQVGDTIGFSVRSGTGIVIESRSVA"
FT   gene            complement(230516..230968)
FT                   /locus_tag="Hmuk_0232"
FT   CDS_pept        complement(230516..230968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0232"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: hma:rrnAC2187 putative
FT                   flagella-related protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46369"
FT                   /db_xref="GOA:C7NX04"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX04"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACV46369.1"
FT                   /translation="MAGVSASHLIIFIASMMVAASVVGVFTDSVGQLSDAISEQGVDVS
FT                   SDVRSDIEIISDSGSDAIYDADGNQNITLHVKNTGTLQLPARADRLDIFVDGAYQTDVE
FT                   VTLVGGAEVWGAGDVVRLDISEPLDPGDHRVKIVVNGDEEVFEFRT"
FT   gene            complement(230970..231413)
FT                   /locus_tag="Hmuk_0233"
FT   CDS_pept        complement(230970..231413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0233"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: hma:rrnAC2190 flagellar
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46370"
FT                   /db_xref="GOA:C7NX05"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX05"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACV46370.1"
FT                   /translation="MGFSVSGSAAIVFAGMFIAFGMFHTATTNGFERVSEAQEDRTDRT
FT                   LAQQNTAIDVTSATWNTTSRTLTVAVNNTGSESLAVSDVDLLADNSYQSGYDTSVGGDD
FT                   DTDLWLPQEQLTITVTALDDDPGRVKVVSGTGVADTATTTEVV"
FT   sig_peptide     complement(231327..231413)
FT                   /locus_tag="Hmuk_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.478 at
FT                   residue 29"
FT   gene            complement(231397..233058)
FT                   /locus_tag="Hmuk_0234"
FT   CDS_pept        complement(231397..233058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0234"
FT                   /product="flagella protein"
FT                   /note="PFAM: flagella protein; Flagella accessory C family
FT                   protein; KEGG: hma:rrnAC2191 flagella-related protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46371"
FT                   /db_xref="GOA:C7NX06"
FT                   /db_xref="InterPro:IPR006752"
FT                   /db_xref="InterPro:IPR009205"
FT                   /db_xref="InterPro:IPR016682"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX06"
FT                   /inference="protein motif:PFAM:PF04659"
FT                   /protein_id="ACV46371.1"
FT                   /translation="MSSIALFPTLQVAIPEGSIFAPALVVLLTGGLVGMSIKNMFDSIL
FT                   SDDEESDDAGGDDGDELADGGGLMADDGGDDEFGDLGGMGGDDMDGFGGDEFGDMDDAG
FT                   QDTDELEHRLDELENEVGSLSSTVNTVRTENEQISESVEEVEENVRKLLDIYEMVTRGV
FT                   NPFADDIDAGMGGGGGMGGGGGFGLFDDDDDETEEDIDEDIANADAEGFFDEDLVEDDG
FT                   DDLGGGGDSVDDVFADDGSDDGGFEDDGGSFEDDFDDFDEGGDDLGDFDEEDDDMSMDM
FT                   DDGGDGDGEGGKSFQELKDEYDSGDAEWAEEDSPGGDMALDEDDGDDEMALEDDELSSG
FT                   IEEDGDDLDGLADDDLFDDVIEDDDEDLTAEADASEPEPEPEPEPEPEPELEPEPEPEP
FT                   EPEPEPEPTTTAEPEPEPEPTTTAEPEPEPELEQTPNASADDGGKPYLSELPGGFASDL
FT                   IVVEWLEYLLEQASYREAARAIDYYERIDWIDEAVADDLHEVLRGFEESGGKGGLTIDH
FT                   HTRSLHYISQLDEDSGADAVALSKLVRGGGSDGLQR"
FT   gene            complement(233305..233823)
FT                   /locus_tag="Hmuk_0235"
FT   CDS_pept        complement(233305..233823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0235"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; PFAM: CheD
FT                   family protein; KEGG: hma:rrnAC2192 chemoreceptor glutamine
FT                   deamidase CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46372"
FT                   /db_xref="GOA:C7NX07"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX07"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ACV46372.1"
FT                   /translation="MKVYDGSQTEQESVGQPERKKVGIAEYAVTTDEAVLTTSGLGSCI
FT                   GVALYDPDSNTAGLVHVMLPRHDEGEGARAKFADTGVEVLLEEMERAGAQRRSMEAKIA
FT                   GGSDMLDFSENGSSIGSRNAAIVRETLAANDVPILGEDVGGDYGRSLRLKAATGDLIVK
FT                   SASQGTATL"
FT   gene            complement(233826..235037)
FT                   /locus_tag="Hmuk_0236"
FT   CDS_pept        complement(233826..235037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0236"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: hma:rrnAC2193 CheA
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46373"
FT                   /db_xref="GOA:C7NX08"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX08"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ACV46373.1"
FT                   /translation="MKVDIQSLGTFNQLAHEGAEQATQSLAQMTGIDAVVDVTKITLLN
FT                   RDDVGEELAGQDFVGVQFDFEGALDGDTVLVFESDSVGPITEALVPGGADGEMAQSSVE
FT                   EIGNIMMSGFIDGWADYLGTTIEHSPPEYIEATGADVLPPAPTVADQPQVFVFKSQIEW
FT                   VGESLNFYIYMLPEYDTLAELMTDHAEPGGDAIPIDKLSVFNEMTTSGTEQAAENVEMM
FT                   TGIPTEAEVTQISFAPIEDVPKQIGDDTYVGTVVEFTGVPSGYLLVLFDEVSAQNVAEA
FT                   LMPTEPDGEGLTEQHKAAIEELGNIMTSGFVDGWANVLQTSVDHTPPQLVHDIGQAIVD
FT                   PLAAQVGQHQEHSFIIESEMRTDEIEFSSEIHALPDEKELRQALEELEVDRADQTDADV
FT                   EQIF"
FT   gene            complement(235039..235398)
FT                   /locus_tag="Hmuk_0237"
FT   CDS_pept        complement(235039..235398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0237"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: hma:rrnAC2194 chemotaxis protein
FT                   CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46374"
FT                   /db_xref="GOA:C7NX09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX09"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV46374.1"
FT                   /translation="MPDVLIADDSEFMRNLLREILEEDHNIVGEVENGVEAVEVYKEQT
FT                   PDLVMMDIVMPIRDGIEATDEIKTSNPDANVIMCTSVGQEEKMKEAVKAGADGYITKPF
FT                   QKPSVMEAIEDVVPS"
FT   gene            complement(235507..237504)
FT                   /locus_tag="Hmuk_0238"
FT   CDS_pept        complement(235507..237504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46375"
FT                   /db_xref="GOA:C7NX10"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX10"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3524"
FT                   /protein_id="ACV46375.1"
FT                   /translation="MNGDRSSGVDAQFRSVWSDRLSRYADRAGQFVFGDAIGLTLWLGV
FT                   VLLGALSWRVGFFITDTYPIANAVANLADGRLAMTPPDFQYSLTLGTQPGLHEYGGRFY
FT                   ARNYGQVVAALPFLWLLEGASVVAPPRLVLAGGWALGVVGLGRRLAARFDRRWLRLVAV
FT                   AVASAWFAAAVVLATALDRSQLPLVALQLSTLAAAGVVAVSCYRLVGAFHDRRVAVAAG
FT                   VALALATPVGFWATIPKRHVLVTALVFWSVFAFARSRQLDGRASYVAHGLAYGALGLVA
FT                   WVHAFEGFFLTAALFAVDFLTEPRKSRRRLAVVGGIFVLSVLPMAVTNVLINGNPLRPP
FT                   RLLPNVGPESVELAPTDGAKAGDGDAASGTAGGDADADPTGGDETQRTLLDELFGLLSP
FT                   LFALSTLAETVLAQLVFIGNYAVAAVSDGVAAAGEHERLWEIFVRRGNSASLSGINDYE
FT                   TIDLSVVESTPIVGTLLALPAVAAVHIRRHGVALSRLGPRRQTDLLVASYAVVLTLVYL
FT                   PRLPLFSQLTVRYLLPAIALASYCPFRLPAVREAISGAPRTIAGVYAGTILVGPALAAV
FT                   VLGVLDPALGEAIQFHALFGLCVAAVAAVLVVGRTVAPDRVSPRSVAIGMAVAGGATTV
FT                   YLSLASVEYFAYGPFAFDVVGLIARLVPIL"
FT   gene            complement(237501..237986)
FT                   /locus_tag="Hmuk_0239"
FT   CDS_pept        complement(237501..237986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46376"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46376.1"
FT                   /translation="MVSVARLERLAVAVVAVTLLLTGPFGVVDATARNPTTVGDGRANA
FT                   TVERLDTSALVVEGGRFGTGVDYLRIPDATISVSDIEGRPRLVYRVSVPELGVDRTTTR
FT                   LLSGGQSETVRLGMRDRGLDPDGVTEQRYRATITVRVQSFEYDQTVFEADETVEVRP"
FT   sig_peptide     complement(237888..237986)
FT                   /locus_tag="Hmuk_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.362 at
FT                   residue 33"
FT   gene            complement(238033..238593)
FT                   /locus_tag="Hmuk_0240"
FT   CDS_pept        complement(238033..238593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46377"
FT                   /db_xref="InterPro:IPR001158"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX12"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2195"
FT                   /protein_id="ACV46377.1"
FT                   /translation="MSEGPDEPNPEDGKILSPEELDISDDDHVEQIDEGRYVVSPDVRT
FT                   DSTTPSRPAPDPTPEPEPTPEPEPTLDDATVHEWLAETMDEGNSRYGFDVTAKFDGTVS
FT                   QQRMVSNDIITVFESLMLWYARQVDGSTPVEEVLGILLSESNVPVRYPPESLRELVKTS
FT                   GCSPDDSIAELLAAVEGEDGVQL"
FT   gene            complement(238684..239385)
FT                   /locus_tag="Hmuk_0241"
FT   CDS_pept        complement(238684..239385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0241"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: hsl:OE2470F flagellin A2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46378"
FT                   /db_xref="GOA:C7NX13"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX13"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACV46378.1"
FT                   /translation="MIELFNDEENDRGQVGIGTLIVFIAMVLVAAIAAGVLINTAGFLQ
FT                   SSAEESGEQSSAQVTNRLQVVDAVGDGIIDDTTASSDTAEVTRVTLTVKKAPGADNVDL
FT                   ETTTAQWVSSDGTYNIVAATRDDFSTSNHGGAFGIGTFQDDDNSITESSVLNDPADRAT
FT                   MTFETTDVSNSNDGRTVEDSDGNTNSNFEIDTDLGEGSTATVKLNTQAGGETTATLVVP
FT                   ESLSGKSAVSL"
FT   gene            complement(239703..240389)
FT                   /locus_tag="Hmuk_0242"
FT   CDS_pept        complement(239703..240389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0242"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: hsl:OE2398F flagellin B2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46379"
FT                   /db_xref="GOA:C7NX14"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX14"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACV46379.1"
FT                   /translation="MIELFDDEENDRGQVGIGTLIVFIAMVLVAAIAAGVLINTAGFLQ
FT                   SSAEESGEQSSAQVTNRLQVVNAVGEEIIDADSSTSGDAEVARVILTVKKAPGADNVDL
FT                   ETTTAQWVSDGGTFNIVEDTRFDNTNHDAAFLTGTFQDDDASISDSTVLNDPADRATMT
FT                   FETTQLSSTNSGGATVDGGNDDALVSDSLSEGSTATVKLNTQAGGETTATLVVPESLSG
FT                   KSAVSL"
FT   gene            complement(240702..241352)
FT                   /locus_tag="Hmuk_0243"
FT   CDS_pept        complement(240702..241352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0243"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: hsl:OE2398F flagellin B2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46380"
FT                   /db_xref="GOA:C7NX15"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX15"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACV46380.1"
FT                   /translation="MIELFDDEENDRGQVGIGTLIVFIAMVLVAAIAAGVLINTAGFLQ
FT                   SSAEESGEQSSAQVTNRLQVVNAVGEDIVDDSGFEVTTVNITVKKAPGADNVDLETTTA
FT                   QWVSSDGTFNVVSEPASGTGGTSGDATFAISTFQDDDNSIGNSDVLNDPSDRATMTFRT
FT                   DSHNNGNTVVSTVNADLTEGSTATVKLNTQAGGETTATLVVPESLSGKSAVSL"
FT   gene            complement(241580..241858)
FT                   /locus_tag="Hmuk_0244"
FT   CDS_pept        complement(241580..241858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46381"
FT                   /db_xref="GOA:C7NX16"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX16"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2199"
FT                   /protein_id="ACV46381.1"
FT                   /translation="MIELLYAISTLVFVVAGLTMVGMAMRAYVQTSRDAMLHLSLGFAL
FT                   AVAGAAATMISAFVNDFEGVRSLLLVNSGLTTFGFLFVMYSLVAYDS"
FT   sig_peptide     complement(241769..241858)
FT                   /locus_tag="Hmuk_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.759 at
FT                   residue 30"
FT   gene            complement(241967..242302)
FT                   /locus_tag="Hmuk_0245"
FT   CDS_pept        complement(241967..242302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46382"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX17"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2200"
FT                   /protein_id="ACV46382.1"
FT                   /translation="MASVDILQTLGNKYSAEILDATDEPASAQELSDELGIPIATCYRR
FT                   IDELTEHDLLELHDNILSDDRRRIKVYRRSVDEITVDFDDELSVHVEDRSEVTNKLDEA
FT                   WRTLSEG"
FT   gene            complement(242451..243176)
FT                   /locus_tag="Hmuk_0246"
FT   CDS_pept        complement(242451..243176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0246"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KEGG: hma:rrnAC2202 circadian regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46383"
FT                   /db_xref="GOA:C7NX18"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX18"
FT                   /inference="protein motif:PFAM:PF06745"
FT                   /protein_id="ACV46383.1"
FT                   /translation="MIELTKTGIDGLDAILNGGIVTNSTTLVSGNPGAGKSILGLQYIY
FT                   NGVEQFDEKGIYLSFEENESDLREAAESIGFDKWPEFVESGDIKVYDKQVLLRENDFSS
FT                   SLELLLDDLEDDKYDRLVLDSLTMFELFFEDETEKRTYLLKFTDILNNNGLTSLLTNEQ
FT                   GAVFPDTDIGLENYLTDGNIYLIQTPTDTGVNRYVWVAKMRKQDIETDIYPMEISWGGI
FT                   KVHENASAFSMMSEEDSPI"
FT   gene            complement(243249..243674)
FT                   /locus_tag="Hmuk_0247"
FT   CDS_pept        complement(243249..243674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0247"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: hma:rrnAC2203 chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46384"
FT                   /db_xref="GOA:C7NX19"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX19"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACV46384.1"
FT                   /translation="MSTTEGQVLEFELGEETYCVSIDYVTEIVDVGDLTTVPNAPRHVE
FT                   GVMDLRGRTTSIVNPKSVFGIGDGGAEQRIIVFDPEIVEDQSAAGWLVDEVDQVVQISD
FT                   EQVDDSPAADSDGSIRGVVKRDDDFVIWVDPRVVHSN"
FT   gene            243854..244930
FT                   /locus_tag="Hmuk_0248"
FT   CDS_pept        243854..244930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0248"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: hma:rrnAC2204 protein-glutamate
FT                   methylesterase; PFAM: CheB methylesterase; response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46385"
FT                   /db_xref="GOA:C7NX20"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX20"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ACV46385.1"
FT                   /translation="MAGSTPRAVVADDSHFMRSVISDILDEGGVDVVAEAKNGREAVAL
FT                   VDEHRPDVVTMDVEMPEMDGISAVEQIMEQCPTPVLMLSAHTDENADVTFEALDVGAVD
FT                   FFTKPGGEVSMEMSRLKDQLLEMVLSVADVDVSGTSGRTPTASPNRSPTSTPEAVADDY
FT                   DANPTLIIGSSTGGPKMVESVLSELPLAADFRVLVVQHMPGGFTGRFAQRIDARSDYDV
FT                   REAQDGDRISGGEALIAAGDYHLRVKNYRNGRLRVKLSDDPPVNSVRPAVDVTMETAAD
FT                   VIDDPLVGVILTGMGNDGAAGIERIKAAGGRTIAQDEATSAVYGMPQRAAETGCVDSIL
FT                   PIEEIPAGIVETIKREVT"
FT   gene            244932..246881
FT                   /locus_tag="Hmuk_0249"
FT   CDS_pept        244932..246881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0249"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; CheW domain protein; SMART: Hpt domain
FT                   protein; ATP-binding region ATPase domain protein; CheW
FT                   domain protein; KEGG: hma:rrnAC2205 chemotaxis protein
FT                   CheA"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46386"
FT                   /db_xref="GOA:C7NX21"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX21"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46386.1"
FT                   /translation="MNDQYLDAFIRESEEAITELNNSLLDLESDPEDTEAMESIFRTAH
FT                   TLKGNFGAMGFDDASSLAHAIEDLLDEMRDGNMPVTPDVMDLIFAGVDKIEAIVSEIEE
FT                   HGESGTDVDEIVDDLRTVLEEGVDAAEGAADDADGPDEAPDDTTDTDSSGDGDVAVETN
FT                   VSPDTADDSIIAAEIDIGDSDMLGVDAMLAIEAVEDYFDVLDAAPQREAVEDGEFSDTF
FT                   TLYLDAEDTGTVDNTLSGIGKIESAETADVTDALSEKSGSTSDETEHKVDEIKSVRVDV
FT                   DQLDDLHGLVEQLVTSRIKLRRAVEQDDLDGAGENLNELDKITANLQNTVMDMRLIPLK
FT                   KVVGKFPRLVRDLSRDLGKEVDFEIEGEDIELDRTILTEISDPLMHILRNSVDHGIEPP
FT                   EVREEKGKPRTGTVELRASRERDHVIIQVEDDGAGLDVEAIRDKAIEKGVRSPEELEAM
FT                   DDSSIYDLVFHPGFSTADQVTDTSGRGVGMDVVHDTVTQLDGSVNVESTPGEGTTVSLR
FT                   LPVTMAIVKVLFVEVGDEEYGIPLKNVDEITRADDRKQVNGKDVIKHNDEIYPIIQLGE
FT                   TFDAPGETANGDGMLVRVRESERQVALHCDSVNSQEEVVVKPLEGILSGTPGLSGTAVL
FT                   GDGNIVHILDVVTL"
FT   gene            246892..247701
FT                   /locus_tag="Hmuk_0250"
FT   CDS_pept        246892..247701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0250"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: hma:rrnAC2206 chemotaxis protein
FT                   methyltransferase CheR; PFAM: MCP methyltransferase
FT                   CheR-type; SMART: MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46387"
FT                   /db_xref="GOA:C7NX22"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX22"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACV46387.1"
FT                   /translation="MSQGDQRQFQELLEFIGAEMDFESGFYNDAYLDRRITARMRRTDI
FT                   DSYREYRRQLERDDDERAALLDSLSINVTGFFRNPEAWESLRSVLRDLTDQHRRVNLWS
FT                   APCADGREPYSAAMLALDDPQVDDRSVSILGTDINEDILREAREGTYETSHTTDIADEL
FT                   APLDDYSEYIDRDGDSFRIRKRVSDMVEFEQHDLIRGASKRDFDLVFCRNLLIYIDGEY
FT                   KVPIFETIEESLREGGYLMIGMTETLPTACRDSFEAVDKQHRIYRKV"
FT   gene            247698..248924
FT                   /locus_tag="Hmuk_0251"
FT   CDS_pept        247698..248924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0251"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein repeat-
FT                   containing protein; SMART: PBS lyase HEAT domain protein
FT                   repeat- containing protein; KEGG: hma:rrnAC2207 phycocyanin
FT                   alpha phycocyanobilin lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46388"
FT                   /db_xref="GOA:C7NX23"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX23"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ACV46388.1"
FT                   /translation="MSLYQLERDGEVQEIIRTLRESDNPKVRARAAELLGNFPNHDDRR
FT                   DVVNALVEAAQGEDSRIAATAVDSLDELGGDAIEQLIADMAGVDFGDDGAEWVRAKAFT
FT                   QALDADVPELRMAAANGLGQLEQADTVGPLSNRFDDDDPRVRARAARACGKIGDPRAVG
FT                   PLESLLRDPKAAVRREAADALGSIGNRQALQALLPLYEDDNERVRRIAVGAFGNFGNDR
FT                   PVDYLVESLTDESSGVRQTAVYSLIELLSNVPTEQSHEIRDTVVERLSSTDDRSVVVPL
FT                   VEILEESTQNAQRRNTAWLLGRVTGEQERVRVIESLIDALHEDDQMLRQFAATSLAEID
FT                   GDDVERRLLSVVDDEAVDPDVRAQAIFTLGKVGSERSRKTLDRIIDQTENETIRKRAFS
FT                   AISKLGGRR"
FT   gene            248995..249858
FT                   /locus_tag="Hmuk_0252"
FT   CDS_pept        248995..249858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0252"
FT                   /product="Protein of unknown function DUF439"
FT                   /note="PFAM: Protein of unknown function DUF439; KEGG:
FT                   hma:rrnAC2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46389"
FT                   /db_xref="InterPro:IPR007381"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX24"
FT                   /inference="protein motif:PFAM:PF04283"
FT                   /protein_id="ACV46389.1"
FT                   /translation="MSDGEQKLADAKGKFVQVVKDGRKRNDIDWRAGRIILSNKRLVLV
FT                   SNEGKRTIPLSKITSITGRDNVNKAIAKVSGYLSLQVGSNVTLIAPQDIEGFESKLYSA
FT                   LLDQTVVLVKHPAVEGGVVQDTEWEKGRLKIDGDSVDLAIASGSFVELEVDDVGSAELK
FT                   TKTVTGKQRRVAEIEHTVEGTSVETHVSGSKSDVSVLASFVRRGEQAGEVDVELSKEEN
FT                   EVLMALYTGVSPFQIPDFVGMEIGQVEEIYDRLIEYGILEPVRTRREVQLEARGRSIAG
FT                   EAVDDQ"
FT   gene            complement(249870..250748)
FT                   /locus_tag="Hmuk_0253"
FT   CDS_pept        complement(249870..250748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0253"
FT                   /product="Protein of unknown function DUF439"
FT                   /note="PFAM: Protein of unknown function DUF439; KEGG:
FT                   hma:rrnAC2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46390"
FT                   /db_xref="InterPro:IPR007381"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX25"
FT                   /inference="protein motif:PFAM:PF04283"
FT                   /protein_id="ACV46390.1"
FT                   /translation="MSESVIADFVGNFNAEVMATTEPVKGRVLLSQKRLVLAANENDKF
FT                   TIPLSSIFDVAVGHVPPDLGDFFDSTVTVAFERNDSRHVAVVEGDDDKISKFSTVLFKA
FT                   ILNGTETTVKERARVGGRVTDDAFSTAKLFVSDGSVEFRSSDGVFVVDLATVTDFQRTT
FT                   REIAGSDRPTLTFRHMMDGTAVTTMAAMASPRKMSILGRYLRIEYSDLMEDLQDIELTD
FT                   DKTEILVAIYSTGDMDGMPLADIVGTDSSAVTMLLRDLEEDGLVQDSSDGPKLTPKGEV
FT                   VASRHLEDVNS"
FT   gene            complement(250838..251266)
FT                   /locus_tag="Hmuk_0254"
FT   CDS_pept        complement(250838..251266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ1071A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46391"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX26"
FT                   /inference="similar to AA sequence:KEGG:HQ1071A"
FT                   /protein_id="ACV46391.1"
FT                   /translation="MADRLPSDHEAVETRRVEVASVGRTDRPRIELPADLDVAAGDVIE
FT                   CVLDGEQYHARVETTLDGEPMLQHAADNRRLAREGDGENRLVEWFADSDCAIGGSVHLD
FT                   VVTAGYTYGLRTPGSRVVYTATDSPDDSLASIADDLGE"
FT   gene            complement(251268..251660)
FT                   /locus_tag="Hmuk_0255"
FT   CDS_pept        complement(251268..251660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0255"
FT                   /product="Ribosomal protein S6e"
FT                   /note="PFAM: Ribosomal protein S6e; KEGG: hma:rrnAC2212 30S
FT                   ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46392"
FT                   /db_xref="GOA:C7NX27"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX27"
FT                   /inference="protein motif:PFAM:PF01092"
FT                   /protein_id="ACV46392.1"
FT                   /translation="MAEFTVALSDPETGTTYQLDVDGQDANRFMGRELGDEVEGSAVGL
FT                   DGFTLELTGGSDTAGRPMRADVRGVGTKSILTDGGVGYKPTRDGERKRITIRGREVSEE
FT                   TAQINAKVTERGSGDVADLLGESDDE"
FT   gene            complement(251790..252206)
FT                   /locus_tag="Hmuk_0256"
FT   CDS_pept        complement(251790..252206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0256"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: hma:rrnAC2215 deoxycytidine triphosphate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX28"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2215"
FT                   /protein_id="ACV46393.1"
FT                   /translation="MYEQYVEDAVHEPTQTADSGFDLTVSNVFEIVAPGRVDFGGGELE
FT                   PAQTTPHTSAKRDPADDYEWWQLRSGQYLIEYNESLTGTATVTFQPRTELLERGLSHPT
FT                   LHVDALPRVPITVGGAGVAIKENARVSTIVDAEE"
FT   gene            complement(252248..253327)
FT                   /locus_tag="Hmuk_0257"
FT   CDS_pept        complement(252248..253327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0257"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   hma:rrnAC2181 aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46394"
FT                   /db_xref="GOA:C7NX29"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX29"
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /protein_id="ACV46394.1"
FT                   /translation="MDDRVREHADVLVDWSARIEAGDDVIVQVDEGAHDLGVAVAAALG
FT                   ERGANLLATYGSDEMTRAYLRAHDGDFDADPEFERALYERADSVLSLGGSRNTAAASDV
FT                   PGDRRQSYRRARTEIRAARMDTDWVSTQHPTRAMAQQAGLSSEAYRDFVYDATLRDWES
FT                   LAEEMDQLKTLLDEGREVHLLGEGTDLTMSIADRVAVNSAASVAYDSHNLPSGEVFTAP
FT                   TATEGTVTFDVPMTVDGTRVRDVRLVFEDGEVVDYSAAQGESTIGELLATDAGARRLGE
FT                   LGIGMNRGIDRITDNILFDEKMGGTVHLALGRAYDACVPDGGNDSAIHVDLITDLREDG
FT                   RLLIDGETVLEDGRFRWER"
FT   gene            complement(253406..254416)
FT                   /locus_tag="Hmuk_0258"
FT   CDS_pept        complement(253406..254416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0258"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: hma:rrnAC2929 glucose-fructose
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46395"
FT                   /db_xref="GOA:C7NX30"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX30"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46395.1"
FT                   /translation="MPVPIALSRMEFGVLSTAAIGREDVIPAIQASEHAVGAIASRDAE
FT                   RARSVADELDIDRSYGSYEALLADEGIDAVYNPLPNSLHAEWTRRAADHGLHVLCEKPL
FT                   TPDAEQARALFDYCDRQGVTLMEAFMYHFHPRTERAREIVREELGEVRHVEATFTFGMG
FT                   DRTDDIRLDPALDGGSLMDIGCYAVSAVRNVLGEPNRAFAHAADTYDTGVDSQLSGLLT
FT                   YDDGVTAQITSSFDTPMTHEYRIMTADGWLHVPEAFDVAPDQSVSLTYQVDGQRHTETI
FT                   DGVDHYRRQVESFADAVAADETPPVDRTETVDNMAVIDALYESAETGEPAAVDGE"
FT   gene            254568..257768
FT                   /locus_tag="Hmuk_0259"
FT   CDS_pept        254568..257768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0259"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: hma:rrnAC2425 MCP domain-containing signal
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46396"
FT                   /db_xref="GOA:C7NX31"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX31"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACV46396.1"
FT                   /translation="MSMDLKVKLVVLMLAISLLPLGSVGALATQNMGSLNQDAQDRSAQ
FT                   ELRGAMTDDLNNSVRARQSSLQNQFDQREVDMRSLAQSGAMDNYQAARQGKMQLVQEAS
FT                   QRQVGYTALEMRNAIESTTQTVLDTEYDGREWEELSPREQRAVKQRVERIIAGTDGDGT
FT                   TADGTMDETFQPGYIGETGYAYVTDLDSNVVVHHRLEDGHNFADDSGGSLTVFDDIKAN
FT                   IESTPALRNGETWGVAEYEWEDTTQDGNPTETQLVAYTYYEPFDWIVAPSVYYYELQER
FT                   AVADSEARLADSFEQYLETRTVSVNREQRYAYDEIIFVDKRGREVISATREGERAVTER
FT                   DGSGWHADKSWFTSAGAVANGEVAFNRIEEENGSQRMYVSTPVYQDGRFRGVVVAQFNY
FT                   SIVTEITNGVSVGETGYLYVVNDRGEMVSHPNETKVAQRVDVAGGEYGEELGNITTEQM
FT                   LAARSGMATHTRTVGGEETTRYVVYAPLQVGDRQFSLVGTVPESDIEGPIAALGDALQQ
FT                   RTDDARNLILLLSGIAALVVVAAGYAVARYVASPIEQMRDRATEMAQGRFDGELDVDDR
FT                   DDEIGEMVEAFEEMEANLTRQITEIEAVSASLSEGEIDDDLHTDLPGSFGDIMTDLQDG
FT                   MTQLRTSFAQISRASENVRTGKLDQEIDSDLPGEYGAVMDELDAGLQQLSESFDRLRTA
FT                   STALSERRLDEDLGTDLPGAYGDVMTNIDAGLDAVEESIARVQSIAREVSSATDDAAAS
FT                   AQEVERASQEVAESVQEISHGADRQSEQLQEAAAEMNDMSATVEEVASSAVDVANTSER
FT                   AADRAEAGSERASEASREIEGIEAETEQAVEQVAALESEIDEISEIVSMITDIAEQTNM
FT                   LALNASIEAARAGEAGEGFAVVADEIKGLAGEAAAATEEIDGLITELQATTGETVDDIE
FT                   SMRDRVENGADTIEDAIAMFDEIAESATEAEHGVREISEATDDQAASTEEVVAMVDEVS
FT                   SVSQQAAAEATSVSSAAEEQAASVNNISQNVRSVADMADDLEALVEAFEVQQSAADGDA
FT                   SAAGASADGGWSPDDGAE"
FT   sig_peptide     254568..254654
FT                   /locus_tag="Hmuk_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 29"
FT   gene            257865..259034
FT                   /locus_tag="Hmuk_0260"
FT   CDS_pept        257865..259034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0260"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   hma:rrnAC2241 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46397"
FT                   /db_xref="GOA:C7NX32"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX32"
FT                   /inference="protein motif:PFAM:PF01729"
FT                   /protein_id="ACV46397.1"
FT                   /translation="MTESFDIVSPEQIRSGRATDAYFDRTIEALDHAGKNPHVVAEVTA
FT                   DQFPTGEWELLAGLKDAAHLFEGRGVDVDAIPEGRLFDGGPVARIEGPYREFCRLETAL
FT                   LGFLSHATGVATRALEARRAAPDSQVLSFGSRHVHPSIGAMVERSALLAGLDGISNVAA
FT                   GEVLDRAAGGTMPHALVICFGRGNQEDAWRAFDEAVDADVPRITLCDTYSDEVDESLRA
FT                   AAAIEDLESVRIDTTGSRRGDFEHILKEVRWTLDAHGHEDVGIFASGGLGPTELARLSG
FT                   VVEGFGVGGYVSNADPVDFALDIVEVEGEPAAKRGKLTGTKQVYRTPDGGHHVGLADRA
FT                   GPTDGQALLEPLVRDGTVVREFDLDAAAQRAADDADAVGFEPVDGGTKA"
FT   gene            259558..259767
FT                   /locus_tag="Hmuk_0261"
FT   CDS_pept        259558..259767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46398"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46398.1"
FT                   /translation="MLPRDMKGLLNESTATVHKYEPQRDRGVTECGATTTVTHDQMRVL
FT                   PVEQAIDERDASKCGRCFGDGGGY"
FT   gene            259859..260152
FT                   /locus_tag="Hmuk_0262"
FT   CDS_pept        259859..260152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46399"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX34"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2131"
FT                   /protein_id="ACV46399.1"
FT                   /translation="MDRQALDEALADRYDADERSRRIVSRQAQDLADSCRIARDLGYPL
FT                   SVEDVLANLDDAPEGHTLVERWNWWLGALDLSHGGYERFRVRPDVAGLDQSE"
FT   gene            complement(260446..261291)
FT                   /locus_tag="Hmuk_0263"
FT   CDS_pept        complement(260446..261291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0263"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hma:rrnAC2951
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46400"
FT                   /db_xref="GOA:C7NX35"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX35"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46400.1"
FT                   /translation="MVHNESDTFDVGGELTVNRLGYGAMRLTGEDIIGLPADEDAAHEL
FT                   LEHADEIGVDFVDTADSYGPGVSERLIGEALDVDRDDLVVATKGGLLRNTDGDWLPHGD
FT                   PDYLRNAVLCSRDRLGTDRIDLYQLHRPDPDVAFEASVTALAECKDEGLIDHVGLSNVT
FT                   VEQLETAEEIVEIATVQNEYNVANREDEAVLEACEQKGVGFVPWFPLGAGDLGEKRSVV
FT                   EDVAQAHDATPYQIALAWLLAHSDVMLPIPGTSSVDHLEQNVAASTIELTTDEYNRLTE
FT                   "
FT   gene            complement(261413..262384)
FT                   /locus_tag="Hmuk_0264"
FT   CDS_pept        complement(261413..262384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:pNG7056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46401"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46401.1"
FT                   /translation="MSHWSRRSLLTAVGLAGVGSLAGCGALESTADAPQLSYTLSVDEI
FT                   GETLLDRVGWSPGDGDAPWAAEQRRLYDAVVDGERYTTVGYDLVPDEQTYVEHEGTYYE
FT                   LHSTPTDLREVERSVLRLEWIGRRDELDDPPAAIEREDLPAIDARAVFPAYVVARAREH
FT                   GGGYPHDIVEEGGYVYRFLDDSESELAPDPDHRHVSVHDTILEVSVTRRRLEEPVYTAM
FT                   AIEIADTEAAFERALDGALVDVRVDEQFPDEQRRLFQRASAGEYEETTPLSEEYRGLLR
FT                   ALERHDLLDADPERQRPRFESGVYLKYDDRFYRFDVYVNPAD"
FT   sig_peptide     complement(262289..262384)
FT                   /locus_tag="Hmuk_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.498 at
FT                   residue 32"
FT   gene            262638..263873
FT                   /locus_tag="Hmuk_0265"
FT   CDS_pept        262638..263873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hwa:HQ1821A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46402"
FT                   /db_xref="GOA:C7NX37"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46402.1"
FT                   /translation="MFETRSTLALLCAGLLVSGGAVGAAGGQSAEQVTLTVTVVDSDGE
FT                   SLGGIDLTASWDTEGGGSIDETTRSNGQVLIDVPAGADVTITVDDDQYVRNEPFVAENA
FT                   TTERVDVPVTVAGTAEIEVVDADGRVDNATVRLSRSGTTVMDARTNASGAATSQMIEQG
FT                   TYALSVWTDGYLRNRTRLTVDGDVTRRVEIRRASRLVTFSVTDDHFAEPRAIENAQITV
FT                   AGNTVTTLSNGEATIRLPVNSNYEVEITKAGYETVTQSLTIRESAVQRNVSIQRTDAIS
FT                   IESDQTQVVVGQSVRVTVTDEYGSAVENASVSVGGEAVGQTDGSGEIAVPVDDTGEVEI
FT                   EAASDDLSATTTVEGIDPNADDETETTDSTATATATEQTTTEPTSLTGPGFTGLGALLA
FT                   GLVALALLARRQ"
FT   sig_peptide     262638..262712
FT                   /locus_tag="Hmuk_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.486 at
FT                   residue 25"
FT   gene            263921..265009
FT                   /locus_tag="Hmuk_0266"
FT   CDS_pept        263921..265009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0266"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="TIGRFAM: folate-binding protein YgfZ; PFAM: glycine
FT                   cleavage T protein (aminomethyl transferase); Glycine
FT                   cleavage T-protein barrel; KEGG: hma:rrnAC2552
FT                   aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46403"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX38"
FT                   /inference="protein motif:TFAM:TIGR03317"
FT                   /protein_id="ACV46403.1"
FT                   /translation="MTVIEGVHEDRGATFRTVGGNRVVANYGRPERVHRAVRQVVGVIE
FT                   MGYGVVTVTGDDRIDFVDNAVSNRVPTADGDGVYSLLLDPQGHVETELYVYNAGERLLL
FT                   FVPPARADPLVEDWREKTFIQDVTIADATDEFAVFGVHGPKATEKIASVLNKTATPETP
FT                   LSFVRGSMVDAGVTVVRSDGLVGEEGFEVVCSADVARDVYDTLENRGLNAAPFGYDTWD
FT                   ALTLEAGTPLFDTEIEGQIPNVVGLANGVDFEKGCFVGQEVVSRVHNRGRPSKRLVGLT
FT                   CGAVPESGAAVFVDDASVGAVTRAVESPTREEPIALARVDYELPDGTPSVRVDGGEVDA
FT                   ELAALPFVTGSDESARLPRYER"
FT   gene            complement(265046..265429)
FT                   /locus_tag="Hmuk_0267"
FT   CDS_pept        complement(265046..265429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0267"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: afu:AF1479
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46404"
FT                   /db_xref="GOA:C7NX39"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX39"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV46404.1"
FT                   /translation="MIAFDTCFLLDYLDGVDAAGAYLEAHEDKPLFAPSLALFEVYRGA
FT                   ARTDGVDGIERVASALDWLEPLPLSEPVTREAALIEAELLDAGERINLGDTLIAGVCRH
FT                   NGASLVTRDEHFERVSALETESY"
FT   gene            complement(265426..265650)
FT                   /locus_tag="Hmuk_0268"
FT   CDS_pept        complement(265426..265650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnB0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46405"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46405.1"
FT                   /translation="MGTKSLTITDEAYERLREHKREDESFTDVINRLTGSDRDVMKGFG
FT                   AMSGVDGFREAVTATRDDLDGDLRERSER"
FT   gene            complement(265827..266912)
FT                   /locus_tag="Hmuk_0269"
FT   CDS_pept        complement(265827..266912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0269"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; FAD dependent oxidoreductase;
FT                   KEGG: hma:rrnAC2126 geranylgeranyl hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46406"
FT                   /db_xref="GOA:C7NX41"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX41"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACV46406.1"
FT                   /translation="MHDFVVVGCGPAGARFARRASEAGHDVLAFEQGTVGEPLACSGHV
FT                   STDIWEFVPDDARDELFQNEIRGARFHRGGPDSEAHRFYKDEAISNVIDRVGLDRRLAD
FT                   CAREAGVDLREEHTVLDVTERTDHVTVEVRGPDGTETHDARMVAGCDGPQSRVRRALDL
FT                   PEPGELLHGVLGFTETVDRQHFVDVHLSVPRFFAWRIPRGEAGVEYGLATPPGHDVSER
FT                   FEAFTADYGVDTDRRCSGLIPIGPPKRVTGRRSFLIGDAAAQTKPFTGGGILYGMTAAD
FT                   HAAREIDPDRPGTLGDYERAWRDDLRTDIRLGHLVRAGYSLPGVVQKAGMKAFEGEIGV
FT                   HMDRPSTLFSREQLKALLTRS"
FT   gene            266986..267372
FT                   /locus_tag="Hmuk_0270"
FT   CDS_pept        266986..267372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46407"
FT                   /db_xref="GOA:C7NX42"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX42"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2124"
FT                   /protein_id="ACV46407.1"
FT                   /translation="MAGYQPGVCNIGRDERRKRRVAGIAGFLGAAAYVAAVLWFGLPDR
FT                   YVLGSFAFLFGGFVGVFQDYFRFCVAFGALARYDLSGSSDDAGSVTDADAVARDRKRAA
FT                   QLLTYAAVSAAVLTALAYAAVTAL"
FT   gene            267450..267725
FT                   /locus_tag="Hmuk_0271"
FT   CDS_pept        267450..267725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46408"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX43"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2071"
FT                   /protein_id="ACV46408.1"
FT                   /translation="MLGSRSSRDVVTCIACGESVSRSDAREYDKHGDRWDRTDKEFEYL
FT                   CKPCHSDLTHQPRPGLEDLLETVEADADDRDSFLRRYVELAEEKRR"
FT   gene            268118..269431
FT                   /locus_tag="Hmuk_0272"
FT   CDS_pept        268118..269431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0272"
FT                   /product="ribonuclease II"
FT                   /note="PFAM: ribonuclease II; KEGG: hma:rrnAC2072
FT                   ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46409"
FT                   /db_xref="GOA:C7NX44"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX44"
FT                   /inference="protein motif:PFAM:PF00773"
FT                   /protein_id="ACV46409.1"
FT                   /translation="MSNEDAQAEAGTPEGQGPVEIDEEMARHMANKREELFEKFEIRDA
FT                   FPPEVMEEAEARTTDVQAEIADEVDEREDLREMTTWTTDPIDAQDFDDAISVEERDDEY
FT                   VLWVHIADVTHYVNPDTAMWEEAVERGNTVYLPGYTIHMLPPMLAETVCSLVPNEDRLA
FT                   HTVEMHLDKDDLGYEEIDIYKSVIRSDARLTYTEAERLLDEPETAEELLEDQRVDLAEK
FT                   TELIWNLADAMHEQRKEEGSLVLNPARDRAHTIIEECMLKANKAVTHELMWDRGVEAMY
FT                   RVHPQPSPEEWDEALVEIQELDGVSIPGDAWDDPRKAVNATLEQAPGRQLDKIQWAVMK
FT                   VMPRAKYMNDPFGGHHALNFEIYGHFTSPIRRLSDLINHWIVYTNDVPEDLIALCDRAS
FT                   DKQKAAETCEREYKQFLEEIGLDPSAVNNRGLEVVDED"
FT   gene            complement(269649..270014)
FT                   /locus_tag="Hmuk_0273"
FT   CDS_pept        complement(269649..270014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0273"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: hsl:OE2047R
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46410"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX45"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACV46410.1"
FT                   /translation="MDRTGDEYSVGNGGHDMGPLTAAAAIVGKKWHPRIVVELLRDGPL
FT                   GFNDLKESVDGISDKVLSESLDDLQERDIVHRTVIDDKPVRVEYSLTEWGEELEQVVTA
FT                   MDEWGTRYLDRTDESAE"
FT   gene            270247..270471
FT                   /locus_tag="Hmuk_0274"
FT   CDS_pept        270247..270471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46411"
FT                   /db_xref="GOA:C7NX46"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46411.1"
FT                   /translation="MTASTKRNVPRNGNRTALSRYDLVLAVIPTAFVVALLSNVLFGIP
FT                   LRTVLPASSLVGVLALADTLYVNPPIDGR"
FT   gene            270549..270707
FT                   /locus_tag="Hmuk_0275"
FT   CDS_pept        270549..270707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46412.1"
FT                   /translation="MKPTGELPLSGASGSLSDRYVDEGETDRKRARTENGLANLVGHTF
FT                   YQSGYRI"
FT   gene            270815..271780
FT                   /locus_tag="Hmuk_0276"
FT   CDS_pept        270815..271780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0276"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   hma:rrnAC2069 phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46413"
FT                   /db_xref="GOA:C7NX48"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX48"
FT                   /inference="protein motif:PFAM:PF00494"
FT                   /protein_id="ACV46413.1"
FT                   /translation="MVDTDDIKASKSIQQRTGRTFHLATRVLPKRIRHATYVLYAFFRV
FT                   ADDVVDQPDGPGPAVQHERLEEIREAALGHASATGDDAAVLEAFAELRERHDIPDEEVN
FT                   VFIDAMEMDIARARYETFDDLVEYMRGSAVAVGNMMMDVMDVEQPETARPHAAALAEAF
FT                   QLTNFLRDVREDIHEYGRVYLPQATLAEHGVTEDDLAEATVTDDFRAVMQTELARTERR
FT                   YHEGVAGIRYLPEDSQFAVLLSAVLYAEHHRLIRARGYDVLTETPELTRRRRLWLLART
FT                   WWHWRRHHDPEAAFYAVSAISEPSPAAETPVGVRDSSQPA"
FT   gene            complement(271907..272497)
FT                   /locus_tag="Hmuk_0277"
FT   CDS_pept        complement(271907..272497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0277"
FT                   /product="Ribosomal protein L15e"
FT                   /note="PFAM: Ribosomal protein L15e; KEGG: hma:rrnAC2065
FT                   50S ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46414"
FT                   /db_xref="GOA:C7NX49"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX49"
FT                   /inference="protein motif:PFAM:PF00827"
FT                   /protein_id="ACV46414.1"
FT                   /translation="MARSSYSYIREAWQNPDDGKLAELQWQRQQDWREEGAIERIERPT
FT                   RLDKARSQGYKAKQGVVVVRTSVRKGGARKERFKAGRRSKRQGVTRITRRKDIQRVAEE
FT                   RATRTYPNLRVLNSYWVGEDGRQKWHEIILVDPEHPAIQNDDDLGWIADDDHTDRALRG
FT                   LTGAGKRNRGLDTRGKGAEHIRPSLRSNRGRGK"
FT   gene            272724..273614
FT                   /locus_tag="Hmuk_0278"
FT   CDS_pept        272724..273614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0278"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   hma:rrnAC2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46415"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX50"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV46415.1"
FT                   /translation="MRVVTLLPSATEIVYALGVEPVGVSHECDYPPAASEQPSVNRSRV
FT                   DPTAASGEINEQVAAAEEEGVYAIERETLASLDPDLIVTQGVCDVCAVDHVVVEDAVAE
FT                   LGLDAEVLTLDVHSLDDLFESIQRIGDVLGRGERASELVGDLRSRVAEVETTAGRAEST
FT                   PSVAVLDWTEPVMVAGHWVPEMVASAGGEYGLESAGAHSRPREWDEIRAYDPERLIVSP
FT                   CGFDLAQIRENLTDLTERPGWAELSAVRNGHVTLVDGHHYVNRSGPRLVDTLEFLGWAI
FT                   HPDPFDRPPRDAVSR"
FT   gene            complement(273604..274425)
FT                   /locus_tag="Hmuk_0279"
FT   CDS_pept        complement(273604..274425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0279"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: hma:rrnAC2090 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46416"
FT                   /db_xref="GOA:C7NX51"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX51"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACV46416.1"
FT                   /translation="MVDLDPEQLDRYSRHVIMDDVGPSGQAALLDASVLVVGAGGLGSP
FT                   VLQYLAAAGIGRLGIVDDDVVERSNLQRQVLHTDDDVGRPKVDSASEFVADRNPDVTVD
FT                   AYETRLTRDNAEEVIADYDLVVDASDNFGTRYLVNDACTLAGTPVSHGAIYRFEGQVTT
FT                   FSGEGPCYRCLFPSAPPEGAVPDCATAGVLGVLPGTIGCFQATEVVKWFLDEGESLDGR
FT                   LLVYDASEMSVDEVPIAPNPDCPVCGSDPALSSVTEAEYDGRCSLSESVSD"
FT   gene            complement(274462..275451)
FT                   /locus_tag="Hmuk_0280"
FT   CDS_pept        complement(274462..275451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0280"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: hma:rrnAC2091 MCP
FT                   domain-containing signal transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46417"
FT                   /db_xref="GOA:C7NX52"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX52"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACV46417.1"
FT                   /translation="MSDTEPRAEPDLSTASDLDEDLDTDIDDQIEQRVDRQAGYDNDAA
FT                   SEIQTSIAELQASSEDIAQEVDDIRGRAAEQHEGMSQIAEEVSNLSAAVEEIASSSEQV
FT                   STATEEATALADRGQENAQDVYGAMERIQGAADSVTEDVRTIQRSVAEIDEIVEVINDI
FT                   ADQTNMLALNASIEAARAGEAGEGFAVVADEVKSLAEQAQSEASEIEQMVGRIQGNTEN
FT                   AVDSLETSNAEIDEGIESVEESVEILDEIGDAVREVNDGIAEVASATDQQAASTEEVAS
FT                   MVDQATAAAEEIAESTAAIAGEADDQTEQIADINRAVDELVADWQAQR"
FT   gene            complement(275649..277178)
FT                   /locus_tag="Hmuk_0281"
FT   CDS_pept        complement(275649..277178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0281"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: hma:rrnAC2092 carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46418"
FT                   /db_xref="GOA:C7NX53"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX53"
FT                   /inference="protein motif:PRIAM:3.4.17.19"
FT                   /protein_id="ACV46418.1"
FT                   /translation="MATEADADDAETPDTYEQFRAHVEQLTYVGDAAGVLQWDQEVMMP
FT                   DEGTPARSKQSAALSTLSHDLLTDDDVAEWLDELEGSDLDPEREAVVREIRRQHDRAAK
FT                   VPSDLVQRISEATSNALPVWKEAKAEDDFEIYADTLEELVQLKREYAEAIDPDRDPYAV
FT                   LFEEYEPYLGLDTAEAALEDLRDTLVPLIDDIKDSDVTLADPFAGGSYDEASQEDLVRS
FT                   ALDYLGYDWDRGRLDTAPHPFSTGTQFDARVTTRFDPEDPLGALSSTIHEFGHATYTLG
FT                   LPDEHYGTPLGESRDLSVHESQSRLWENHVGRSRPFWEGFAPTVEDHLATSATPREYYE
FT                   AANTVHPDNCIRVEADELTYHMHIVLRFEIERDLIHGDLDVSEVPQVWNDKMEEYLGVR
FT                   PETDAEGCLQDIHWSHGSFGYFPTYSLGSVLAAQLFAAAEDDIGDLDGQLRDGEFDDLH
FT                   EWLTDNVHSHGARYETDDLIEEATGEPFTADYFLEYAESKYRDLYDCYSNN"
FT   gene            277257..277643
FT                   /locus_tag="Hmuk_0282"
FT   CDS_pept        277257..277643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0282"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rxy:Rxyl_2374
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46419"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX54"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACV46419.1"
FT                   /translation="MERETVDSGTEWEAEVGYSRAVRVGDRIEVSGTTATDEAGGVVGV
FT                   GDPYAQAAKAIENIETALETAGAGLEDVVRTRMFVTEIENYEAVGRAHREAFGDVRPAT
FT                   SMYEIERLVDPDLLVEVEAVAISE"
FT   gene            278047..279162
FT                   /locus_tag="Hmuk_0283"
FT   CDS_pept        278047..279162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46420"
FT                   /db_xref="GOA:C7NX55"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46420.1"
FT                   /translation="MADSNSVNEVDIDKRELLKAIGSVGATGGFLSSTASAGQIEEEEV
FT                   DLDEFATKPIYELAIDVIEHPKHSMLAFTTSVIDESLGLYIATGVSKPKNSYLPREGTP
FT                   PGRRATEVIKVAEAKTGAIMQLEWHSKTEISYWEAGEIIATDVSDITNKLDTGNNGRRS
FT                   HRNNSKGPSVEIQSQPSDRKKRVVSKQTAPDSLQGIIETQSETPSTEITTQQFDPSRCN
FT                   IPKLPQVGIEECQDAGAFGEFCAKTTSIGCMRKQCSWGKTPPLLSVPVTIAEGNVGDGK
FT                   VYIDMWAGLEITDSGKYCVWLGSEAAGVCVTDCYRDRPDTAEATKLAEDFVPEIDLFGA
FT                   AKFVGEVIVTLIALIILAIVAAAAGITGVGA"
FT   gene            279617..279775
FT                   /locus_tag="Hmuk_0284"
FT   CDS_pept        279617..279775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46421"
FT                   /db_xref="GOA:C7NX56"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46421.1"
FT                   /translation="MVLALAFVMLAPVVLTATVYGIALAALGEPLLAGAVALVCRAMLL
FT                   ILPAVPS"
FT   sig_peptide     279617..279694
FT                   /locus_tag="Hmuk_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.675 at
FT                   residue 26"
FT   gene            280130..281911
FT                   /locus_tag="Hmuk_0285"
FT   CDS_pept        280130..281911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0285"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: hma:rrnAC1626 HTR-like protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: PAS fold-4 domain protein; PAS fold
FT                   domain protein; PAS fold-3 domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46422"
FT                   /db_xref="GOA:C7NX57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX57"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV46422.1"
FT                   /translation="MAPRHTGTSQLLHVGERETLLREASGAVDAGGGDVAVTTVDSIEA
FT                   ADERIDRGNVDCVVYEHGASGEEPESLRKLADRASATPWLFLTSDETAVDDALRAGASD
FT                   VVVLRENTDRRLLSRRLEHILARQRLGESETGATSTMTEALRSDRAATDLLLDTLDDVF
FT                   YLVGTDGTLERWNESLKTVTGYSDAELAEMNAIALFEESDRRRVDEAVAETLETGSSSV
FT                   EASFVTTDGETIPYEFTGARLADDGDVRGLVGIGRDISERKALEAELRRKASLLDHIFN
FT                   QVPTALYVKDTEARHVRMSEFHSDAEGTLGKTDPEIYGETEYTESTYADDMRVIEEGDR
FT                   IINQEEFNPRTGEWSLTSKVPWRTEDGEIQGLIGVTRLITEKKEYEQKLNLRNRAIAEA
FT                   PIGITIHDAMEPPGRIVYANDSFQSLTGYDEPALDGEDLTILAGAETEPGQLDRLDTAF
FT                   HDSESRSLVALLYRRDGTPFWGRITVAPVTDDDEVTHFVGFLQDVTETKERAEEIERRL
FT                   DEFGELIAEELRTPLERAEQSVAAIADPSQQAAVENAVESIRRADKLVDDLAAVHSFSV
FT                   KSRDVFETASTSQSEDR"
FT   gene            281961..282722
FT                   /locus_tag="Hmuk_0286"
FT   CDS_pept        281961..282722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0286"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: nph:NP2906A response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46423"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR040726"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46423.1"
FT                   /translation="MNFPADSVVVFEENRTRGELYSLWLDEYDVDVAATKQEADAELDG
FT                   AVVVAVLNQGFADGAASKLLEIVRSRAPLCRVVATRERSDPFPDLNVDHQLVKPVFEEE
FT                   LVDLVETLLCRANYHLALSRYYQTNVDLSSFEVHDGDHPPDRTEYDELQQRASKLQKFI
FT                   ASLTKEMEQEDIRAVKRDILLERDIEETHSTEKIDSKYRPRKCTNCGQRWDGNADGEPG
FT                   VTQLGAYVWRCGGCGHVQMAADPSHQHVNRW"
FT   gene            complement(282754..283875)
FT                   /locus_tag="Hmuk_0287"
FT   CDS_pept        complement(282754..283875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0287"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: hma:rrnAC2095 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46424"
FT                   /db_xref="GOA:C7NX59"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX59"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACV46424.1"
FT                   /translation="MHVADLTRELVSIPSHEDEAAAGDYIEEWLREHTDSAVFRDEHGN
FT                   VFARKGPGVDSAGDSVARDGAGGASLALAGHHDVVPPDESQVDDDGAYRVEQRDGRLYG
FT                   RGAADMKGAVAAAMLSFRDATDLDCELVFVSFVAEESGCLGSTAAIDDGFAPDYAVVGE
FT                   GSTGYSAEGVTDVAVAHKGRRGSTIEATGTAAHASEVESGENAIYRASDAVDVVRDLSF
FT                   PSTTVMGHEVRGSVAVTEIDGGSAWNVIPESCAVTVDERTVPGERASIERVEAIDGVEW
FT                   TVDQDLPPMACEDEAFADLVLDAATATQDGAPEHVVKPHATDAGNLAGAGTDCVVVGPA
FT                   QPGEAHTADESVSIDVLERCVAIYRDVASEVAR"
FT   gene            283968..284972
FT                   /locus_tag="Hmuk_0288"
FT   CDS_pept        283968..284972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0288"
FT                   /product="protein of unknown function DUF368"
FT                   /note="PFAM: protein of unknown function DUF368; KEGG:
FT                   hma:rrnAC0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46425"
FT                   /db_xref="GOA:C7NX60"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX60"
FT                   /inference="protein motif:PFAM:PF04018"
FT                   /protein_id="ACV46425.1"
FT                   /translation="MTTSSSEATDSDFSSVPSLRRWLKTFVIGLCMGSADATPGISGGT
FT                   VALIMGIYERLIAAITAITPERARRFLRALTPVDGGVSLRRAVAVLEEVDVWFLLALVG
FT                   GVGTAVVIVARIVHVASEETPVLLYGALFGLIGASAVILLRALSIETATHAVAAASGFV
FT                   LAFVLSGPASPLGTEGLLVVFLGGAVSVSAMILPGISGSLLLVVLGQYERLSGALTTFV
FT                   DGLLAVLTGRPAAGLVDAGTVVVTFILGGLVGLFTISRLIRRALDRNRGATLAFLVALV
FT                   VGALRAPITELSTREAVTWTTETIAVFAAVAAAGAVVVLVLDWYAVDLDFEAV"
FT   gene            285064..285240
FT                   /locus_tag="Hmuk_0289"
FT   CDS_pept        285064..285240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46426"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46426.1"
FT                   /translation="MRTIIKSVGENETFMADRFSYREIRAIEREYCRQNDNIVGFFGGA
FT                   DERSPERSSNGDD"
FT   gene            complement(285293..286555)
FT                   /locus_tag="Hmuk_0290"
FT   CDS_pept        complement(285293..286555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0290"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hma:rrnAC0944 putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46427"
FT                   /db_xref="GOA:C7NX62"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX62"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV46427.1"
FT                   /translation="MNDNDRSIVGFAMLAHATVHTYELSIPIFVVVWLQQFSTTTALLG
FT                   TIVAVGYALFGIGALPGGVLADLLSARTVVIGCLLGMGGSFLLLGFAPGIPTIALALGL
FT                   WGVAASVYHPAGLSLLSTGVSERGTGFAYHGMAGNVGIAFGPLATALLLLAFDWRTVAG
FT                   LLSIPAALAVAYAVTAEFDEMAAVRADGGADEGRGGGPSSLGEFVTGTRTLFTAGFALA
FT                   ICVVLMNGVFYRGVLTFLPDVLGGFLPPITDYVRLFDPGSPMAEEFDLASYVYAGLLTV
FT                   GIAGQYAGGKLTDRISVTTGLIGVFAALAVVAVLFVPAAQAGLGPLLAVSAVLGFVLFA
FT                   IQPLYQATIAEYSPPDDRGLSYGFTYLANFGVGAAGAALSGILLSAVGTDGTFLALAAF
FT                   PVLGAALAVALSRVGTRRGAA"
FT   gene            complement(286552..286710)
FT                   /locus_tag="Hmuk_0291"
FT   CDS_pept        complement(286552..286710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46428"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46428.1"
FT                   /translation="MLYLWVYSMIETDSAGPATGLGPVASARVETVERSARTQRRYEHG
FT                   WGVARCR"
FT   gene            complement(286831..288426)
FT                   /locus_tag="Hmuk_0292"
FT   CDS_pept        complement(286831..288426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0292"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: hwa:HQ1488A gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46429"
FT                   /db_xref="GOA:C7NX64"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX64"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACV46429.1"
FT                   /translation="MDPDLDRFDSRRSTVYANRGVVSTSQPLAAQAGVRLLREGGNAFD
FT                   AAVATAAALNVVEPMSTGIGGDAFALYRTADGEVGALRSCGGAPQRATREAVRDRVDDG
FT                   EMPDFGPLAITVPGAARGWEHTVEAHGRLALGDVLQPAIEYATEGYPVSEIIADAWAAC
FT                   AQRFVSDAGREAYLPGGEAPDVGQTVTLPGLGETFETVAREGADAFYEGAIAERIGQAV
FT                   QAEGGLLSADDLAGFTPDVVDPVSTTYGGATVYELPPNNQGLIALEALNVAAELGAGDH
FT                   PAGSPERVHYFAEAMKRAFHDGHHYITDPDFESVPDLHDPAYASERAATVDETAGEVSV
FT                   GGPGLPDEDSDTVLLTVADEAGNVVSFINSLYNGFGSGVVVPDTGIVLQNRGASFSLDP
FT                   DHPNTLEPGKKPFHTLIPGLVELDDEDWAAFGVMGGYMQPQGHVQVLSNLIDDEMPLQR
FT                   AFDAPRWRYMEDGRLALEERLAGEIGADLARREHDVAVLPPRQFGGGQIARREPDGTLS
FT                   GATEPRKDGSSVGF"
FT   gene            complement(288502..289266)
FT                   /locus_tag="Hmuk_0293"
FT   CDS_pept        complement(288502..289266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0293"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; PFAM: PcrB family protein; KEGG:
FT                   hsl:OE3699R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46430"
FT                   /db_xref="GOA:C7NX65"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX65"
FT                   /inference="protein motif:TFAM:TIGR01768"
FT                   /protein_id="ACV46430.1"
FT                   /translation="MNLDWDDITHVTKIDPAKDLPRDIGVLSETDAIIVGGSDGVTAEN
FT                   TLAVIEQIGEAVPSIPILQEPYSSDHVSTDTIDAVDLLAIPAVYNGDREHFVGKHLDLF
FT                   TEVGNKPEELFGTGLPVLGDLIASKGLDAVARMADKIVGEGYVIQNIESKAATVSGVET
FT                   AYTTEQVAGAALATEAFYGFPIFYLEYSGTYGGPEEVEAAASHLDDATLVYGGGINSRR
FT                   RAREILDAGADAIIVGDCFHEDPEQFRATVPS"
FT   gene            complement(289411..289785)
FT                   /locus_tag="Hmuk_0294"
FT   CDS_pept        complement(289411..289785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0294"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: nth:Nther_0290 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46431"
FT                   /db_xref="GOA:C7NX66"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX66"
FT                   /inference="similar to AA sequence:KEGG:Nther_0290"
FT                   /protein_id="ACV46431.1"
FT                   /translation="MSGIVFFRTENRAETVSFYTDRLGFDVWLEQDGGCTILAYDNLLV
FT                   GFCDGTETETDGIVTVVLDDEAAVDDCHADLADVARGPPKPNDDFGIYQFFATDPDGRT
FT                   VEVQTFQHETPPVGSSSFSE"
FT   gene            complement(289950..290741)
FT                   /locus_tag="Hmuk_0295"
FT   CDS_pept        complement(289950..290741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0295"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hwa:HQ3624A ABC-type cobalt transport system, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46432"
FT                   /db_xref="GOA:C7NX67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46432.1"
FT                   /translation="MIEASGLAYRYEDGTTAVDGVDLTIEAGERVALLGPNGAGKSTLL
FT                   LLLGGLLPPDDGSVRYFGTDQPGDAVRDRLGVLTQDPGEYLFNPTVREDIEYGPAQLGL
FT                   SAAEADRRVAELAERFDLEHLLDRPPFRLSGGEQRRAAIASVLSVDPDVLLLDEPLSNV
FT                   DGNNEAELLDLLDELSADGVTIVTSTPDTDLVAAVADRVVLLGRDGRVVATGSTREVLT
FT                   DTDRLREAGLAPPTVVELFDRAGFEDLPVRVEEAVERLRRQ"
FT   gene            complement(290753..291550)
FT                   /locus_tag="Hmuk_0296"
FT   CDS_pept        complement(290753..291550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0296"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   hma:rrnAC2280 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46433"
FT                   /db_xref="GOA:C7NX68"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX68"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ACV46433.1"
FT                   /translation="MDALDRTVAAVSDEAQSFLVTTRTPRRDGFMQAVDPALKLVGVLS
FT                   LLVVAVVTDDLAILCGLAALPMGLAIGSRIAPLRLGRRIAPPVLASAAVVAPQAVLQPG
FT                   PTVAALGPLSLSATGLSYVAVFLVRVTASLALLSVLLLTTGFGPLVTALRRLRLPPLAI
FT                   TLLAVTYRSLLLFFRELERMAHARRSRTFSRGSLRSRWARSGSFLGTFLLRSLDRGERV
FT                   QRAARARGGTRLRPYDRSGSPGRADAAFALLLVVVVVVRVIAA"
FT   gene            complement(291550..291858)
FT                   /locus_tag="Hmuk_0297"
FT   CDS_pept        complement(291550..291858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46434"
FT                   /db_xref="GOA:C7NX69"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX69"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2281"
FT                   /protein_id="ACV46434.1"
FT                   /translation="MSVASDAWDRSWVRRSLLAIAAIVAASPLFAWAAGRVGYAEPLEN
FT                   AAERTGAMAHEVTYNPGLLPDYAIPGLDPLVGTFVSAVVGTALTLVVATAIARLLAD"
FT   sig_peptide     complement(291757..291858)
FT                   /locus_tag="Hmuk_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.910 at
FT                   residue 34"
FT   gene            complement(291855..292496)
FT                   /locus_tag="Hmuk_0298"
FT   CDS_pept        complement(291855..292496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0298"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: hma:rrnAC2282 cobalamin biosynthesis protein
FT                   CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46435"
FT                   /db_xref="GOA:C7NX70"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX70"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ACV46435.1"
FT                   /translation="MHIPDGFLDLWIAVVCAALAGGTLVVAARRADGELTDTTAPVLGI
FT                   VAAGLFAAQMLNWPIPGGTSAHFVGGAFAAILLGPHLGALCVATVVTIQALVFGDGGLV
FT                   VLGANVLNMAVVEVYVGYGLYRLLAGHNEFVAAFVAGWLGITAGAVAAALQLGASSAFA
FT                   YELVTTVSIMGVGHLLLGLIEGGITAVVYRYVADARPDLFPTATTTEVAA"
FT   gene            292604..293014
FT                   /locus_tag="Hmuk_0299"
FT   CDS_pept        292604..293014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0299"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein DNA-
FT                   binding domain protein; KEGG: hma:rrnAC2283 CopG family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46436"
FT                   /db_xref="GOA:C7NX71"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX71"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ACV46436.1"
FT                   /translation="MSDDLDRISLTLPAEMTTRLDDIVDDWEYDSRSEAIRDALRDFFG
FT                   AYEWESADDTVHHGTVVVVHDHHVDGIADQLQTIQHEMADLITSVQHIHLSHDTCMETL
FT                   VVEGAGTAITELANRLRAIGGVNQVKVVVVGD"
FT   gene            293105..293347
FT                   /locus_tag="Hmuk_0300"
FT   CDS_pept        293105..293347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46437"
FT                   /db_xref="GOA:C7NX72"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46437.1"
FT                   /translation="MPAKSGASHSTGYLVSVVVSGLLIEHILAFAPSFRRVSRIAGELL
FT                   TAYTNVPISEEAAGMLLVTAVLVGVWGVGYHLYRH"
FT   gene            293401..295290
FT                   /locus_tag="Hmuk_0301"
FT   CDS_pept        293401..295290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0301"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; AAA ATPase; KEGG: hma:rrnAC2098
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46438"
FT                   /db_xref="GOA:C7NX73"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX73"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV46438.1"
FT                   /translation="MDIVPDTSVVIDGRVSERIEADADPDSEVEGTGFAGATVVVPEAV
FT                   VGELEAQANDGRETGWEGLEELQRLVSLDEDGTIDVEYVGRRPDAVEKREAGEGEIDAL
FT                   IRDVAQDRGATLVTSDDVQAEVASAKGIPVEFLDPIERTIDRLTIENFFDEATMSVHLK
FT                   VGVAPFAKRGSIGDMAYQPIRDDPATESELRGYAADIEEAAHASPEGFVELSEPGMTII
FT                   QYRDFRIAIARPPFSDALEITAVRPIVKTELDDYEHADELRDRLTDHQRGVLISGSPGA
FT                   GKSTFAQAVGEFLVDADYAVKTMEKPRDLQVGDEITQYTELGGSMEKTADSLLMVRPDY
FT                   TIYDEVRKTDDFEVFADMRLAGVGMIGVVHATRAIDALQRLIGRVELGLIPQIVDTVIY
FT                   IEAGEVHTVYDVTTEVKVPDGLMEEDLARPVILIRDFETGEPKYEIYTFNRQVVTVPLD
FT                   DEDGGGPGSDSGVDRIAKQEIEREIRSIAHGHVEVELKSPDTAVVWVEESDISQVIGKG
FT                   GGRITDVENRLGIDIDVRTLAEKPSGSSASSTAGGGANAPGQIVTPEITSRHVQIPMDG
FT                   HQGDTVEVQADGEYLFTATVSRGGEIQVSRGSAIAEELEQAIDRGKTITVVPS"
FT   gene            295312..296022
FT                   /locus_tag="Hmuk_0302"
FT   CDS_pept        295312..296022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46439"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46439.1"
FT                   /translation="MTFGIETAYVGCGRAGRALVRDGLEERTGEAATPDRGPDPRLLTI
FT                   DSGADEPAAVLAAFDVVVVTGAVDSPDARRQIAEVGRACPDDATCVGVVTGTTDRGIER
FT                   LGRACDTVVPVETDALAREFATDLLTWASEPMLLRTDSSQVYDDLDGAGVAAVDRVTGD
FT                   RTALPALVERASVDETADGQRLCFGYLAFGVDFTLADDERFRRLCDRPEVVTGRASLAE
FT                   PDACRLTAVRRVPE"
FT   gene            complement(296206..296874)
FT                   /locus_tag="Hmuk_0303"
FT   CDS_pept        complement(296206..296874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0303"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   hma:rrnAC2108 F420-dependent NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46440"
FT                   /db_xref="GOA:C7NX75"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX75"
FT                   /inference="protein motif:TFAM:TIGR01915"
FT                   /protein_id="ACV46440.1"
FT                   /translation="MEIALLGGTGDIGEGLALRWAADSAHDVLVGSRDPERAAAKATEY
FT                   ATALDDRGRDASVEGLGNVEAARRADVIVTAVPAYHLTDTVESIADELSPDDVLVSPAV
FT                   GMKRDEDGFHYNRPGVGSVTQLAANAAPDDVPVVGAFHNLAAGRLADLDADLDWDTVVV
FT                   GDETDAKDTVIELAESIEGLRALDGGPLANAAEIEGLTPLLINVARHNDGLHDLGVRFQ
FT                   "
FT   gene            complement(297019..297222)
FT                   /locus_tag="Hmuk_0304"
FT   CDS_pept        complement(297019..297222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46441"
FT                   /db_xref="GOA:C7NX76"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46441.1"
FT                   /translation="MDRTDLLWFVGLTVTLAVFGLVLGVLVVPPDPASQLFVGVQWVVL
FT                   SLVLAYLIVLRGEPGPPLLGDD"
FT   gene            complement(297261..298142)
FT                   /locus_tag="Hmuk_0305"
FT   CDS_pept        complement(297261..298142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0305"
FT                   /product="HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR01548"
FT                   /note="TIGRFAM: HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR01548; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: hma:rrnAC2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46442"
FT                   /db_xref="GOA:C7NX77"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX77"
FT                   /inference="protein motif:TFAM:TIGR01548"
FT                   /protein_id="ACV46442.1"
FT                   /translation="MHVDAVVLDIDGVLVDVADSYRRAIVESIERLYGETIDRSAIQSF
FT                   KDAGGFNNDWELTHAGALYVLASREGLDQTVEAFTDGIAQRGGGRDAAEAIVREALTPN
FT                   AREDVFDAWDPDQLRDVFQMLYLGAELYREIEGREPRIAEPGFVNDEPVIVDPETIAAL
FT                   QADYDVGVVTGRPAPEADIALERAGLDVADEHRFTMDDWEAGKPDPHALVTLAERFDAD
FT                   RIAFAGDTLDDVRTAVNANESDGRVYDGIGVLTGGLTGETGRQKFTRAGAAAVVESVDD
FT                   LPELLSPRSTDR"
FT   gene            complement(298171..298578)
FT                   /locus_tag="Hmuk_0306"
FT   CDS_pept        complement(298171..298578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0306"
FT                   /product="Protein of unknown function UPF0146"
FT                   /note="PFAM: Protein of unknown function UPF0146; KEGG:
FT                   nph:NP0772A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46443"
FT                   /db_xref="InterPro:IPR005353"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX78"
FT                   /inference="protein motif:PFAM:PF03686"
FT                   /protein_id="ACV46443.1"
FT                   /translation="MNDPRSPLVDRLADFECVVEVGVGRRPDVARRLARRGVDVTVTDV
FT                   VRRDVPRALAFVLDDVTDPDPSVYADAEAVYALNCPPELHRPLRALAREHGAVCYFTTL
FT                   GGDQPAVAVDREQLPGGETLYRVRQDGPKGK"
FT   gene            298618..299139
FT                   /locus_tag="Hmuk_0307"
FT   CDS_pept        298618..299139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0307"
FT                   /product="peptidase zinc-dependent"
FT                   /note="PFAM: peptidase zinc-dependent; KEGG: hma:rrnAC2105
FT                   archaemetzincin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46444"
FT                   /db_xref="GOA:C7NX79"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX79"
FT                   /inference="protein motif:PFAM:PF07998"
FT                   /protein_id="ACV46444.1"
FT                   /translation="MHVDVVPVGDVSARVKREASKGLRTVYDCEVSMHEPQPIPTGAYD
FT                   ADRDQYRAEEFIDLAQRIGSGEKNIAVTPQDLYYRRRNYVFGLAYLSGSGSVISTHRLQ
FT                   TSSDGGFSNRSASDIFGDRVRKEVVHEIGHTLGLEHCDNERCVMKFSPTVREVDVKEQS
FT                   LCGSCATQVT"
FT   gene            299255..299479
FT                   /locus_tag="Hmuk_0308"
FT   CDS_pept        299255..299479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46445"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX80"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2104"
FT                   /protein_id="ACV46445.1"
FT                   /translation="MARCMSKTQESARIDELGEIFVSVTGDDAVTESQDRAAKRSDREL
FT                   PDDGGGVDIEDGLDDAVDGAEVGEPDPVS"
FT   gene            complement(299605..301434)
FT                   /locus_tag="Hmuk_0309"
FT   CDS_pept        complement(299605..301434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0309"
FT                   /product="metal-binding domain in RNase L inhibitor, RLI"
FT                   /note="PFAM: metal-binding domain in RNase L inhibitor,
FT                   RLI; ABC transporter related; 4Fe-4S ferredoxin iron-
FT                   sulfur binding domain protein; SMART: AAA ATPase; KEGG:
FT                   hma:rrnAC2103 putative ATPase RIL"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46446"
FT                   /db_xref="GOA:C7NX81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034348"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX81"
FT                   /inference="protein motif:PFAM:PF04068"
FT                   /protein_id="ACV46446.1"
FT                   /translation="MADDSIAVVDLDRCQPDRCNYECMNFCPPNRTGKECIVKRGDAYD
FT                   EDDNYAGSDDQVWISEEICLGESCGICVEKCPFDAIEIINLPQELGDEPVHRYGENSFA
FT                   LYGLPAPQEGRVTGILGPNGIGKTTAVHILADEMTPNLGRFDEEPAWKAVIDEYRGTEL
FT                   QDYLEDLREGDMTVARKPQYVDQIPDQFDGTASELLERTDERGALDDLIERTGIGPVVD
FT                   NHIDDLSGGELQRVALVATLARDADFYFLDEITPYLDIGQRMTAAQLIQELAEDEDRSM
FT                   LVVEHDLAILDLLADALHVAYGEPGAYGIITSPKSTKNGINEYLSGYLDNENMRFRQQE
FT                   IEFEEHAPRSVSTGDVVAEYPDLTKSYGDGEFSLDVEAGQIRESEVLGVVGPNGIGKST
FT                   FAKLLAGRLEPDAGTVDADLDIAYKPQYIEIDQPMRVDAFLSSITDDFGSSYWNTEIAQ
FT                   PLQLDAVMEQQLTDLSGGERQRVAIAACLSEDADLYLLDEPSAHLDVEQRVMATSAIRR
FT                   YAENHDATAMVIDHDIYMIDLLSDRLLVFDGEPAKQGHASPPVEMREGMNQFLSNLDVT
FT                   FRRDERTSRPRINKPGSQLDRQQKRDGEYYYAP"
FT   gene            complement(301436..301735)
FT                   /locus_tag="Hmuk_0310"
FT   CDS_pept        complement(301436..301735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46447"
FT                   /db_xref="GOA:C7NX82"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX82"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2102"
FT                   /protein_id="ACV46447.1"
FT                   /translation="MATDTVEGMSSHLRGLTVTTLAALSGLAAGVAANEIAAGAGDRLA
FT                   VAVLIAAIVVQFPILSVLGVDIDDFSAKDYLFVAFMTFSLWFVSWGILLTTAAL"
FT   sig_peptide     complement(301634..301735)
FT                   /locus_tag="Hmuk_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.542 at
FT                   residue 34"
FT   gene            301949..302215
FT                   /locus_tag="Hmuk_0311"
FT   CDS_pept        301949..302215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0311"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: hma:rrnAC2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46448"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX83"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2101"
FT                   /protein_id="ACV46448.1"
FT                   /translation="MTETDGEAIADLPPSAKLVYKVLEYDGPLTQKGIVEESMLSARTV
FT                   RYALERLDEVGVIEEDVYFADARQNLYEITDSGAEQADAAVSD"
FT   gene            complement(302259..302525)
FT                   /locus_tag="Hmuk_0312"
FT   CDS_pept        complement(302259..302525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0312"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: hma:rrnAC2110
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46449"
FT                   /db_xref="GOA:C7NX84"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX84"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ACV46449.1"
FT                   /translation="MTVTLKDFYADWCGPCKTQDPILEELEADWGDVSFEKINVDEEQD
FT                   VANEYQVRSLPTLIVENDDGIVERFVGVTQREDLEDALQQASA"
FT   gene            302643..302816
FT                   /locus_tag="Hmuk_0313"
FT   CDS_pept        302643..302816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0313"
FT                   /product="preprotein translocase subunit SecG"
FT                   /note="KEGG: hma:rrnAC2111 preprotein translocase subunit
FT                   SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46450"
FT                   /db_xref="GOA:C7NX85"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX85"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2111"
FT                   /protein_id="ACV46450.1"
FT                   /translation="MSSSDSGGLMSSAGLVRYFDAEDSNTIRMDPRSVVAFGVLFGVLI
FT                   LMLNALFILGAV"
FT   gene            302854..303228
FT                   /locus_tag="Hmuk_0314"
FT   CDS_pept        302854..303228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46451"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX86"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2112"
FT                   /protein_id="ACV46451.1"
FT                   /translation="MHFSQREQQALAEAGLSTDEIAAASEAVVAATDEAATTLEGFFAD
FT                   RETVYSDMEMAHSASDVQEHAVDYLDLFTHADDIRGYLRFDSWGVPVEGGRVLSEDVVE
FT                   LTLGPTVDGRVRFAHDDGAL"
FT   gene            303225..304613
FT                   /locus_tag="Hmuk_0315"
FT   CDS_pept        303225..304613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0315"
FT                   /product="RNA-binding protein AU-1"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   hma:rrnAC2113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46452"
FT                   /db_xref="GOA:C7NX87"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX87"
FT                   /inference="protein motif:PFAM:PF04167"
FT                   /protein_id="ACV46452.1"
FT                   /translation="MTVRIRGIYTTALTELFRGDPGVVQPSPPIVDRFDAEFTHEPATV
FT                   TVETTADRQGVRVTGEHDAVQAVCEELGAVGRDAFVWPDPTPRGAVYDGAVTETLGGGA
FT                   IVDLGDGEGYLPYGATDRRIEDGDGLRVQVDEPSPPWSDDRPTLDTTIRAHGSLVTLVR
FT                   GETIEHTGPELADILPADPVDGWGSSWHRHSDDASLDALGDALERANDRAGALDDALAD
FT                   APAPGDDPPDRHARPTSTAWVWFGRESRFALDEARDAVTATMPGHHRIKAGSRSASAGV
FT                   DLAEAVADGFRTGEQDFPFAAVTSQFGPTAGDTVRLDHGKPDGRMYTLGDAAVEGVEPD
FT                   GTVTVEREMSPGGTYDALGVDRRAGDVATTKVKEGRWWYPTVYEGADGTKRGTYVNVCT
FT                   PVEVFPDAVRYVDLHVDVVKHADGRVERVDDDELDAAVEAGHVSEGLAEKARSVAKAVK
FT                   HGLE"
FT   gene            complement(304614..306014)
FT                   /locus_tag="Hmuk_0316"
FT   CDS_pept        complement(304614..306014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0316"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: LVIVD repeat protein; KEGG: hma:rrnAC2114
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46453"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX88"
FT                   /inference="protein motif:PFAM:PF08309"
FT                   /protein_id="ACV46453.1"
FT                   /translation="MRRRPLLRTLGSGLALGSAGLASGHPTATSDGTPPAETPDSQPLG
FT                   TVSIENVREMVLNPDGTVAYVATVDGFAVVDVSDPTEMRVLARERLLADHADGPLSGIW
FT                   DLHCDGDRLLVAGPANGGRDSVRGFGYVDVSDPADPELLAEHEVDFYTHNCVLADGVGY
FT                   FTGGGLDGSPLVVADPESGTELARWSVVDVDDRWAELPFGMVNLHDVWVHDDRAYLAYW
FT                   DAGTWCLDVSDPGEPTLVSRVRGRPLDELLDVTNRRRERTEPPGNDHFVTVDETGDLLG
FT                   IGTESWAAASGSTGPGGIAFYDVTDPAEPTRLGAIDPPPTPDPTRGGVWTTAHNFELVD
FT                   GRCYAAWYQGGVTVHDVTDATDPVERFHWRDAGRGKFWTAQLAAPGEFFLGASIGAFGV
FT                   NTAADSPLESALFAFPDQRPADGATTTDGTRSGRASTPTSETGAGAGVGAGLLGLLGAG
FT                   AWCRRRSE"
FT   sig_peptide     complement(305940..306014)
FT                   /locus_tag="Hmuk_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.789 at
FT                   residue 25"
FT   gene            complement(306051..306632)
FT                   /locus_tag="Hmuk_0317"
FT   CDS_pept        complement(306051..306632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46454"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX89"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2115"
FT                   /protein_id="ACV46454.1"
FT                   /translation="MSALSKYDIQGLELTDNSYTVEQSLVRNKYKAMDAAGDVVVRGKQ
FT                   KMLKMKEEFPFTDGDGNEVFTVKAGGIIDVAGNYVLSDAQTGEDLVVLDNDYSVMQDTW
FT                   TLRDAGDERAIAKIDSRGAAVTLARNLLPFGEIIPHKYEITDVDGNHVGSIEGQLSLRD
FT                   RYEITIDDASNVPKEAVIAAAMVIDAIQGN"
FT   gene            306747..309767
FT                   /locus_tag="Hmuk_0318"
FT   CDS_pept        306747..309767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0318"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: hma:rrnAC2116 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46455"
FT                   /db_xref="GOA:C7NX90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX90"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACV46455.1"
FT                   /translation="MTREYIEVRGAEEHNLKDIDVEIPREELTVVTGLSGSGKSSLAFE
FT                   TVYAEGQRRYIESLSAYARNFLGQMDKPQVETVEGLSPAISIDQKNAANNPRSTVGTVT
FT                   ELHDYLRLLYARIGTPHCPECGREVGEQSAQNMVRRMLALPEGTRAKIAAPVVRDQKGA
FT                   FEELFEELVSEGYARVEVDGEPYDLTIDDPDLDENYDHTIDVIVDRVSVSADARSRITD
FT                   SVETALEEGAGITKVILPDPPEGVSLGGATARSTGDLAGTGDSDDHSDRERLVVEFSEE
FT                   LACTHCGIDISEIETRSFSFNSPHGACPECEGLGETKEVSEELVIQDRSKPLKHVFEPW
FT                   SYDRTYYSRQLDNVADHFGVSLETPFEELDESIQHQFLYGTDDLVHFEWQTKNGTREKT
FT                   ERFEGVVPNLERRHVETDSDRAREHIEEFMAVTTCPECEGTRLKAESRHVLVDGSSASD
FT                   ASGTSSEVSSDGTSITEVNRMSIGDALEHFEGLEASLDERDTKIAEEILKEIRARLGFM
FT                   EEVGLEYLTLDREASTLSGGESQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNDRLLN
FT                   TLAELRDLGNTLLVVEHDEETMRRADNIIDMGPGPGKRGGEVVVNGDMDEVIDCEDSVT
FT                   GEYLSGERTIPVPDDRRASDTHLTIEGARQHNLADLDVDLPIGCFTAITGVSGSGKSTL
FT                   MHDVLYKGLVRRMNDTDVNPGEHDGIEGIDEIETVRLIDQSPIGRTPRSNPATYTNVFD
FT                   HIRELFAETNLSKQRGYEKGRFSFNVKGGRCEACGGQGNVKIEMNFLSDVYVPCEECDG
FT                   ARYNDETLDVTYKDATISDVLDMSVAEAYDFFEGHTGIRRRLKLLKDVGLDYMRLGQPS
FT                   TTLSGGEAQRIKLAEELGKKDSGETLYLLDEPTTGLHPEDERKLIDVLHRLTDEGNTVV
FT                   VIEHELDLVKNADHIVDLGPEGGEHGGTIVAEGTPEDVARNEESYTGQYLRDLLPKVDL
FT                   EGPRADRDVAQPAADDD"
FT   gene            309855..311084
FT                   /locus_tag="Hmuk_0319"
FT   CDS_pept        309855..311084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0319"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hsl:OE4411F major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46456"
FT                   /db_xref="GOA:C7NX91"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX91"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV46456.1"
FT                   /translation="MTLATRLRGLARFDALVLTASLWFIGKFLRYAFPPLFGTLGESYG
FT                   VSRTVLGTAFTGFMLVYAAMQFPSGALADRLGSVRVIAAGAALAATGALVLVVDAPFAV
FT                   LAGAMVLMGAGTGAYKTVAVRLLSGVYPDRTGRALGVFDTVGAFGGVAAPAAVVAVGGV
FT                   SLLTGAPWRTVFLAGGIATIVLAALFVRRVPQRLSSRADDDATATDATGDGVAVGDYLT
FT                   MFREWQFAGFVAVTILFSFAYNGTVAFLPLYLADETALTAATANLLFSALFVVSLVQLV
FT                   TGEASDRVGTAPMLVVTLAVATAGLVAVLVFSATGGPLALGGAVVALGLGAHGYRPVRG
FT                   AYLMAVVPEDVAGGSLGVVRTLLMGAGAVAPAIVGWLSDVANFQVAFGLLAAALIGATG
FT                   LTAALWLFDR"
FT   gene            312070..312903
FT                   /locus_tag="Hmuk_0320"
FT   CDS_pept        312070..312903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0320"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cmi:CMM_0794 putative sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46457"
FT                   /db_xref="GOA:C7NX92"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX92"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACV46457.1"
FT                   /translation="MGTGYTAMMYDPTDVETAISDVSACRYDGIEIGLGKVRDNDTATL
FT                   KRWLADADVELYCVMSEWIESDEAVERIVEDVPTIADLGAEFLGLLPPQRGRHDEATVE
FT                   AWLTRVSDAALDAGLRPVVHHHGATAVERPSEIRHYLDAVDGLELLFDTAHYYPYSDHF
FT                   PEGDVTDAVERFGDDIAYVHLKDVAPGQGFADNRDALTDGDFHLDNVINYFRSFTDLGD
FT                   GVVAFGALADALDAAGYEGHYTIEIENQTEKPLVHAKENIDRWRELSVERAADGR"
FT   gene            complement(312910..314145)
FT                   /locus_tag="Hmuk_0321"
FT   CDS_pept        complement(312910..314145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0321"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: hma:rrnAC0575 mandelate racemase/muconate
FT                   lactonizing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46458"
FT                   /db_xref="GOA:C7NX93"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX93"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACV46458.1"
FT                   /translation="MYEDFASTLAATMWADFDEQPRRADGPPGEITDVQTVVVDGNFPW
FT                   TIVTVETSEGVTGIGECYPSPGVHEVITDYLRPVLVGENPTDVERLYNLMRESLSGRGS
FT                   QQGIGTIAISGVEIALWDATGKLLDQPIYQLLGGKLRESVAVYADCHAGEAMVESAREG
FT                   QEASTYDPQAYARAARGAVDDGFDIVKFDLDVPSGREIDTLSRHFDPPEIEHKRRVVEA
FT                   VTDEIGHDAEVAVDLHWNFSPETAERLCRAIEPYDLAWIEDPLPPENTDAMRELKRRVD
FT                   VTLLTGENRYGRHGFRDLVAEQAVDFLAPDVPKTGGIAETKKIAELAETYYQALVPHNI
FT                   GSPVATAATVHVGATVPNFVALEYHAREVSWWDDLLVRDEPFIRDGRIRVPDGPGLGVE
FT                   LDWDAVEDHRKH"
FT   gene            complement(314200..315282)
FT                   /locus_tag="Hmuk_0322"
FT   CDS_pept        complement(314200..315282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0322"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   mlo:mlr2436 NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46459"
FT                   /db_xref="GOA:C7NX94"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX94"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46459.1"
FT                   /translation="MRFGIIGCGTIAQIMHIPYVTELPDLELYALADPATERVTTLGER
FT                   YNVSHRYESADEMIAERGDELDAVIVLTPPSQHADVVETTLGAEIDTLVEKPLSVSVAD
FT                   ADRMVSAAEAADATAMVAYNKRYAPAVEAAREEIAALDRVDKITAYDVDPNHGRNIEAV
FT                   YDLVDGAVPESVVETTREKQLADSKQVIDSDDDELADDYHWHLEHICHDVNLLRGLFGG
FT                   VESIDHVDLYADGRYATANLVYEGGRRCTLDSGLSDRKWFEEFVRVDSPTGMIELSFDD
FT                   PFIRNSPPSVRVKRGTDEISDETRTPAYEESFKREVEHFVACIRGDAEVRTPFEEGRAD
FT                   VRLIADLFRQIQGAPLLGDY"
FT   gene            315442..316233
FT                   /locus_tag="Hmuk_0323"
FT   CDS_pept        315442..316233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0323"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: pcl:Pcal_1422
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46460"
FT                   /db_xref="GOA:C7NX95"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX95"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACV46460.1"
FT                   /translation="MTHVKDAIEAGESPLGTWISVGHPTITEAIAQLDIDFLLVDMEHT
FT                   TMSLETVESIARSVDAADGETETVVRVPWNDPVRLKRVVDIGVAGVMVPMVGTAEEARE
FT                   LVRAVRYPPDGIRGIAGSRATEYGRNFEEYVANANGTLLTIAQIETEEGLENAAEIAAV
FT                   DGVDALFVGPADLSGALGKFAEWDSQSLTTAMASVIEAGNDADVPVGTLVTDLDDIDTR
FT                   VEQGHDFLIAGKDVALLMDGVDEAIDRYDDAFAETTPAEQD"
FT   gene            complement(316280..317776)
FT                   /locus_tag="Hmuk_0324"
FT   CDS_pept        complement(316280..317776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0324"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: aba:Acid345_1533
FT                   methylmalonate-semialdehyde dehydrogenase [acylating]"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46461"
FT                   /db_xref="GOA:C7NX96"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX96"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ACV46461.1"
FT                   /translation="MTRKHEQPPAATAIPDAVRNYVGGEWASGSADGQPVVDPATGERL
FT                   ADVPFSSADDVDRAVRTANDAFEEWRRTPPVERVQYLFDLKHELEAREEQIAHALSREH
FT                   GKTVEEARGELRRGIENVEVATGIPNMLREASGTVEDVAVGMDETAVRQPLGTFAAVTP
FT                   FNFPAMIPLWFLPYAVATGNTFVLKPSEKVPLTAQLIFEAIEAVEFPDGVVTLVNGGVE
FT                   TVDALLEHDGIEGVSFVGSTPVARHVYETAAQHGKRVQAQGGAKNFAVVTPSAELDRAV
FT                   PNIVGSGYANAGQRCLANDVVVAVGDVYDELRGALVDAVEDLTVGRGLDEDTDVGPLIT
FT                   GASRERVTELIAEAVAEGAEVVVDGRGFEHPDYPDGNFLGPTLLAGVTADMEIAQTEIF
FT                   GPVLCLAARPSLDDAIEMVNGTEYGNASSIFTEDGGEARQYRYEVDAGNIGVNVGVCAP
FT                   MGFFHFGGTKESFFGDLHAQGEDAVAFYTDKTIEIERWYS"
FT   gene            complement(317863..319593)
FT                   /locus_tag="Hmuk_0325"
FT   CDS_pept        complement(317863..319593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0325"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="PFAM: thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein domain protein TPP- binding;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: rha:RHA1_ro04554 acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46462"
FT                   /db_xref="GOA:C7NX97"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7NX97"
FT                   /inference="protein motif:PFAM:PF00205"
FT                   /protein_id="ACV46462.1"
FT                   /translation="MNGGEIIATYLEKEGVEYLVGIPGHGSTNLLDAFNDSDVSVVQPR
FT                   HEQGAAHLADGYARVTGEPLAVFTSIGPGATNTVTGVATAYVDSIPMVVFTGAPQTHEY
FT                   GQGILQEIERQKPGDFPSVMEPVTKQSFEVTSVEHLPRVLRRAFQIARSGRPGPVHVDV
FT                   PMDVQGAVADVTLPEPTKHRPHSRPGGDPETVSEAATLLAEADRPVIVPGGGTMLAEAW
FT                   DEVQALAEHLQAPVVPTFQAKGIIPEDHDLFVGYAGWIGSTAGNELASNADTILAVGCR
FT                   FTDMHTSSFEAGVSFEIPPSKLIHVDIDPQEIGKNYPIEVGIQGDAKVVTRQLTEQLRE
FT                   RMEPVSTEDNDYYAEIQELWDEWAAMVQERWDDDSVPMSISRVLASLREVLPRDGVVVS
FT                   SAGQPQETVNPEFPVYEPRTNVSCGGFSTMGFGVSAAIGAKLGKPDSPVVDVEGDGSFL
FT                   MCNQEVAAAVEHGVDVTYLVLNNRGWKSIRNLQVDKYGWDRVLNTEFDEDSGVDYMAMA
FT                   DSFNLGYAERVVKPENLDAVLDDAIAHDGPAMVEAVVEPDNPDSGAIVTGEWDLADLEE
FT                   "
FT   gene            complement(319666..320643)
FT                   /locus_tag="Hmuk_0326"
FT   CDS_pept        complement(319666..320643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0326"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rxy:Rxyl_0217 luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46463"
FT                   /db_xref="GOA:C7NXM5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXM5"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV46463.1"
FT                   /translation="MVAVDYMAHQEQYSPSELLAFSELAAANGFDFIWTSDHFHPWFHT
FT                   DAEAGFAWSWLGAAIERVDLPVGTCVTPAGEHYHPALVAQAFATLQSMHDERVVLGLST
FT                   GEAMNEKPLGHEWPDYGVRRNRLEETLEIVHGLWENDGFYSYEGEHYEVDDARLYTMPD
FT                   ERPEVQIAANGPSTASLTGEYGDGFITVKTGEEYTERMYPAIRRYATDAGRDPDQIETT
FT                   LLVIASYDEDRERARESTRPWWATTQDVFDRALANPKEIEREGEKATREQVEAKFLIAD
FT                   DPAEIAGQLEAYAEMGFDRIALGNTSPEPERFFEVMGDEVIPSL"
FT   gene            320804..321568
FT                   /locus_tag="Hmuk_0327"
FT   CDS_pept        320804..321568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0327"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR ; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   hma:rrnAC1338 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46464"
FT                   /db_xref="GOA:C7NXM6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXM6"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACV46464.1"
FT                   /translation="MASEHQSRTVDAVQTSLDIIEFLQSVESAGITEIADAVDRSKGTV
FT                   HGHMATLVDNEYVVNDDGTYRLSLQYLDLAETVKGRLQIYDVVRKELDDLAEECGELAQ
FT                   FATEEHGKAVYIYKTEGEDAVQTASSVGNRAHLHCLSLGKAMLARMDESRVEAIVDEHG
FT                   LPGFTDATITTRSELFEELEGIRERGYAFDREERIEGLRCVAAPITMNDEVMGAISISG
FT                   PASRFSGPLYEDELPNLVTRSANVIEINAQFS"
FT   gene            complement(322204..323094)
FT                   /locus_tag="Hmuk_0328"
FT   CDS_pept        complement(322204..323094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0328"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: nph:NP4360A glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46465"
FT                   /db_xref="GOA:C7NXM7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXM7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACV46465.1"
FT                   /translation="MWPTFANGAPCADAPAASLTAGWHDGASPARPLSLPVGRRGLVRS
FT                   GLGGLATLLAGCTGGSGHGTETASRTREDDVRLIGHRGCADQYPENTIFAVEQSAPHVD
FT                   MIEFDVQRCGSGELVVFHDDELDRLTDATGPVATTDWEELRELTILDSEETIPRLSAFL
FT                   SAVPSDTAVNIELKHDGMAAEVVSAADECDNEVLFSSFSPDALREVRERDDAAALAFLV
FT                   SDAPERSLSFADEMDCVAVNPGVDLVLDTDFVERAHAEGFEVNTWTVDDSKTARRLVDA
FT                   GVDGLFVDRWDLLTE"
FT   gene            complement(323099..324238)
FT                   /locus_tag="Hmuk_0329"
FT   CDS_pept        complement(323099..324238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0329"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: hsl:OE5170F
FT                   glycerol-3-phosphate ABC-type transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46466"
FT                   /db_xref="GOA:C7NXM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXM8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46466.1"
FT                   /translation="MARIQLTDLEKQYDDVLAVKGIDLEAQDGEFLVLVGPSGCGKSTT
FT                   LRMIAGLEDITSGTLRIDDEVVNDVPPKDRDIAMMFQNYALYPHMTAAENMKFGMKSVS
FT                   DFSSDEIDQRVEEAAETLDIADLLDRKPKELSGGERQRVAIGRAIVREPEVFLLDEPLS
FT                   NLDAKLRVQMRAELLRLHEELDSSTVYVTHDQTEAMTLGDRVAVLDAGELQQVAPPQEL
FT                   YDFPANRFVAEFIGEPAMNVFPVDVHERNGHYVADHAGFSISLPDGEGLDTASDSSVSM
FT                   GVRPEDISLASNLPDDAETFAVETTVREPLGELLLLHCQLGDDEIHVKVEPRSEIQPGE
FT                   TIEVGFDEDRLHLFDARSGDALYHSTAPEATKSEPVVTE"
FT   gene            complement(324244..325119)
FT                   /locus_tag="Hmuk_0330"
FT   CDS_pept        complement(324244..325119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0330"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hsl:OE5169F
FT                   glycerol--phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46467"
FT                   /db_xref="GOA:C7NXM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXM9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46467.1"
FT                   /translation="MATTTETDSTPVDESRTISQRLPDNLAMHVGIILSIVAMAAPLLL
FT                   AIIMSTQTTSEVYEVTNLGLGSQGLSNYQTVLSEYQFTTYLLNSFVMSIIIVVGKVGIS
FT                   LLAALALVYYELPYERAVFMFILLTLLLPVPVRIVPLFQLMADLGWTNTMLALTGPYIA
FT                   SATAVFLFRQHFMSIPSSLVETARMSGIGPATFLFKVLIPMSKGMIAGVCVITYIYSWN
FT                   QFLWPLVAVNDKSSQVVQVGISYLQGSAQAGLTPWGLIMAGACIALLPPLLVLIVLHRP
FT                   LLQTFAVQRK"
FT   gene            complement(325125..326018)
FT                   /locus_tag="Hmuk_0331"
FT   CDS_pept        complement(325125..326018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0331"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hsl:OE5168F
FT                   glycerol--phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46468"
FT                   /db_xref="GOA:C7NXN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46468.1"
FT                   /translation="MAEQTKPFDSKLQAAALLLPTIVVLVAFLYYPSLETFRLSLFESA
FT                   FLGQDLRWTGIGNFVELATSSTYRNSFVVSVLFAGVVVIGTLVLSLLISYMLFDVDLGS
FT                   SSYLVAAIWPYALPPAVAAILLNFLLHPNLGIFTHYLELLTPWTLDWFNSGPQAFAVLA
FT                   IVAIWKQLGYNIIFMVAALNNIPETLTESAQLDGVGRLKMLYKVYVPLISPTMIFLVVM
FT                   NTIYSFFSTFPLVDLMTSGGPSGATNLLIFKLYRDAFEFSNYGLASAESVILFALVAIL
FT                   MYIQLRATEGHAQYGA"
FT   gene            complement(326048..327454)
FT                   /locus_tag="Hmuk_0332"
FT   CDS_pept        complement(326048..327454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0332"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hsl:OE5166F glycerol-3-phosphate ABC transporter
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46469"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV46469.1"
FT                   /translation="MKKPTRRDYVRGVGAATIVGLAGCSGDGGDGGSDGGDGGSDGAST
FT                   GDSGGSSDVTFDFWHIHGDELGETLSQFAQEFSEETDGVTVNAVNKDGYRQNLNQSLQA
FT                   SRAGDPPGVAQIFEIGTQLCLDSGAFTPIEQVIPDGAVDFDDLLPSVSSYYRIDDELNS
FT                   MPFNSSNTIMLYNKTAFEEAGLDPEDPPRSLSGVRSAAETIVDQTDMEAGISWPNHSWM
FT                   QIEQQFAKQDQVLLNKENGRAGRADKTYYNSEAGRNVYEWWKGMADDDLYLNPGIEAWS
FT                   EARQAFLTGQVPMLWDSTSNMVSMKAGAEENGFELGSAYLPAPDGANNGVVIGGGSLWV
FT                   PDALADEKKEAAGKFIAYMVQPEQQARWHRNSGYFPVSQGAVDQLESDGWFEENPDFRT
FT                   AFDQLQDTKDSPATRGAVMGVFPEARSINTEISVSILNGDVGVEEGLSEMDTQVQETLS
FT                   SYSGNYSGEE"
FT   gene            complement(327896..329209)
FT                   /locus_tag="Hmuk_0333"
FT   CDS_pept        complement(327896..329209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0333"
FT                   /product="magnesium transporter accessory protein"
FT                   /note="KEGG: hma:rrnB0318 magnesium transporter accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46470"
FT                   /db_xref="GOA:C7NXN2"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN2"
FT                   /inference="similar to AA sequence:KEGG:rrnB0318"
FT                   /protein_id="ACV46470.1"
FT                   /translation="MLEPLTDAAGTVLSVLQIGGLDGQSFAFEQISPEVVQLGLAVLLG
FT                   MFLGLEREWSEKNAGIRTFALLTLLGAILSITGEPLLLVAGALLVITMSVLLAVQSLLS
FT                   SASEASLSLTTSASMFVAYGVGILVTQGFLIESVTIAVLSSLLLVLKRELHEFAWGLSK
FT                   EEMQSATEFAILAFVVYPLLPDEAFGPWNAIEPRTVWLLVIAVSGIGLVNYVLVKRYRG
FT                   RGFIATGFFGGLVNSTAVIAEMAQRAKQQPSLRSLAVGAILISNAAMAFRNALVVVPFM
FT                   PETALIVGVPLGAITVTGIGLSLFVSDLDQDFEAQLTSPFSLRNALVFGGLFLAVLVVS
FT                   AGAEATFGANGFLTTSFLAGLISSGTATATAVTLVATDQISSDLAIAGVIAGTLASILV
FT                   KVVFAATIDWDLVRPVMIWNVVLIAVGVFFGGIVILFL"
FT   gene            329742..330986
FT                   /locus_tag="Hmuk_0334"
FT   CDS_pept        329742..330986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0334"
FT                   /product="cell division control protein"
FT                   /note="KEGG: hma:rrnAC0548 cell division control protein 6
FT                   homolog 6"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46471"
FT                   /db_xref="GOA:C7NXN3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0548"
FT                   /protein_id="ACV46471.1"
FT                   /translation="MNFEDRIQRRYRSQAGTQRVVDRAVLSPTTHLAEPTGRGPLLELV
FT                   LDQLDPIFAGELPRDTYVWGERGTGKSAILAALVHHLDRHPRPLGQLIRTTAGTHSPPV
FT                   PELVYVDTHRTASGFEFYATVLDRLTDEPAPQRAVGIEAVREELDAVLAERPVVPIVDH
FT                   LTASRHVTPERVATLFDRLTADVGWVGVGRSPPAALDWTPPAAIEFTPYETSTLVDVLM
FT                   TRADDALGQHALGHEHAQRLAEWADGDANDALAALFVAADAALRAESEQIEDTHITTGI
FT                   ADVPTQAVSLTRVFALSADCLSVLRELVALDPDRHPTVDAAAAAIADRDPIDLSTRTVR
FT                   RFLRELATDGVLERTRSSGESQAGTPPELLEPRFSPILFKRLYDHTRSPGETTAASQSD
FT                   GSITATAPSRTESER"
FT   gene            331011..331421
FT                   /locus_tag="Hmuk_0335"
FT   CDS_pept        331011..331421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0335"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hma:pNG7322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46472"
FT                   /db_xref="GOA:C7NXN4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV46472.1"
FT                   /translation="MSLDSTGYAAVAMVSWGLWAVFVELAMSRSSHRPVLLLSYGFAAV
FT                   LVVGYSATTGAGFDISASVVALSLAGGLFAGGGTLAYYLALENGGVGTATTITALYFVV
FT                   AAIIGVTLLDEPLSASKVVGIGLAVASVVLIS"
FT   gene            331964..332851
FT                   /locus_tag="Hmuk_0336"
FT   CDS_pept        331964..332851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0336"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   hma:rrnAC2805 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46473"
FT                   /db_xref="GOA:C7NXN5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN5"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACV46473.1"
FT                   /translation="MGGQQFVTEFSLPGVVDGGIERVNVGSWIGDSIVVLVFYPSDFGP
FT                   RSGQSAALLRAVDELTGETDARAVGIAPESVYSHRRFAAEADVDVALASDADGSVTEAY
FT                   GVASTGEAGQVVTERSLFVVDYRGVVVHEWVASDTGAMPEFERLRTRLRSITPDGSARG
FT                   CYRTGYARYREGRRYLSSGLEHCEAGDWGLAASAFDEASEEFGDATNRFTKGQGLADGD
FT                   DINENNSRGRVVATKYWEAAEWLAGFATAASKDNVEAREENREAAEQALREVRDVTLPE
FT                   PDAASKTATGKHHA"
FT   gene            complement(332861..333673)
FT                   /locus_tag="Hmuk_0337"
FT   CDS_pept        complement(332861..333673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0337"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: hma:rrnAC3302
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46474"
FT                   /db_xref="GOA:C7NXN6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN6"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACV46474.1"
FT                   /translation="MAQIQRLTVYPVKGLDGVTRREATVTPGGTLRHDREFALFDEAGD
FT                   VLNGKRTARVHDVATEFDVERSELAVEFDEERERFALDEEPERASRWFSSMFDAEFTLE
FT                   RDRELGYVDRRDMGPSIVSTATLRTVASWFDDVTVAGARRRLRANVEVSGVPPFWEDRF
FT                   VGADAPAFAVGSSGAGDTETGSGPTEGVRFEGVTPCGRCVVPERDPETGEPTPEFRERF
FT                   VERREATFPDWADPDAFDHYYTVMLISRVPERDRGGRIRVGDEVSIVE"
FT   gene            333760..334536
FT                   /locus_tag="Hmuk_0338"
FT   CDS_pept        333760..334536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46475"
FT                   /db_xref="GOA:C7NXN7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2117"
FT                   /protein_id="ACV46475.1"
FT                   /translation="MAQSTADTPEWGIGGLATQANTAFAAGAVVVPLAALAAALASNDV
FT                   RALTYVHVMAGVLWTGIDMFMGAVLGPVVGSLDPKQRADFFGRFTPKMTFLMPALAVVT
FT                   IAGGIALALRLTTFAYADQWLAVFTAVNTVPIVLLLAYQFDALGDRRALAVLGVAVVGS
FT                   GAYLATTLPGTSLVAMVTTTSPWLLAALGIVTVLGLQGFGVVLPGEIRIYRQIASEEPD
FT                   TELIGEIGMRNAKLGGVQGVLQLSIVFVMVGLRYLS"
FT   gene            complement(334574..334768)
FT                   /locus_tag="Hmuk_0339"
FT   CDS_pept        complement(334574..334768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0339"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: hma:rrnAC2900 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46476"
FT                   /db_xref="GOA:C7NXN8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN8"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACV46476.1"
FT                   /translation="MANGTVDFFNDTGGYGFIETEDADDDVFFHMEDVGGPDLEEGTDV
FT                   EFDIEQADKGPRATNVVRQ"
FT   gene            334975..335172
FT                   /locus_tag="Hmuk_0340"
FT   CDS_pept        334975..335172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46477"
FT                   /db_xref="GOA:C7NXN9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46477.1"
FT                   /translation="MQATVGELVSNLVTHFTNDPLALLMALAGAAFVGGASLFFGYLTL
FT                   GAVADFITPDVSNEPPSRAN"
FT   gene            complement(335129..336109)
FT                   /locus_tag="Hmuk_0341"
FT   CDS_pept        complement(335129..336109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0341"
FT                   /product="5,10-methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   hma:rrnAC2437 methylenetetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46478"
FT                   /db_xref="GOA:C7NXP0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019946"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP0"
FT                   /inference="protein motif:PRIAM:1.5.99.11"
FT                   /protein_id="ACV46478.1"
FT                   /translation="MYAIELTPEHPVETLTELAVEAEAEGFDAVLASHHYNNRDQFMAL
FT                   SSMAQATDELLVGPGIANPYETHPVTLASRVATLSEVSGGRALFGVGPGDEATLSNLGF
FT                   DHDRPLRRVLETFKVAQRLWDGERVDHDGTFQARDAGLNYDVGEIPVYVGAQGPHMTRM
FT                   AAKHADGALYNGAHPRDLEWASEQAAKGEADRPDARGEFDLAAYASVSVAEDGAAAREA
FT                   ARIPVAFIAAGSPPPVLDRHDLDAERAREVGDAIAAGEFRAAGDAVSEAMIDAFCIAGT
FT                   PETVAERTDALLDYADSVVFASPLGPELETAISLLGSAARSTRLA"
FT   gene            complement(336112..336864)
FT                   /locus_tag="Hmuk_0342"
FT   CDS_pept        complement(336112..336864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0342"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase; PFAM:
FT                   protein of unknown function DUF129; KEGG: hma:rrnAC2436
FT                   F420-0--gamma-glutamyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46479"
FT                   /db_xref="GOA:C7NXP1"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR023659"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP1"
FT                   /inference="protein motif:TFAM:TIGR01916"
FT                   /protein_id="ACV46479.1"
FT                   /translation="MEVFAVDGLPEIRPGDDLAALIDANAAIGDDDVVCVASTVVSKAE
FT                   GRQADLAAFPAGDRARDIAERIAAETDEQKDPRFAQAVLEESEELVLEAPFLLAVTRFG
FT                   HTTVNAGIDRSNVPDADLLLLPADPTASAERLRAGLDADPAVVVTDTSGRPFRHGQRGV
FT                   ALGWAGIPASRDWRGEHDRDGRELGVTVQSVVDELAGAANLVTGEGAGGTPVAVVRDFA
FT                   FGEHAGSDELFRDPETDFVRQALREWDY"
FT   gene            complement(336955..337113)
FT                   /locus_tag="Hmuk_0343"
FT   CDS_pept        complement(336955..337113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46480"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46480.1"
FT                   /translation="MAVLLAIATAPLTGIALVLAALIVALLARAARPRRPATSPRRRTT
FT                   VVPGTTR"
FT   sig_peptide     complement(337021..337113)
FT                   /locus_tag="Hmuk_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.837 at
FT                   residue 31"
FT   gene            complement(337428..338345)
FT                   /locus_tag="Hmuk_0344"
FT   CDS_pept        complement(337428..338345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE5282R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP3"
FT                   /inference="similar to AA sequence:KEGG:OE5282R"
FT                   /protein_id="ACV46481.1"
FT                   /translation="MTVPLNLPDMSEPGLVETADPETVFGALSDGTRVDILLALWDADG
FT                   RSATFSDLREEVGMADSGQFNYHLDKLRDRFVRQTDDGYTLTLAGEQIVGAIQVGAYTM
FT                   EGSIEPIPLAEPCRACGGERTLYYEDETVRIECGDCPSTSTSGVPPGVFADHERSEIPA
FT                   VASRYFRTILAHVGEGFCWHCEGPITATVVPAAETRAARDDLPTTFEELPMARYDCGRC
FT                   GSEITSDLGGALLNHPVVGGFFYEHGIDVRERPFWAFNAVGHEQSRFRERDPVRATMTY
FT                   TAGDATLTLVVDETLDVVAVERDG"
FT   gene            complement(338402..338890)
FT                   /locus_tag="Hmuk_0345"
FT   CDS_pept        complement(338402..338890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0345"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: hma:rrnAC2435 putative
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46482"
FT                   /db_xref="GOA:C7NXP4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP4"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACV46482.1"
FT                   /translation="MEIAIVSDTHVPSRARRIPDPFRERIRAADHVLHAGDFDAESTVA
FT                   DVRDLADTLTAVRGNTDPAVGLPEVATVELGGVSFVVTHGTGSKRGYEDRVARLVREHG
FT                   GTDAVGISGHTHEVLDTTRGGVRLLNPGSATAASPATSATMLTATAADGDLTVRRHEL"
FT   gene            338997..339302
FT                   /locus_tag="Hmuk_0346"
FT   CDS_pept        338997..339302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG7144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46483"
FT                   /db_xref="GOA:C7NXP5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP5"
FT                   /inference="similar to AA sequence:KEGG:pNG7144"
FT                   /protein_id="ACV46483.1"
FT                   /translation="MVSAVGPWLDTGEAAVLFAALALATMGTIALFLVACAAAWRRRTT
FT                   TYLLVTAAIGLLVLRSIVGFGTALGAVAMPAHHIVEHTFDFLIALFVLGAAYAVGE"
FT   gene            339402..339947
FT                   /locus_tag="Hmuk_0347"
FT   CDS_pept        339402..339947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0347"
FT                   /product="NosL protein"
FT                   /note="KEGG: hma:pNG7145 NosL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46484"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP6"
FT                   /inference="similar to AA sequence:KEGG:pNG7145"
FT                   /protein_id="ACV46484.1"
FT                   /translation="MDATLSRRELLGATALGLLAGCQSQTTPEPVTLDGTESCDHCGMV
FT                   IGQQSGPVGETYYEDNSPAGHDPPTRFCSAVCTYRHRFQTEQRGWTPTVTYLTDYSSVD
FT                   GEVGETDGTALLTRHLDASAFAPTTDVTVVVGADVEGAMGPALVPFGEADDATAFAEEH
FT                   GGQTVAATDLSREAVEQE"
FT   sig_peptide     339402..339476
FT                   /locus_tag="Hmuk_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.573 at
FT                   residue 25"
FT   gene            340013..340543
FT                   /locus_tag="Hmuk_0348"
FT   CDS_pept        340013..340543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0348"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: hma:pNG7146
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV46485.1"
FT                   /translation="MSTVREQVRESVSANPGIHFNELTRRLDIATGQAQYHLRKLVRAG
FT                   DINTEEIRGRTHYFDREHDPWERRTIALVRRETTRSIVGHLLEDGPLASVELVDRLDVA
FT                   RSTVSWHVESLIEAGVAEKSYGQRGRAVVALTRPTETRRLLQTVEPSLADRLVDRFSRL
FT                   VDDSLGRDGYSNN"
FT   gene            complement(340598..341428)
FT                   /locus_tag="Hmuk_0349"
FT   CDS_pept        complement(340598..341428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG7148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46486"
FT                   /db_xref="GOA:C7NXP8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP8"
FT                   /inference="similar to AA sequence:KEGG:pNG7148"
FT                   /protein_id="ACV46486.1"
FT                   /translation="MTGALDRFWTVFGREVRGLVRTRVVFVLAAVVAALAFGVARAGGG
FT                   PSGGYVPTVVDVLVVVELLVPAAAFAIGYRALADATARGEPAVLETYPLSPWTYVAGVY
FT                   AGRAVALLAAVVVPLLALGAHVATTAGPETTVLASHRGVDSVSLYVRFVALTALLGLVT
FT                   LAVALALSAVANSRRRAILLGLLGLLLVVAGTDVTVLTALGGGLLDESALGTVLALTPS
FT                   GAYRGLVFEHVLSVAFEGRSGFVPTGLALVASLFWWASGLSLATLWAGFRYRSH"
FT   sig_peptide     complement(341300..341428)
FT                   /locus_tag="Hmuk_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.816 at
FT                   residue 43"
FT   gene            complement(341425..342144)
FT                   /locus_tag="Hmuk_0350"
FT   CDS_pept        complement(341425..342144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0350"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hma:pNG7149 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46487"
FT                   /db_xref="GOA:C7NXP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXP9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46487.1"
FT                   /translation="MTDDVALTATDLRRSYGDVTALDGVSIDVPTDGVTALIGPNGSGK
FT                   TTLLDVLLGIERSDAGTVDYGESDARRQVGYLPQRPTFRPDDTVRETIAFYAALVEDDP
FT                   DRLLERVGLDTVPDRRVSALSGGMTRLLGIAQALAGDPPILALDEPASGLDPAMSDRIF
FT                   GVIDSLAADGRAVLLTSHALSLVERTADHVVVVEAGGVAARGSPAALRERTGGPLHETF
FT                   TDLLSEPTTAVDGGDES"
FT   gene            complement(342141..344057)
FT                   /locus_tag="Hmuk_0351"
FT   CDS_pept        complement(342141..344057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0351"
FT                   /product="copper-binding protein"
FT                   /note="KEGG: hma:pNG7150 copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46488"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ0"
FT                   /inference="similar to AA sequence:KEGG:pNG7150"
FT                   /protein_id="ACV46488.1"
FT                   /translation="MITSEATGWQWFAIALVAVAAVVVTAAFTADAGSARPEPVAYDET
FT                   VGVGLTMEAEQIARAEGASVPRAEVFYSQFRYVVGYPGIDRLVSALDAPARASQFGFPL
FT                   AVYVSDYGGVSVDCSAGGSLSASATPEWTPAETAHYVVDSDARSPAGPVIVPFEDRADA
FT                   EAFTGDCGGRVVDWQTVRAREPTTDDPAAAVRAQVEQRASRADERVGAARERRDRPVSV
FT                   VVGRDVATVRAAIDRAPPNTTIRVPTATTVGNVTVDKPVTLRGEGTRLDGGGDGTVLRV
FT                   TADRVGVVGFEIVGVGNATVGEPTNADSSWDAPVRRGYGQSDAAVAATNVSGLFVANVS
FT                   VETPASGFVLVGTPGAVVENVTVDGTDDWRDGFMGVVGMDEPIVVQHSTFTDGRDGVYL
FT                   HRADGTVLRNNTFRGNRFGTHLMYTSDALIADNQVRDQSHAGIVVMTDPSGNAIVGNDV
FT                   RRARSGILTAGSRSYVGHNVVVGTERGLSTNAGRSLYEHNVLSDNAVGVTAATIVPSNR
FT                   VVENDFVANDRHATSRPGPMRIYTHDGRGNYWSGAYDLDEGGQALSRPYSPTDSVDRRL
FT                   HRSDAAVVLSEAPSVHALRSLRGTTPGFRSASIVDTAPLTEPANPRLLATATNETTDGG
FT                   VSP"
FT   sig_peptide     complement(343968..344057)
FT                   /locus_tag="Hmuk_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.645 at
FT                   residue 30"
FT   gene            complement(344185..344511)
FT                   /locus_tag="Hmuk_0352"
FT   CDS_pept        complement(344185..344511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46489"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1994"
FT                   /protein_id="ACV46489.1"
FT                   /translation="MSEDESTDEDVSVSMEITGRYEEVVSKLKSEESRPDALAPLASDL
FT                   ETLLETVQRMGGGTRSAIADELPGEMAADYDAAAVVETMQVLERYDLVVLEGNTWKPGP
FT                   RLGE"
FT   gene            complement(344672..345724)
FT                   /locus_tag="Hmuk_0353"
FT   CDS_pept        complement(344672..345724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0353"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: SpoVT/AbrB domain protein; PhoU family
FT                   protein; KEGG: hma:rrnAC2144 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46490"
FT                   /db_xref="GOA:C7NXQ2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ2"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ACV46490.1"
FT                   /translation="MDSRKIQTVGGGTYTVSLPKSWAREQSLEAGSVVDLHTHVDGVLV
FT                   VEARETDDGAGRVEVAVEDQRPVHLEQTLRAAYAAGASTVRFEAAGEFTDAQSRRIQSV
FT                   TRTMTGVTIDERTAAQITVQSLVDAAEVSIPQSVRQLAFVALSMHRDATAALDGDGGPD
FT                   IADRDDQADRLAAMVDRHFGRALARLDEVDALGQRRPELLDCWRTACELERVADHAERI
FT                   ATTAAALEAPPAESVDALTDLAQRARTVVEDGVGVVVDRTAAGAARDVLDRRDGVRERA
FT                   TAIERRLVDGADGDYRLVRVLDSLRRTAEHGGNIAEAGLRGAVRRGDHRDAFHSGPEGS
FT                   AVDAASDAGS"
FT   gene            complement(345726..346631)
FT                   /locus_tag="Hmuk_0354"
FT   CDS_pept        complement(345726..346631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0354"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: hma:rrnAC1505 phosphate ABC transporter ATP-
FT                   binding protein; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46491"
FT                   /db_xref="GOA:C7NXQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ3"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACV46491.1"
FT                   /translation="MSNNEIATDDGIDGATTTDTASNTLDPSGDPLVDHDISVEGSGSR
FT                   SASSGKTVIESRNLDVYYDDLQAIDDVSMAIPARQVTAMIGPSGCGKSTFLRCINRMND
FT                   LVDSARIEGELRFDGQDVYEQDIDPVALRRRIGMVFQHPNPFPKSIYDNVAYGLRVQGR
FT                   DGEVDLDQQVEESLRRAALWDEVKDQLDKSALDLSGGQQQRLCIARAIAVDPDVILMDE
FT                   PASALDPIATSKIEDLIEELAEEFTVVIVTHNMQQAARISDRTAVFLTGGELVEYDDTG
FT                   TIFENPESQRVEDYITGKFG"
FT   gene            complement(346637..348259)
FT                   /locus_tag="Hmuk_0355"
FT   CDS_pept        complement(346637..348259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0355"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hma:rrnAC1507
FT                   phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46492"
FT                   /db_xref="GOA:C7NXQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ4"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACV46492.1"
FT                   /translation="MATQDEGVDQLRQASGTRLRELKGQLFEAALLGATLVGIVSLLIL
FT                   FGYIAFDTFQPLTASAQWYLLYFGTLVAPTAAFTWYARRDTAVRAVNAKAFAVVFGGLA
FT                   VSLVTYVVADSVSPYDVLIYLLFGAIPPLLVGVYGRTTDERTYTGPAIPVAAVLGLGVA
FT                   ALLYGLVRPVVGIAAQWIAYFGITTLPVAGIIGFVVARRWSPRHGIMATAAVLLSAFLV
FT                   AGGLLGVGTDPSFWVVLFSTFVVPVGYVVGSTVGTNSEGRIGVLGPFVLIGGVLAGATL
FT                   ERQLAIKGLESYLTPTLLLESWHGRVASEAGVYPQLVGSIVVVGFMAILAFPVGISAAV
FT                   YLEEYAPKSGWGSRFATLLEVNISNLAGVPSVVYGLLGLALFRRTLGFGTGIVVSAAGT
FT                   LGLLILPIVVVSAQEAIRAVPDSLREASYGMGASRWQTLRNVVFPEAVPSILTGTILAL
FT                   ARAIGETAPLVMIAVATTTYTPPEGLFSSATALPLQIYAARSSALPEFRHGVVPAAAIV
FT                   LLALMLVMNATAVIVRNRYERDT"
FT   gene            complement(348259..349311)
FT                   /locus_tag="Hmuk_0356"
FT   CDS_pept        complement(348259..349311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0356"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hma:rrnAC1508
FT                   phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46493"
FT                   /db_xref="GOA:C7NXQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ5"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACV46493.1"
FT                   /translation="MSNESQSVSDSLQRNQFVARKERLYAWLIAGSAVLTILVTVGIIL
FT                   ALSVNALTFWSEISPIAFFTGTNWSPKIAGEYGVLPLVSGTLLVTVCSALIALPVGLAA
FT                   AIYLSEYASERVRSILKPALEVLAGVPTVIYGYMALVYVTPLIDGFLPIDATVIPSRIQ
FT                   ILTVPDWLPAISGFVLALPEFTFVVPSLRTFNALSASIVVGIMIIPMVSSISEDALSAV
FT                   PDSLREAAYGLGSTKFDVSTKVVVPSATSGIVASYVLALSRAIGETMAVTMAMGMSPQM
FT                   PYFPNVLKNLAESSQTMTAAMVQIAGADSLGTGPTFEAMFALGMTLFAITLTMNVLAEL
FT                   VRRRFREAYE"
FT   gene            complement(349360..350490)
FT                   /locus_tag="Hmuk_0357"
FT   CDS_pept        complement(349360..350490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0357"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   hma:rrnAC1509 phosphate ABC transporter phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46494"
FT                   /db_xref="GOA:C7NXQ6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ6"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACV46494.1"
FT                   /translation="MTRESARLSDLVSRRKFILTSGAVGAAGLAGCTSGSEQGDAESDG
FT                   GDGGNGGDGGDSGDGGDSGDGGDGGSGDDSNVDRASLSGDVRISGSSTVYPVAEEVSRL
FT                   WNEEYGDGVGFNITPDGSGGGFENVFIPGDSDINNASRPIKDEELQRCRDNGIEPVEFY
FT                   VAQDALTVVVNNDADFIDEISLEDLKTIWSPDTAPEMWSDVNSDWPDEPLDLYGPASTS
FT                   GTYDYFIEAVIGETESDQPIRSDFEGTEEDNLIAQGVSGNEYAFGYLPFAYYTNNPDSV
FT                   KALGLVEGGNDPVEPSLEGAQSGNYPLARPLFFYANMNKLQEKTHLQEFIRFYVNEADE
FT                   DYIASDVGYVPSSDQMVEDNLANLEAGIAGDYEFSR"
FT   sig_peptide     complement(350371..350490)
FT                   /locus_tag="Hmuk_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.459 at
FT                   residue 40"
FT   gene            complement(350703..353459)
FT                   /locus_tag="Hmuk_0358"
FT   CDS_pept        complement(350703..353459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0358"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: hma:rrnAC2937 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46495"
FT                   /db_xref="GOA:C7NXQ7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ7"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACV46495.1"
FT                   /translation="MDAALGPPEKMAERADELTPMMRQYYELCRAYDDSLVLFQVGDFY
FT                   EAFCGAAERVARLCEITLTKREDSTGQYAMAGVPIDNAESYVETLLDAGYRVAIADQVE
FT                   DPDAVSGVVDRAVTRIITPGTLTEDELLDSPDNNYVAALTADGRRYGLALLDVSTGDFY
FT                   ATSADAVDAVADEVGRFAPAEAIVGPGVDVDEDRVFEAAAMVTPYDESVFAFEDAADRV
FT                   RTYFGDPDALLADDLEVRACGALLAYAEYTRGGGAGTSDEIADDDGGQLTYLTHLTRYD
FT                   PREYMLLDAVALDSLELFERRAVRGHEGRTLVDTVDETACALGRRRLGDWLRRPLLDAD
FT                   RIERRHEAVAELVEALQRRERLHALLADVYDLERLISRVSRGRANARDLRSLAATLAVV
FT                   PDVREQLADADSALLADLHEGLDPLTDVREEIEAAICPDPPQEVTEGDVIREGYDDDLD
FT                   ALRETERSGKRWIDDLEINERERTGIDSLKVGHNSVHGYYIEVTDPNLDSVPDDYERRQ
FT                   TLKNSERFVTPELREREEEIVRAETAADDLEYDLFCEVRAAIAAEAERVQALADRLATL
FT                   DALVAFGEVAATHDYCRPSVGGDAIDVTAGRHPVVERAEASFVPNDACLTPDSFFTILT
FT                   GPNMSGKSTYMRQIALICVLAQAGSFVPAREANLPIVDRVFTRVGASDDIAGGRSTFMI
FT                   EMTELADILQGATSDSLILLDEVGRGTSTADGLAIARAVTEHVHDEIGAYTLFATHHHE
FT                   LTAVADELPGVRNRHFETRHDGDGVVFEHSVAPGAAAASYGIEVAALAGVPDSVVERSR
FT                   TVLASEDERSESSETRAGAERHAGGEDERSESSDAENGAVAQASAPASEPPSASADGHA
FT                   VVEAATGDESGPDADPLRERLAQLDVATMTPIEAMNALARLQDDIAD"
FT   gene            353572..353907
FT                   /locus_tag="Hmuk_0359"
FT   CDS_pept        353572..353907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0359"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; glutaredoxin 2; KEGG:
FT                   hma:rrnAC2458 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46496"
FT                   /db_xref="GOA:C7NXQ8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ8"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ACV46496.1"
FT                   /translation="MSTETQPRPHLLDSKPALDDLIASEERLLVEFHTKGCSLCEAMAP
FT                   VLDAVAKGTDATVATMNPRDDPVLVDEYDVRSVPKLLLFVDGELVETLEDGFVPVDDVR
FT                   AFVTEAE"
FT   gene            complement(354695..355771)
FT                   /locus_tag="Hmuk_0360"
FT   CDS_pept        complement(354695..355771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ton:TON_1183 archaeal flagella-related protein
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46497"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46497.1"
FT                   /translation="MQDIKYSQIRIYGMLTSGDEESLLADIKEGIQYALFLGKERGRFA
FT                   EEDIRLDKIRLNKLQYIVNEDRDLGLTFGWYKYGPAPEDVTSDHNASLMPAPGSEISHL
FT                   EESRLPTRDSLSTEEFAYYFISELGEEFDKIVTAENTKEYLEDFYAKYAPRDRYAARYT
FT                   DLYIASARLQQTLDKIKDDESWHEDSTHYYYELEKRFTPVINEVAKHEELEHTTEPLRE
FT                   YQKVLTSVIAEADAMEELSSGQDAFISNAVRKFYSTIWDFVAQEVSLKTMRGDNVDSLR
FT                   PSVEATVKTYRGGSWVDELDSIRDRRGNSDLDPDREPSEPQGNSETEEQSIDESLLNAV
FT                   SRTGVEAIKRAEGEVTQE"
FT   gene            complement(356115..356774)
FT                   /locus_tag="Hmuk_0361"
FT   CDS_pept        complement(356115..356774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0361"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: hma:rrnAC2450
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46498"
FT                   /db_xref="GOA:C7NXR0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR0"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACV46498.1"
FT                   /translation="MTDTDAADRPESPTTDEIAVYSDYVCPFCYLGRESLRQFQADRDE
FT                   QLRIDWRPFDLRHNKRNPDGSIDHSVDDGKDDDYYEQAKESVRRLQAEYGVEMSLDLAS
FT                   EVDSLSAQIASYHVKTTADYETWLDFDTSIFTALWQEERDIGDPDVLADLAERAGLDGD
FT                   EVRAALDDETLREEVTTRFTEAQREGITGVPTFVYDGYAARGAVPPEQLERLVDGT"
FT   gene            complement(356833..357012)
FT                   /locus_tag="Hmuk_0362"
FT   CDS_pept        complement(356833..357012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP5086A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46499"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR1"
FT                   /inference="similar to AA sequence:KEGG:NP5086A"
FT                   /protein_id="ACV46499.1"
FT                   /translation="MTESDTSSDATTDDEPSADEQFGAFTTDDGDTIVYDRTNSAAWIQ
FT                   SDYAVEVGGDSSSA"
FT   gene            complement(357260..357511)
FT                   /locus_tag="Hmuk_0363"
FT   CDS_pept        complement(357260..357511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP5086A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46500"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46500.1"
FT                   /translation="MVILVSLRIATKLIIFMICGRVRLSTRVAGWHGTMTRTVDRTGGE
FT                   QSDKYGTFVTGDGNFVVYDRENPDAWIQSDFALDLSGQ"
FT   gene            357543..358856
FT                   /locus_tag="Hmuk_0364"
FT   CDS_pept        357543..358856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0364"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: hma:rrnAC2449 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46501"
FT                   /db_xref="GOA:C7NXR3"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR3"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACV46501.1"
FT                   /translation="MTREAAPVTPPVVLSIAGSDSGGGAGIQADTKTIEAGGAFATTAI
FT                   TGVTAQNTQGVRDVTTLDPAAVSEQIDAVVEDFDVAAVKTGMLSTSAVVETVTEYAETL
FT                   PGLVVDPVMVAASGDRLLDPAAEAAYEDLIAAAALVTPNADEAEVLTDVEVTDADAARR
FT                   AGEALVAMGADAALVKGGHVPSDAVVDTLVTDETVHTYRHDRIDTAATHGSGCTLSSAV
FT                   ATRLAHGDEMETAVGEGIALLARAVRYNVDVGEGAGAVHHTVESRNEAARNETVEAVEA
FT                   VVAGLSDANATALVPHGIANVAGATPYAESPAEVAAVEGGIGLTRDGIRSNRGVRFGVP
FT                   TPLAATILACREHDPAVRFALSCTATSPLVDALGTLDGETATVENDESEARVQAAFADC
FT                   ETTPAAIVDRHGDRLVVLAPEATQLLERVQTLVASVEA"
FT   gene            complement(358859..361006)
FT                   /locus_tag="Hmuk_0365"
FT   CDS_pept        complement(358859..361006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0365"
FT                   /product="putative glycyl aminopeptidase"
FT                   /note="KEGG: hma:rrnAC2446 putative glycyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46502"
FT                   /db_xref="GOA:C7NXR4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR4"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2446"
FT                   /protein_id="ACV46502.1"
FT                   /translation="MGEVTRGVVAVLVVVVLSGSIAPAITVADSSAVETTVDTDVPASA
FT                   DRSGSPPKQLSAGVGQFGLGVGDTAGSDTGQQDDGTLGLTQRFQRLPERPGTVRVRLTY
FT                   SVPARVVSMRAALPDGATFVSRQGFARDNETHFRWRATTQQPTLTYDYRINETIDRTGP
FT                   QASDGRALYAGTGEWALFERPPTPTYWEATGGTPIVFDRGSSTAGPGAAGEWLVYLGEH
FT                   ELHERTAHGQRFRLVVPAAATLSEPPSAILDALADSSDALRVGDRDETVFLIAAPTGSV
FT                   EWGVRGVQTGDTDAWVRDAETLDQPDNAWLHEYVHTRQAFTPTSRTAWFTEASASYYAA
FT                   LLSLEQESVAFEAFRDRLARGTHPVYDGVVLSNVSTWEGAPDYDRGSLVAGELDRRLRV
FT                   ATDRERTLQDVFREMNGQQRPVSQLDFLELLATTGGTSVLDEGQTYTETTASVETWNRT
FT                   THAAVFGQLPARVGYELPPAGDADGYRITGPYRNETVTDDTIQLVTGERLTVDTLVSNA
FT                   GGTAGVYNVSMRVNGTVVDETSGRIEAGESTTAPLSHRFPTPGTYHVVVDGERINVTVQ
FT                   RPVRANVVSLDVEPTTAQQGDTVVLTATLYNGEPRPGEATVVFTRDSEEVGRRHVTMPA
FT                   YNRTSIEREISLPRPGTVSLGAGTVPSVEVMVRPNRVRTMTATATPTATATSRGDGAGP
FT                   GVVALVVALSVLWVALRRRLG"
FT   gene            361109..363853
FT                   /locus_tag="Hmuk_0366"
FT   CDS_pept        361109..363853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0366"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: hma:rrnAC2532 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46503"
FT                   /db_xref="GOA:C7NXR5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR5"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACV46503.1"
FT                   /translation="MTEATGIVGEFLSLKADSDADLLAMQCGDFYEFFDEDAEIVADEL
FT                   DLKVSQKSSHGASYPMAGVPVDDLTPYVSALVERGYRVAVADQHETADGHAREITRVVT
FT                   PGTHLETTDDAAQYLAAVVGTGGDSSDPVAGADGSYGLAVADVTTGQFHVTQLDGPDAR
FT                   TRIQTELYKFDPAEVLPGPDLRGDDDFLDRLRERTDAALTVHTEESFAPGRARHRVRDH
FT                   FGPETVDSVGIADDDAAICAAGAVLSYVEDTGVGTLASITRLQSYGATDHVNLDATTQR
FT                   NLELTETMQGGTDGSLFDTIDHTATAAGARLLREWLQRPRRDRAELTRRQSCIAALTEA
FT                   AMAREQLCETLSDAYDLERLASKAVSGSADARDLRAVAGTLSLLETVEDVIDEDDRLAD
FT                   SPLADALDRLDREVVADLAAELDAALVDDPPGTVRQGGLFCRGYDEELDAVIERHEDAL
FT                   EWLETLPDREKETTGITHLSVDRNKTDGYYIQVGKSEADDVPDRYEGIKELKNSKRFTT
FT                   DELQERERAVFRLEEQRHEMEYELFGDLRERVAEDATLLQDAGRVLAELDAVASLAIHA
FT                   VRNDWTRPELTDGRELDVEAGRHPVVEQTTEFVPNDLRMDGATSPPDQERASGHADADR
FT                   QFLIVTGPNMSGKSTYMRQAALITLLAQVGSFVPARAATVGLVDGIYTRVGALDELAQG
FT                   RSTFMVEMQELSNILHSATDDSLVILDEVGRGTATYDGISIAWAATEYLHNEVRAKTLF
FT                   ATHYHELTSLADHLDRVHNVHVAADESDGDVTFLRTVRDGPTDRSYGIHVADLAGVPEP
FT                   VVDRSRTVLDRLREEKAIEAKGSGSSEPVQTVFDVNAGGFKRADESETATADGGTAAEA
FT                   SDGGLDPETEAVVEELTELDVNETPPVELLATVQQWQEQLDDG"
FT   gene            complement(363870..364505)
FT                   /locus_tag="Hmuk_0367"
FT   CDS_pept        complement(363870..364505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0367"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hsl:OE4543R putative N-terminal acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46504"
FT                   /db_xref="GOA:C7NXR6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV46504.1"
FT                   /translation="MDQTDRVCRYWDPGECEGTRHCPPRCPRFVDREGSSWVIRPAADG
FT                   DHEALVDMYDDFAPGQAAQGLPPRKRSRIAGWLDGLLDEGCNFLVVGETGIVGHALYTP
FT                   TDDAEPEFAVFVHQDYQGRGIGTELSKHVVAAAAVADREALTLIVDPDNRTARRLYEKL
FT                   GFEVVEELPYEERGRRTAILRLRRPLDDRDGIEYQHVPIVGTRVDGRR"
FT   gene            complement(364565..365128)
FT                   /locus_tag="Hmuk_0368"
FT   CDS_pept        complement(364565..365128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0368"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hwa:HQ1994A
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46505"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV46505.1"
FT                   /translation="MARYVISDHHFGHSNIIEYCDRPFTSVGEMDSALLDRHYETVDPD
FT                   DLLVHLGDVAMDMRDGRETIEYFQQLGGDLLLQGNHDVGLDPAAAPFPVLDSCVLEHGD
FT                   YRFYCTHRPEDVPDDWDNWVIHGHIHNNDPETHPFVAPAEQRVNVSCELLDFRPISLET
FT                   LTGVLDAATTSLRDVAAAKALVEE"
FT   gene            365236..365907
FT                   /locus_tag="Hmuk_0369"
FT   CDS_pept        365236..365907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0369"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: nph:NP0728A serine/threonine
FT                   protein phosphatase; bis(5'-nucleosyl)-tetraphosphatase
FT                   (symmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46506"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR8"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACV46506.1"
FT                   /translation="MRIGLLSDVHGNRPALDAVLDDLPPVDELVCVGDVVGYNPWPAEC
FT                   LERVRETCSVVVQGNHDRTVETPERYAHNEMARAGLERARRALDDEQREWLADRPPRTT
FT                   IDGGRYRLAHSHPDPDQLGTYVRPRQFPELRPYLDDHDGIVVGHTHVQHEATVDDRLIV
FT                   NPGSVGQPRDGDPRAAYAVLDTDDDSVELRRVQYDIDRVISKVEALDRPRRLGIRLLDG
FT                   S"
FT   gene            complement(366122..366415)
FT                   /locus_tag="Hmuk_0370"
FT   CDS_pept        complement(366122..366415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46507"
FT                   /db_xref="GOA:C7NXR9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXR9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0785"
FT                   /protein_id="ACV46507.1"
FT                   /translation="MTDTTTIVDRIALGLSGALFVLGIVVMGVLELLAGKPYSPTALTN
FT                   DAGEVIATPLIDPTLRTGIVIAALLVLAVWGAYKLVTPMATDAADRTEMPAD"
FT   gene            complement(366430..366954)
FT                   /locus_tag="Hmuk_0371"
FT   CDS_pept        complement(366430..366954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0371"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hma:rrnAC0784
FT                   terminal quinol oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46508"
FT                   /db_xref="GOA:C7NXS0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS0"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACV46508.1"
FT                   /translation="MATNTANPLATDFELELDGPLTSYWLALLRVITGWWFFHAGVTKL
FT                   VEDGLAYSYGPMYMQEMTGTALGPIPVWMGNNLAWLIAPGVPLFETLIGLALMAGLLTR
FT                   LASIGGVIFMTLFWIGNAEFGHGLVNSDLMGLLLFLTVIVLGAGRYYGLDAIVEQTKLV
FT                   QRHPKLRYILG"
FT   gene            complement(367078..367548)
FT                   /locus_tag="Hmuk_0372"
FT   CDS_pept        complement(367078..367548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46509"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0433"
FT                   /protein_id="ACV46509.1"
FT                   /translation="MALDVPVPDPPSLSGPQTRGEYEAIDNEIVDTSDDYRREEVEGFF
FT                   QAGTWQDAFEEWTTSAGLSTAEFAVVERLDLIEAFDFYWDPASDEVGYRAPELPDDAAD
FT                   EYALDDPDGIDMALDSLGRIVSEVLENDYVLRDDDDFGFFDDEDVAYGDREE"
FT   gene            367633..368460
FT                   /locus_tag="Hmuk_0373"
FT   CDS_pept        367633..368460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0373"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: hsl:OE1211F
FT                   STE24-type metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46510"
FT                   /db_xref="GOA:C7NXS2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS2"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACV46510.1"
FT                   /translation="MRHVGLKARMAFVGSLLFGFYAVAAVVLMGLFGESALPLILVGSV
FT                   LFVGIQYKIGKWAALRSVGAEDLPEDRFPQIHKQVEYLSTDMGIEKPRLMVARMGVPNA
FT                   FAVGRKGAGTVVVSEELLQLLDADEVEGVLAHELAHIRNRDVVMMVLGQGIASIVAIAA
FT                   QWIVLLTGDNDLADFFLAIVVGQIVQMIVMVFVLAISRYREYVADSDAAAEVGGEPLAS
FT                   ALEKISRGSERAQDSAIDEQVSALCIFGEERGLLATLFASHPPVEKRIERLRN"
FT   sig_peptide     367633..367707
FT                   /locus_tag="Hmuk_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            368462..368698
FT                   /locus_tag="Hmuk_0374"
FT   CDS_pept        368462..368698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46511"
FT                   /db_xref="GOA:C7NXS3"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46511.1"
FT                   /translation="MDTRTVLAAVLGVGLGLVFLAAPGAVRTAYSVGRSPQDRRGEYGS
FT                   AERAGRRVHSLIRAVGAAFVLVGLYVGWQALAV"
FT   sig_peptide     368462..368548
FT                   /locus_tag="Hmuk_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.438 at
FT                   residue 29"
FT   gene            complement(368722..369168)
FT                   /locus_tag="Hmuk_0375"
FT   CDS_pept        complement(368722..369168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46512"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46512.1"
FT                   /translation="MPYRVRSRVPAGFDPSDVPLYEDQQARDDAYYEAEAESTPFFAVE
FT                   RYEEGYAITYDLLPAGYELSEPMRKELNERVTRTVEDVVGDEALATVEVSRSIGASLGN
FT                   VSFFQREATARDVAAVISRLVLAEENWVEADGPGDLPPTEVQKN"
FT   gene            369256..371385
FT                   /locus_tag="Hmuk_0376"
FT   CDS_pept        369256..371385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0376"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   hma:rrnAC2550 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46513"
FT                   /db_xref="GOA:C7NXS5"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS5"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACV46513.1"
FT                   /translation="MSEGTDTEIRRLDSATVERIAAGEVVERPASVVKELVENALDADA
FT                   DRVSVAVEQGGIEGIKVTDDGIGMSREAVERAVEEHTTSKISSIEDLERGVGTLGFRGE
FT                   ALHAIGAVSRTTITTRPRGREHQGTELVVEGGDVTAVEPAGCPAGTTIEVDDLFYNVPA
FT                   RRKYLKQTSTEFAHVNTVVTSYALANPDVAVTLSHDGRETFATTGQGDLEATVLSVYGR
FT                   DVAQSMIEVDDGDLPDGPLESVTGLVSHPETNRASRDYLSTYVNGRYVRADAVREAIVD
FT                   AYDTQLAPDRYPFAVLFCAVDPATVDVNVHPRKMEVRFADDEGVRRQVEHAVQSALLSE
FT                   GLVRSSAPRGRSAAEQTEIAPESGRVDDETDATGAREEADGEQSDGDSAGEARRRDTPV
FT                   SDRAADGASGASAGERGDRGQPDATTGIDVTDDDATADSAADTTSPRSRSSASSGRDEP
FT                   PTSAQSTRTDDADRGRARTGRDADPERKFRGDDRQARLGGEEPGQSLDSLPALRILGQL
FT                   HETYVVAEADDGLVVIDQHAADERINYERLKDAFEGETTTQALAEPVELELTAGEAAVF
FT                   EDRVEALARLGFHADRTGDRTVEVRTVPGVIADAAGPELVQDVLAAFVAGEHEAADTVE
FT                   AAADELLADLACYPSITGNTSLTEGSIRELLAALDDCENPYACPHGRPVVVEIDRGELE
FT                   DRFERDYPGHSGRRT"
FT   gene            371512..372471
FT                   /locus_tag="Hmuk_0377"
FT   CDS_pept        371512..372471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0377"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hma:rrnAC2551
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46514"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACV46514.1"
FT                   /translation="MSRLVTFGETSLRLSPPDHERLETATDVSLHADGTESSTAVAATR
FT                   LGAPAVWLSKLPDTVLGRRVVAELEQQGDGLQTQVVWDEDGRQGLQFVERGSPPRDDVT
FT                   VQDRGDTALATVSTDDVRMAMVQNADVFFVSGSTPALSPTARRTTEALYRACEGTCVFD
FT                   LDYQSGLWSLSDAREALLSLQDAIDVLVADEDDAQAVFDRSGKARQLAHSIASEGDFEQ
FT                   VVITRSERGAVAWDDNVVHEQDAIETEVIDASGTHAGFLGGYLHQLYEDAPTEQALAYG
FT                   TAAAALTRTVPGPLPTISAGEVEGLVETEREPTGERSI"
FT   gene            372539..373774
FT                   /locus_tag="Hmuk_0378"
FT   CDS_pept        372539..373774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0378"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: hma:rrnAC2133
FT                   mRNA 3'-end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46515"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV46515.1"
FT                   /translation="MQVEFLGGADEIGRSAVLIDGSLLLDYGMASESPPQYPVGDVDPD
FT                   AVVVSHGHLDHVGAVPALLSGTEQPTVHWTPPTRELALTLAEDTLKLHGGSPRCPFTEN
FT                   DVRRIGEVSATHGYREPFEAAGYEVTFYNAGHIPGSAHVLVSDGETRLLYTGDFHTDDQ
FT                   RLVSATSDRPAADAVICESTYSDVSHEDRGDVEASFVETLRTTVWQGGTVVVPAFAIGR
FT                   TQEIMLVCAAHGIDCYVDGMGQRVTEQLRHHPAFLRDADAFRGAVSNARFVDGRDGQRR
FT                   RIADQNAVVVTTSGMLSGGPAMTYVPAIADRPVNTIAMTGYQVEGTPGRDLLETGSAEI
FT                   DGRVMPVSAQVEAYDFSAHADREGLLSFLDAYRDSRLLINHGDRCESFARELRDDGHDA
FT                   SAPTLGETVRLS"
FT   gene            373856..374473
FT                   /locus_tag="Hmuk_0379"
FT   CDS_pept        373856..374473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:pNG7384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46516"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46516.1"
FT                   /translation="MVEPSRRETLAAIAGGTAAALAGCQWNAEPSDGEREQRRRVTDYE
FT                   VASVRHADERALFTEGEPLSTPRESDERPPVYGHTYLTSGDDLDDVTFAETSEAERLAS
FT                   FAAATALDGEESVYLFTTAVRACSEVRLQWVEVDGTGPSAQFCRTLRPADVECRATAYE
FT                   TTGFAIRLPFAGERFSGHGAGMSSSCGRPPRPEPFDPTEGSP"
FT   sig_peptide     373856..373939
FT                   /locus_tag="Hmuk_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.664 at
FT                   residue 28"
FT   gene            374470..375771
FT                   /locus_tag="Hmuk_0380"
FT   CDS_pept        374470..375771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:pNG7383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46517"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46517.1"
FT                   /translation="MNRLGRRRFLTAIGAGTTALAGCSALPSNGDDEPELDDDAIARAI
FT                   REREAPSVPATNPLSVPSSAIEDHRTAARETLERVPPELSVPNGAVTEKLREQRARVAD
FT                   TLDSSAEGAPVERLATWRDRRGDAVNVRRAYEAASGDADRGAYRDRCDEVRAERAAVGA
FT                   DLEYRAPEPVAATVGFATIESLLDTARGRLDPRSPFPEEPAAAVFDVGDRWEAVETAGI
FT                   ETADARRLRDAFVDATDDTPWRSHLVATSHHLGHSLQMTRDRVEEYVDAEASVLDADAA
FT                   TEPPTRHLFRQASDGVHWRTERAARARDRHDHATTVIELGRGLVAAETLDRIVAEIESG
FT                   DYRTELTEETIQSAHASAVSAVEDAVETTPQPLAVALATPAIQVVSGLRRRLDASRSRV
FT                   TPERLQPRLDYVVRYARVVPTATAFVADRLAVET"
FT   sig_peptide     374470..374562
FT                   /locus_tag="Hmuk_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            375818..376129
FT                   /locus_tag="Hmuk_0381"
FT   CDS_pept        375818..376129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0381"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   hma:rrnAC2137 tetracenomycin polyketide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46518"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT0"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACV46518.1"
FT                   /translation="MRQTHLDFEQYFSVAMETDEAQAAEMTVEPGRTVGGPENVHADSD
FT                   QWCYVAAGTGVATVDGADNRIEAGDLLLIEAGEAHAIENDGDEPLRTVNVYTPPRSDR"
FT   gene            complement(376749..376865)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0382"
FT   gene            complement(376997..377812)
FT                   /locus_tag="Hmuk_0383"
FT   CDS_pept        complement(376997..377812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46519"
FT                   /db_xref="GOA:C7NXT1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46519.1"
FT                   /translation="MMGNNGGRLTLVGAFSIAFASLGATTGQQQSWLVAIGLHLGIAYC
FT                   ILGSVRMVIPHEKIHWIVIVTVLGAGSMGLALQPIGSIVFGELGSDPRSIGSLSWAFAS
FT                   IAVALAYPLGRVSNKQIEWSIVGAIGIAISPHVYYLWQALDTVSVPAGAVVEMAGSINT
FT                   SLQPLAETSVIAAICLWAAIPLYHLGRTQSDIGTSSRVPSLPTATLGLGICLLQVLSIG
FT                   AANPVRAGSLQGVVLLFLVSPVLYFSGRLLQGIHTLNSDPENGAETGAD"
FT   sig_peptide     complement(377741..377812)
FT                   /locus_tag="Hmuk_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.718 at
FT                   residue 24"
FT   gene            complement(377903..378216)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0384"
FT   gene            378318..379760
FT                   /locus_tag="Hmuk_0385"
FT   CDS_pept        378318..379760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0385"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: hma:pNG7136 NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46520"
FT                   /db_xref="GOA:C7NXT2"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT2"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACV46520.1"
FT                   /translation="MTDPFVAIGGDAAGLSAASKCKREQPERDVIVFEKGSWVSYSHCG
FT                   MPYFVKGEVDRLDDLLSLSPAEIRERGIDLRRGHEVVAIDSDARVLTVETSAGDRLEQP
FT                   YGDLLIGTGARAVTTPIEGSDLAGVHTMHGLDSAAAVRAHLLDPAVDAVADVGGEEFVD
FT                   RELVERHAAFEPPETVAIVGGGYVGVEMAEAFSAHGLDVHLFQRGEHVLPPFGEAVAEV
FT                   VEGELAAEGVTLHLGEEVQRLDGDDGRVERLVCAGGASLAVDLALVGIGIRPNTDLLAD
FT                   TPIETGVADAVAVDDYGRTNVDGVYAAGDCATMRHAVTGERDWVPLGLTANRAGRAIGA
FT                   TVAGDPTPVGDIAGTAVVKAFEQECGRTGLVDHEAASDAGFDPVSETITAGSRSGYYPG
FT                   GAETTVTLIADRDSGRLLGGTIVGTDRAAIRIDIVAMALEQDATVGELERSDLAYAPPF
FT                   SPVWDPVLTAAKVLGSSVQERY"
FT   gene            complement(379754..380269)
FT                   /locus_tag="Hmuk_0386"
FT   CDS_pept        complement(379754..380269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0386"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   hma:rrnAC2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46521"
FT                   /db_xref="GOA:C7NXT3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACV46521.1"
FT                   /translation="MSDRFRVTVEHDDETETALFSDGECALSAGDATVRFNLGESASDD
FT                   GPVAGDDPKRIVDLDAVPTDSTVRFEARGPSHGVDCILRRIDDAVVAWRNSCPHRPEVP
FT                   LDPGTGAIVRGDDLVCHKHGAQFSGGEGTCTHGPCAGDALDAVAVAVDDDAVYLTDDRF
FT                   ESARVLGQ"
FT   gene            380358..380522
FT                   /locus_tag="Hmuk_0387"
FT   CDS_pept        380358..380522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE2363R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46522"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT4"
FT                   /inference="similar to AA sequence:KEGG:OE2363R"
FT                   /protein_id="ACV46522.1"
FT                   /translation="MDSEDVAVDVEVEVELDTAELEAEIEDATEYEATLEGDGIEIELE
FT                   AAVEFTDED"
FT   gene            complement(380597..380974)
FT                   /locus_tag="Hmuk_0388"
FT   CDS_pept        complement(380597..380974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0388"
FT                   /product="iron dependent repressor"
FT                   /note="PFAM: iron dependent repressor; SMART: iron
FT                   dependent repressor; KEGG: hma:rrnAC2037 iron-dependent
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46523"
FT                   /db_xref="GOA:C7NXT5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT5"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ACV46523.1"
FT                   /translation="MERVAQYLVVVYDRERTDGSPVEPGTVARAMGRSPSATTEMLQRL
FT                   ADDGLVDYEPYEGVTLTDRGRERATELYDTYRTLSAFFEEVLELESPEREARAVVDTVS
FT                   PIVADRLDALLLEGEESVPVQ"
FT   gene            complement(380980..381141)
FT                   /locus_tag="Hmuk_0389"
FT   CDS_pept        complement(380980..381141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46524"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46524.1"
FT                   /translation="MATTTAPDDRAGEPATDRPSIDVCETCPGSRTFIESDNTEGWIAT
FT                   DLVVDVRR"
FT   gene            complement(381270..381818)
FT                   /locus_tag="Hmuk_0390"
FT   CDS_pept        complement(381270..381818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0390"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: hsl:OE4427R
FT                   ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46525"
FT                   /db_xref="GOA:C7NXT7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT7"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACV46525.1"
FT                   /translation="MSQQQSTLKQAGTVEASEALRLEQEKVEQIVDALNADLANVYVLY
FT                   HQLRKHHWNVEGAEFRDLHLFLGEAAEEAEAAADELAERVQALGGVPHASAATLESEAT
FT                   VEPEDEDVYDIRTSLANDVDVYGEIIESARSHIELTEGLGDHASAQMLREQLVELEDAV
FT                   HHIEHYLEDDTLVTESAMQ"
FT   gene            complement(381909..382070)
FT                   /locus_tag="Hmuk_0391"
FT   CDS_pept        complement(381909..382070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46526"
FT                   /db_xref="GOA:C7NXT8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2135"
FT                   /protein_id="ACV46526.1"
FT                   /translation="MDEAYLDLEAVELELDEELLDAIDEKAFAEHRDNREAAIRDLLDE
FT                   WLKERDEE"
FT   gene            382204..382611
FT                   /locus_tag="Hmuk_0392"
FT   CDS_pept        382204..382611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46527"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXT9"
FT                   /inference="similar to AA sequence:KEGG:Franean1_0259"
FT                   /protein_id="ACV46527.1"
FT                   /translation="MSHSVDRSELTDTERAALHRLQLGVEHVHRGYGSLLACHHSIGHG
FT                   MDHFEAARELLSEAGHEAYAEALREEILPAGFVDDRWTYELVDAARTGFVDDVATLEAA
FT                   IRADLADGEQHVSERRLQRRWRRRAAGRDGE"
FT   gene            complement(382623..383351)
FT                   /locus_tag="Hmuk_0393"
FT   CDS_pept        complement(382623..383351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0393"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: nph:NP1384A thioredoxin
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46528"
FT                   /db_xref="GOA:C7NXU0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU0"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACV46528.1"
FT                   /translation="MPERYDVVVVGGGVAGLSASVFTARADFQTLVLDAGGSILRRNAH
FT                   LENVPGFPAGIDARQFLDLLGEQAQRAGAERRLATVETVTHRSDGFTVETDAGERYTSD
FT                   SVIAATKNETSYLSEIDGVGLIDRGKTFVDTDEHGRTGVDGLYAAGRLAEKPHQAVVCA
FT                   GHGAEVAVTLLTDDDAPFYHDWVVPEGYFTDRGRDLPPGCEEIDADERRRREERARARL
FT                   RETLADPHPEPPETHPSLTE"
FT   gene            complement(383442..384659)
FT                   /locus_tag="Hmuk_0394"
FT   CDS_pept        complement(383442..384659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0394"
FT                   /product="ferrichrome-binding protein"
FT                   /note="KEGG: hma:pNG7190 ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46529"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU1"
FT                   /inference="similar to AA sequence:KEGG:pNG7190"
FT                   /protein_id="ACV46529.1"
FT                   /translation="MADDRSSTRRRFVASSIAAGTALAGCAGSDATEADESDGSTPDDT
FT                   ARPRTQTESTTDAGHTATLSPAGTVSFDAVPETVFTVYPQYLDMAVALGHGDAVQSVYV
FT                   PEMSGPTMNHYYHHLDGVSLDWERLSDPLSDGFSKERLYTHDADVHLTDPAWVTTQDNW
FT                   GADDVDEVATQLGPWFGNFYSGTHDQPPEGYDDYQYYDLWELFGAVADVFRERERYEAL
FT                   AAVHADLVERIQSQLPPVEDRPTAVRATLSGDGETFWTYHLNEPGYWLADTRPLGANDA
FT                   FADQDWGGLWGTVDYETMLEADPDVFLHLWGMTPNYSITDTRTRLEDSASGSRLSAVEN
FT                   DRVYPAGMRYQGPIMNLFQIEMGAKQLYPEIFGEWPAYTDGEHYPEIHEGERLFDRQRV
FT                   AEIVTR"
FT   sig_peptide     complement(384564..384659)
FT                   /locus_tag="Hmuk_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.798 at
FT                   residue 32"
FT   gene            384761..385696
FT                   /locus_tag="Hmuk_0395"
FT   CDS_pept        384761..385696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0395"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   hma:pNG7275 ferrichrome ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46530"
FT                   /db_xref="GOA:C7NXU2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU2"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV46530.1"
FT                   /translation="MAGTHPTDTPTEVGHQRSWLTGRLAAFCLASAAITVFAGLLQVSF
FT                   GSYSMTIAEAWRSVFDPSIVFDPAVWNIRLPRVLVAVVTGATLDVSGAIFQAVARNELA
FT                   SPYILGVSSGAGLAVLLTLVVFSGLTPFLPLIAAAGGTVAFALVYAIAWKGGTSPVRLV
FT                   LAGVIVGTVFQSLQTGVFFFADDLVVVQSAIAWTTGSLTGTDWEQVRLSIVPATFAIVL
FT                   AQAARFADNLVAMRDGQLYDWGPPREVVTEQLLADVFGVEARIQHEPELQILPSGLSRN
FT                   DLASIFPRLNFSDLGIYPLNRSHSGVEHTS"
FT   gene            385738..386925
FT                   /locus_tag="Hmuk_0396"
FT   CDS_pept        385738..386925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0396"
FT                   /product="ferrichrome-binding protein"
FT                   /note="KEGG: hma:rrnAC0899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46531"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0899"
FT                   /protein_id="ACV46531.1"
FT                   /translation="MTDESRRSQTRRTVLKTGATLSVAALAGCTESTSGGDADESASTT
FT                   TDAPADATTTTDADAETTADTSYSVSMEPVGTVEFDEVPETWVANNGSWADMGIALGQQ
FT                   PPEGVWLPGRYHTQYYDDIPGVSVDTDEMTALYQDSVSKELFYTLDGDVHVIDPNFLLN
FT                   RFKGWDQIDIDEVTDNVAPFFGNSIFSGGYTWHEDYQYYSLYEAFEKLAAVFQQRDRFE
FT                   AFSALHDDFQSSIDDVVPPEGERPEVAIMWAGSDEPTEFSPYLVSRGTSFKQWRDLGVR
FT                   DALAETDVEDFHESRGRIDFETLLKIDPEHIMFRGQEAKSREAFEDTILAYMENHEVAS
FT                   QLTAVENGDVYRGGPLYQGPITNLVLTERAAHQVYDIDEQLFDRQRVADIVNGEF"
FT   sig_peptide     385738..385845
FT                   /locus_tag="Hmuk_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.699 at
FT                   residue 36"
FT   gene            386997..387080
FT                   /pseudo
FT                   /locus_tag="Hmuk_0397"
FT   gene            complement(387089..388024)
FT                   /locus_tag="Hmuk_0398"
FT   CDS_pept        complement(387089..388024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0398"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: afw:Anae109_4059
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46532"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACV46532.1"
FT                   /translation="MDVFIAGATGDLGKRLVEQFTANDHTVVGLTRDEEGDEIVRERGG
FT                   QPHRGDLFDVDSLVSGATGADVVIHAATAIPTETKPSPADWEQNDRIRREGVENLTTAA
FT                   AEVDADQYVQQSIVWVARQPDGSPFDETAPRNTDRTTESAADAEDIATTAARDGPFDAT
FT                   VLRCGWFYAADSEQTRTIAENLESGDMPIVGGGLFGRKDAVVSPIHIDDAANAFVAAAE
FT                   DGLEGTYHVVDDEPVTVADFLTTFAEHLDAGEPSRIPGWLAKLFVGKDNVRFFTSSMPT
FT                   SNEQFREATDWVPTYSTHEDGLAAVADNLS"
FT   gene            complement(388498..389445)
FT                   /locus_tag="Hmuk_0399"
FT   CDS_pept        complement(388498..389445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0399"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hma:rrnAC2140 short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46533"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV46533.1"
FT                   /translation="MTDWTARDMPSLDDRTVVVTGANSGIGYEATKAFARRGATVVMAC
FT                   RSTERGERAAREIDRSVANADLDVMACDLADLDTVADFAEAFTSAYGELHVLCNNAGVM
FT                   ALPRGETADGFERQLGINHLGHFTLTGHLMEALAATDGARVVTQSSGAHQNGEIDFEDL
FT                   QGERSYGRWSAYSQSKLANVLFGYELDRRADEAGIDVTSAVCHPGYADSDLQRRAGEAG
FT                   AGAIGAVIAQAANALVAQSAARGALPMLYAATHDGISGGEYVGPGGLLNMRGAPAVQDS
FT                   SARSYNAATASRLWHVSEDLTGVEYDFEVPAAAV"
FT   gene            389611..389862
FT                   /locus_tag="Hmuk_0400"
FT   CDS_pept        389611..389862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0400"
FT                   /product="S1 IF1 family protein"
FT                   /note="PFAM: S1 IF1 family protein; SMART: initiation
FT                   factor 1A (eIF-1A); KEGG: hsl:OE3470F translation
FT                   initiation factor aIF- 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46534"
FT                   /db_xref="GOA:C7NXU6"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU6"
FT                   /inference="protein motif:PFAM:PF01176"
FT                   /protein_id="ACV46534.1"
FT                   /translation="MPNDDELFAVVTEHNGGNHVRVQCEDGKERMGRIPGRMKFRTWIE
FT                   TDDVVLVEPWDWQDEKANIEWRYTSQDADQLRSEGHIQ"
FT   gene            complement(389932..390228)
FT                   /locus_tag="Hmuk_0401"
FT   CDS_pept        complement(389932..390228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46535"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46535.1"
FT                   /translation="MSAFGVGGLWAVILVGYEKIRKKTNDILPAGTVSTTLQSVIDSII
FT                   VGGGSGATLWLVHWHLSAVEFGAASYLLVGGFLFFRSYWPLSESEAELSSTDR"
FT   gene            complement(390344..392281)
FT                   /locus_tag="Hmuk_0402"
FT   CDS_pept        complement(390344..392281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0402"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   hma:rrnAC2314 ABC transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46536"
FT                   /db_xref="GOA:C7NXU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46536.1"
FT                   /translation="MSTDEQTPFDRYRTRIDRPLVRLFADYGTSRTRWLVIGLVANLLA
FT                   QTASLLPPVVLGTAIDALFREETSEYSLLFLPRAWIPPGEVAQFWLSVALIAGSFVATA
FT                   LFTWIYGVSANFFAHGVMHSVRSDSFEKMLRLDAAFFDDKQTGEVMSILSNDSQNLELF
FT                   LDNALMNGVRLIVMVLGIAAILFALNWQLALVTLVAIPLIGGFTVWFMRVIEPRYEARQ
FT                   SAMADFNTRIENGITGVILAKVTGSEDYEVDRVRDASHGVFETTMDVLKLSYFYRPGME
FT                   LLAGFSFAATFLVGGYWILFDAPGPLTGDLSVGVFVTFVFMTQRFVAPLAEVSNIVDEV
FT                   QNAKVSAARVFGLADIPVRITDREDAKRLGDPEGRVTYEDVCFSYPELLTDDHGPAVPD
FT                   DETETDGGFAALDGDEGDDDSVIEHVSFEAEPGETVAFVGSTGAGKSTLCRLLLRLYDV
FT                   DEGRVAVDGTDIRDLELASLRQHVGYVSQDAFLFDGTIGENIRYGRFDESDEAVREAAE
FT                   AAEAHEFIQRLPDGYDTRVGERGVKLSGGQRQRIAIARVVLQDPEILILDEATSDVDTD
FT                   TEQRIQASLDALTADRTTFVVAHRLSTVIGADTILVLEDGEVVERGDHDTLRQQGGRYA
FT                   ELWGAQTGSE"
FT   gene            complement(392399..393034)
FT                   /locus_tag="Hmuk_0403"
FT   CDS_pept        complement(392399..393034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0403"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: hma:rrnAC2143 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46537"
FT                   /db_xref="GOA:C7NXU9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXU9"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACV46537.1"
FT                   /translation="MDYGVYLVTQASHSAGRSTPEIVSAAIDGGVDVVQLREKDLTARE
FT                   RLAIGRRVRERTRAAGVPLIVNDRIDLARAIDADGVHLGDDDLPLSVARELLGEDAVLG
FT                   RSVSFVEDAVAAEAAGADYLGVGAVYATGSKDDIDDDEHAIGPERIATIVDAVSIPVVG
FT                   IGGITPDNAAPVVDAGADGVAVITAITAADDPAAATRRLSETVDDARE"
FT   gene            393144..394085
FT                   /locus_tag="Hmuk_0404"
FT   CDS_pept        393144..394085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0404"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: hma:rrnAC3122
FT                   malonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46538"
FT                   /db_xref="GOA:C7NXV0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV0"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACV46538.1"
FT                   /translation="MDSLWALAAGVDLDLLGRFAYMLALVAVGFGARRLGVLTNDRNER
FT                   LGQVAFYVLLPALVFSSTYDKRLGELVSVALVAGLVVVIGTLVALSLVSNRGGDDDVRS
FT                   VAVIQSYHGNFGYFGVPVVAATLGSTAAATASIILGLGALIQIPLTILVLVRINETEAD
FT                   FLGELRNLVTNPILLTLGVGLVFATLQLDVPTAAGTGLDWLSTLALPVALLAVGGSLDP
FT                   RGPEIPLTRTATVVGLKVLVMPLIAWLVFSGLGADAMTRNAALVMFGAPTAVSTYVYAT
FT                   ELGGDSAFASVNVFATTVASIVSLFFLLLVIT"
FT   gene            394664..395044
FT                   /locus_tag="Hmuk_0405"
FT   CDS_pept        394664..395044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP0712A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46539"
FT                   /db_xref="GOA:C7NXV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV1"
FT                   /inference="similar to AA sequence:KEGG:NP0712A"
FT                   /protein_id="ACV46539.1"
FT                   /translation="MVLAGLVGSVVTFLVSLLIGGLGIYVGARVMTGDGDFERAVWTAL
FT                   FAALGVGVVSLLVGWIPLLGGLLATVLGFLVYLGIINWRYPGGWIDAAGIALIAWLASV
FT                   IVLTLVSRLLPGGVGALGVAGV"
FT   gene            395120..396262
FT                   /locus_tag="Hmuk_0406"
FT   CDS_pept        395120..396262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0406"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   KEGG: hma:rrnAC2245 M50 family metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46540"
FT                   /db_xref="GOA:C7NXV2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV2"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACV46540.1"
FT                   /translation="MRSFKVAQVWGIPIKIHISLLVVLPLFAWLLGSGQQIELYAGLIE
FT                   GLTGAPLDTDALTVDGAIPWIIGSAAAVGLFASVALHELGHAWAALRYDLEVESITLWI
FT                   LGGLASLSAIPREWNKEFWIAVAGPATSVVTGLACYGALFVIPASQPVVVFVVGWLAVT
FT                   NVVLAVFNMVPAFPMDGGRVLRALLARNRSYAGATRTAATVGKLFAILFGAAGLLGGFN
FT                   PMLVLLALFIYGAASSESRTVALGDLLEGLTVTDMAAAPDATIEADATVSELVTRMFAD
FT                   RRTEFAVVEDGDVVGVISGNDFRAVAPEERETTTVADLMATDLPTFDGSMSAFDALVAL
FT                   DQARASEAFVTTPEGTRVVSRTDFASAMEMRKVLGRGEPL"
FT   gene            complement(396287..397630)
FT                   /locus_tag="Hmuk_0407"
FT   CDS_pept        complement(396287..397630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG6077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46541"
FT                   /db_xref="GOA:C7NXV3"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV3"
FT                   /inference="similar to AA sequence:KEGG:pNG6077"
FT                   /protein_id="ACV46541.1"
FT                   /translation="MDRRARGLALVGLGVLVIVGTLAVGAVTAPDRSVTDGDERQTLVG
FT                   SQGGGTGWHDHGSVYLVDSDEIAWREDSADSYFDVTMLPNGSVMAGFMHSGYEDGCGPY
FT                   ETPCTKTGFRVIDPDADGGPTVVSEHAVPVRSQGNSEVHDVERLPSGEYLMTDMDAERL
FT                   VAVRNGEVTWEWRASELYTAPEDPTRRDWLHVNDVDVINESHYLVSVRNANQLVVVERG
FT                   AGAVEVINADRGGSDDSCLVRGEQLVPDADGDVRCGDPDVLNHQHNPQWLGDGAVLVAD
FT                   SDNHRVVELHRTESGEWEPAWTLERAGGIRLDWPRDADRLSNGNTLVTDTLNTRIFEIS
FT                   PNGTVVWSRETPDTSPIPYEAERLPEGERVGGQRYPGGEAAGETDGRTPTATPDAPGGD
FT                   VPGLSLGMTVLRAAVPSTPFWFGEAHLGFSLVGLVLVVGGGIDRWRAL"
FT   sig_peptide     complement(397550..397630)
FT                   /locus_tag="Hmuk_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.636 at
FT                   residue 27"
FT   gene            397714..398550
FT                   /locus_tag="Hmuk_0408"
FT   CDS_pept        397714..398550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0408"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: hma:rrnAC2244 zinc
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46542"
FT                   /db_xref="GOA:C7NXV4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV4"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACV46542.1"
FT                   /translation="MLQTVPELFVRVVGTDPVIQGLAGGIVIAAMNLLGASLVLVWRDP
FT                   SERALDGALGFAAGVMLAAAFTSLIIPGIEQYSGGDPLPTLAGVVLGALFLDQADRFVP
FT                   HAHYLLTGSRRTDAADPTDRLPAVDERLGAVVLFVLAITLHNMPEGLAVGVGFGSGNVE
FT                   EAIPLMIAIGIQNVPEGLAVSVAAINAGLDRRAYAVFAGIRSGVVEIPLAVIGAVAVSV
FT                   VAPLLPYAMGFAAGAMLFVISDEIVPETHTRGYERVATLGTMAGVVVMLYLDIALG"
FT   gene            398658..398831
FT                   /locus_tag="Hmuk_0409"
FT   CDS_pept        398658..398831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE2127R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46543"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV5"
FT                   /inference="similar to AA sequence:KEGG:OE2127R"
FT                   /protein_id="ACV46543.1"
FT                   /translation="MGFGSYDESEQKDQDNDIDEDEAVNVHNNDHDGDVSFESDADQDE
FT                   LIGRLDEMRDEE"
FT   gene            398999..399913
FT                   /locus_tag="Hmuk_0410"
FT   CDS_pept        398999..399913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0410"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   6-phosphogluconate dehydrogenase domain protein; KEGG:
FT                   hma:rrnAC2180 6-phosphogluconate dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46544"
FT                   /db_xref="GOA:C7NXV6"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR032883"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV6"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACV46544.1"
FT                   /translation="MELGVIGLGRMGRIVVDRTLAAGHDVVAFDISGEAVADAAEAGAT
FT                   PADSIADVADQLGAEKRIWLMVPAGDPIDAALDELDGLVDADDVIVDGGNSNFHDTLRR
FT                   AERTDAAYVDCGTSGGPASAEDGFSLMVGGPEWAYEALVPVFDAVATGPAGHDRMGPTG
FT                   SGHYVKMVHNGVEYALMQAYGEGFELLANGRFDLDLESVARTWNNGAVIRSWLLELCEE
FT                   AFREEGTDLGDVADRVEGGSTGTWTVQEALEQEVPTPLIYQALAERFSSRSTDGDDPGR
FT                   FARRLANRLRYGFGRHDVPRREE"
FT   gene            complement(399953..400417)
FT                   /locus_tag="Hmuk_0411"
FT   CDS_pept        complement(399953..400417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46545"
FT                   /db_xref="GOA:C7NXV7"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3528"
FT                   /protein_id="ACV46545.1"
FT                   /translation="MGIRESWNELGTGGKILVGLAVGVVLLAVLLVVLVVLAAVLASFV
FT                   LGVGDEAAQTTPTVSFDFDYDDSTTTTTIRHEMGDSIPASQLRVVVAERSVGWADGGGA
FT                   VSGDDGEVVAGDSITVDTQPGDRISVVYDGPDTTSTLAAHEIHEVTVTVS"
FT   sig_peptide     complement(400301..400417)
FT                   /locus_tag="Hmuk_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.714 at
FT                   residue 39"
FT   gene            complement(400636..400764)
FT                   /locus_tag="Hmuk_0412"
FT   CDS_pept        complement(400636..400764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46546"
FT                   /db_xref="GOA:C7NXV8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46546.1"
FT                   /translation="MAGIGLAILTMGILGESGLDIFLLIITVLVIAYSFVPTVLNS"
FT   gene            complement(400859..401695)
FT                   /locus_tag="Hmuk_0413"
FT   CDS_pept        complement(400859..401695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46547"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46547.1"
FT                   /translation="MRDRRNFIRMAAGSIAALSTVGTVSAARRTHGLSKQKVNKAFHRG
FT                   IIQDGAAGARANLEDLGIEDPTVKSHNDFNVQTDPETLTEEDDDAGRVSPEYKYGDPEN
FT                   TDSKLFVSQHNVDGSDDKVKVSVGMALRDQKLTAGHAFWCDDAIGVGYNNSDWAAVGNP
FT                   VVRASKDHSARFTSDDVGDDALAGTVNIKDHYGRGEETSLPQAAATLSGVFRLRDGKVP
FT                   STLWGSYNHTLSISPSGAISDISGGKGGISVGLNTEARKAWSIADSVDPRKDLPGY"
FT   sig_peptide     complement(401615..401695)
FT                   /locus_tag="Hmuk_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            402181..402762
FT                   /locus_tag="Hmuk_0414"
FT   CDS_pept        402181..402762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0414"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: hma:rrnAC2179 2Fe-2S
FT                   iron-sulfur cluster binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46548"
FT                   /db_xref="GOA:C7NXW0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW0"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACV46548.1"
FT                   /translation="MVEPVSVAAGAVLTIVVVAVHYSSGTGWEPSEDISQNVIEKRAAT
FT                   VPETDFPEPYNRSIGGGGSAAAIPAGEEGAELEEGAEEADDGFDPDEIADDEVEYYEIE
FT                   FAKEGETIEVANNETILDAGEDEGWDMPYACRQGQCVSCAGQITDGAASDYIRHSQNES
FT                   LFDDDMEEGYCLTCVAYPTDEFTIETGEQP"
FT   gene            402885..404207
FT                   /locus_tag="Hmuk_0415"
FT   CDS_pept        402885..404207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0415"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; peptidase M20; KEGG: hma:rrnAC2170 aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46549"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW1"
FT                   /inference="protein motif:PFAM:PF04389"
FT                   /protein_id="ACV46549.1"
FT                   /translation="MTEWIGETFTSDAGWRHLTELVDTGTRMAGSEGERAAAEATRDAL
FT                   AEYARDAGLSAFDIQGWEREASAITADGETVASDDRAVIALPRSPAGSVTGRLVDAGHG
FT                   LPEEFAEADCEDAVVIARSDVPDWYDRYIHRREKYYHAVEAGAAAFVYVNHVEGMLPPT
FT                   GSVGTPEEPIGDVPAVGVARETGARLARRYEGETATVSVDCTTPDATSQNVHAELGPDT
FT                   DEAVLVTSHVDAHDIAEGAMDNGAGTATVVEVAKALAAREGELDTRVEFVAFGAEEVGL
FT                   VGSSRLADETDLEDVKAVLNLDGVVRGRTLQCYTHGFDGLIEATEAVADRLDHPITTSP
FT                   TMNPHSDHWPFVQWGVPGIHVMSETDGEGRGWGHTHADTLDKLEPRTLREQAVLLTELA
FT                   VELADEERALPRRDTAEIATALEEQDLAEGMQVVGDWPYDD"
FT   gene            404407..404781
FT                   /locus_tag="Hmuk_0416"
FT   CDS_pept        404407..404781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46550"
FT                   /db_xref="GOA:C7NXW2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46550.1"
FT                   /translation="MNERTGKAVAFLGLSGSISFLRIVPTVESAAHLSAIAWVPEVTLG
FT                   LLWAATGVVGALGELTSSDAEYRDSGQLPSYVWGWASLLVAMFVVGLGFGYLTEDYLRF
FT                   GAELVAPIGALITYLVIRHR"
FT   gene            complement(404868..406850)
FT                   /locus_tag="Hmuk_0417"
FT   CDS_pept        complement(404868..406850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0417"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   hma:rrnAC2314 ABC transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46551"
FT                   /db_xref="GOA:C7NXW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46551.1"
FT                   /translation="MDVDAGDDDAFEDVRENVDHPMRRLFAEYGRDNTGAFTVGLLSSI
FT                   AARLLDLLPPVLLGVAVDAIFRNDRPFALGPVDLSAYASDPESQVILASSIIAGAFILG
FT                   AGFHWTRNWGWNAFAQRIQHAVRTDTYDRMQRLNMDFFADKQTGEMMSVLSNDVNRLER
FT                   FLNDGMNSAFRLSVMVLGISAILFYYNWQLALLTLVIVPAIAFFTYRFIKAIQPKYADV
FT                   RSSVGQLNSRLENNLGGVQVIKTYSTEGYESDRVEDTSRDYFDANWGAITTRIKFFPGL
FT                   RVLAGVGFVVTFLVGGLWVYSGEGPWIFTGTLSEGEFVVFILLSQRFIWPMAQFGQIIN
FT                   MYQRAYASAERIFGLMDTPSLIEETDDAEELAVTDGEVEYDGVTFGYGETQSVSEQSSG
FT                   EGTDPADDEVILDDVSFTVDGGDTLALVGPTGAGKSTVMKLLMRMYDVNDGAVRIDGQD
FT                   VRDVTIPSLRDAIGYVSQETFLFHGTVRDNIAYGSFDATDEEIREAAKAAEAHGYIQNL
FT                   PDGYDTMVGERGVKLSGGQRQRVAIARAILKDPEILVLDEATSDVDTETEMLIQRSLDR
FT                   LTADRTTFTIAHRLSTVKDADQIVVLEDGSVVERGSHDDLLAEDGLYANLWAVQAGEID
FT                   ELPEEFVRRATERRSQVDAEVGDDD"
FT   gene            407036..408457
FT                   /locus_tag="Hmuk_0418"
FT   CDS_pept        407036..408457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0418"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: hma:rrnAC0487 HTR-like protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46552"
FT                   /db_xref="GOA:C7NXW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV46552.1"
FT                   /translation="MNLAPVATILVVDDSDFFLEITSETLEEKHGLNTRTASTGSEALA
FT                   VMRDQQIDCVVSDYEMPSMDGLELHKAIDAEFDVPFILLTGQGDETVASEAIGAGIDDY
FT                   LLKTRIIDGEQLQLLANRIDNVVSQYEARRKYEQLVDNTPDEIVEVTSDGMILSANTSM
FT                   ASSHGMTREQVIGERLSSVIDPDVAARRLEYGHRATTAGSAVTFQDNIGVRQFHNIVTP
FT                   RRETADHETVQFISRDITQQKRHEQQLETKTEELALINRLVRHDINNDVQLLMGWAGAV
FT                   APHVDEDGVEYLERIQDTCDHIAELTANVGAFTDALEESGAVDFTPIELSDVIASEVTK
FT                   SQRRFEDATIRVEGALPTVTIEANGAVQAVFGNLLSNAVHHNETDDPHITVTMTVTDTV
FT                   ARVTVADNGPGISDEFKPSVFDKDEMGKKSDGTGIGLYLVETLVEQYGGDIWIDDNDPR
FT                   GAAFTVELPRSDLAT"
FT   gene            complement(408494..409477)
FT                   /locus_tag="Hmuk_0419"
FT   CDS_pept        complement(408494..409477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0419"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   hma:rrnAC2315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46553"
FT                   /db_xref="GOA:C7NXW5"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW5"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ACV46553.1"
FT                   /translation="MERSTAVVGGTIGLLVVGALVVWSGVWLQFVDPGSYERTTVTVVD
FT                   EGGTELGAVDARIADTWQQRLVGLSRTDSLAVDEGMLFVHDRQDQHGYVMRRMSFPLDI
FT                   VFVAENGTITRIHHAPTPADGASESDLREYSGEGKYVLEVNRGWTNATGVSVGDRLLIS
FT                   GETSDDAVSDEAAGDQQATASTPECPAGPTGTPSPDNATVTALDDDCAPLGTVSVAIAD
FT                   NSSERITGLSDTESLAVDEGMLFVFPEIGEHAFVMREMSFPLDIVYVAANGTVTRIHHA
FT                   PVPEGEYERRYPGEGKYVLEVNRGWTNETGVSVGDRLRLPNVTAAS"
FT   sig_peptide     complement(409403..409477)
FT                   /locus_tag="Hmuk_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.600 at
FT                   residue 25"
FT   gene            409564..409636
FT                   /locus_tag="Hmuk_R0003"
FT                   /note="tRNA-Val1"
FT   tRNA            409564..409636
FT                   /locus_tag="Hmuk_R0003"
FT                   /product="tRNA-Val"
FT   gene            complement(409727..409894)
FT                   /locus_tag="Hmuk_0420"
FT   CDS_pept        complement(409727..409894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46554"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2943"
FT                   /protein_id="ACV46554.1"
FT                   /translation="MAHCPECEATLDQQDDVEFVDMDSTTGFFTASKRFYLVACGECGA
FT                   AIGSGVAGAM"
FT   gene            complement(409894..410079)
FT                   /locus_tag="Hmuk_0421"
FT   CDS_pept        complement(409894..410079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46555"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2944"
FT                   /protein_id="ACV46555.1"
FT                   /translation="MVHCPECQTPLETADDIEFAETDATTGFIKASKRFYTANCAACGL
FT                   TIGSGVAGAKSNGGAV"
FT   gene            410167..411129
FT                   /locus_tag="Hmuk_0422"
FT   CDS_pept        410167..411129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46556"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2123"
FT                   /protein_id="ACV46556.1"
FT                   /translation="MPTCYAALDDRLLVIEDDDWMARERPVAHSLECVAAAPERPERVF
FT                   VGTVDAGLQCSTDGGDSWTTGLDTGDRVTAVTVSPHDPGVIWAGTEPSRVYRSIDGGDS
FT                   WSERPGLQSLPSASRWSFPPRPDTHHVRWIAVDPADPDRLYVAIEAGALVRTDDAGESW
FT                   EDHPDGARRDNHTLGTHPDAPERVYTAAGDGYAESRDRGDTWSFPQSGLDHRYVWGLAV
FT                   GADPDDVVVSAATGARDAHSTEGESSVYRRTDDGWERAMSGLPDPDGLARAVLAAHDGQ
FT                   FYALTNHGLFASDDGRAWSALGLAWPDEYRQLPRGLAVV"
FT   gene            411200..411844
FT                   /locus_tag="Hmuk_0423"
FT   CDS_pept        411200..411844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0423"
FT                   /product="protein of unknown function DUF1508"
FT                   /note="PFAM: protein of unknown function DUF1508; KEGG:
FT                   hma:rrnAC1613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46557"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXW9"
FT                   /inference="protein motif:PFAM:PF07411"
FT                   /protein_id="ACV46557.1"
FT                   /translation="MSEETIHESSETRSRRGIASYFRRLARRFATGEPAPADEEQTVTV
FT                   SAPPEADLETEVEREGERLNLEIEVAWTEDGDDVDTDAAASKATFELFEDSAEEWRWRL
FT                   VHDNGNVIADGGEGYASAQKAEQGLESVRSNAPGANVIDQSKDDESQDGGSDATFELFA
FT                   DSAGQWRWRLVHDNGNIIADGGQGYSSKQKAKQGLRSVKQNVRGAQVEREE"
FT   gene            complement(411863..413323)
FT                   /locus_tag="Hmuk_0424"
FT   CDS_pept        complement(411863..413323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ3226A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46558"
FT                   /db_xref="GOA:C7NXX0"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX0"
FT                   /inference="similar to AA sequence:KEGG:HQ3226A"
FT                   /protein_id="ACV46558.1"
FT                   /translation="MFSDGLLASCRRIGTGLTDCVARARANATAADWIRFALLATICLL
FT                   LAVVAANVATSTPADNTTLQRGTVTQPADNTTIVSVQGYTFEGSVNDKKPARLIAADER
FT                   AGTDWTYQSRQGSGAWFFDVDPLDDGNLLVVSPRSGETLIYELNPETNERVWERRFPFE
FT                   DTHDADMLSEDELVIGHMRAWNETSEVSNDEVVVYNLTTDEITWRWRLREHFDNDTDGG
FT                   MNADWSHLNDVDQVGEHRLLLSPRNFDQAIVVDRRSGEIVRRLGRDDDYSVLTEQHNPD
FT                   YLVGENGTPTMLVADSGNDRVVEYARLNGSWERTWEVGTGSLKWPRDADRLPNGNTLIV
FT                   DSLNHRVIEVTPTGEIVWEYYATWGPYDAERLGTGDESNGPTIRQQNATGSYDLSGSAG
FT                   LRPGTGDNLDFPSRLQATFSGTLLSGPANALAQLWGHYMPWFRPVWLSSWDAAFLIGAG
FT                   LLGVSWAGGEAIVRRKRLVGGLRRRLPF"
FT   gene            complement(413397..414128)
FT                   /locus_tag="Hmuk_0425"
FT   CDS_pept        complement(413397..414128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0425"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: hma:rrnAC1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46559"
FT                   /db_xref="GOA:C7NXX1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACV46559.1"
FT                   /translation="MASAIQLYTLRDMDCSVPELLDRVAGAGFDGVEYAYRVPEADPEA
FT                   VRTALDETGLAVPAAHVPVDALEDDLAATVEQYRSLRTERLVVPYLDSESFGTVERVRE
FT                   TARRLDGLADRLADYDYPLLYHNHDAEFAEVDGRTAFDVLVEETDSVAFELDVGLATYA
FT                   GVDAAAVIDSHADRIDLLHCTDTHVDAAEPAHAAFDTGDVDYDAVFDAAERAGIEWRIY
FT                   ENGSQDDPVGELDHAAERFLS"
FT   gene            complement(414197..415087)
FT                   /locus_tag="Hmuk_0426"
FT   CDS_pept        complement(414197..415087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46560"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2826"
FT                   /protein_id="ACV46560.1"
FT                   /translation="MSRADDLRDCEDCLAPADAFAIVGEETRLSILEALWRLDEPAAFS
FT                   EIRAAVGMTDSAQFNYHLGKLTDQFVRKTDDGYELRTAGERIVQAIFAGSFTQHPEREI
FT                   EIDDPCVRCGATLSAHYVDEQLSITCPACEHGHGEYPFPPGGLHDRTDAEILSAFDQRV
FT                   RHLHCLAKDGVCPECNGRMATTIGRGEDCCLGVSVRATHRCRQCAHELCSAVGLGLLDQ
FT                   SPVVSFYEDHGVDLAQTPYWRLDWCVDDHPVTVVEEDPWRLRVDVTRDGDRLAVVVDGD
FT                   LEIVETRRDPATPAE"
FT   gene            415246..415725
FT                   /locus_tag="Hmuk_0427"
FT   CDS_pept        415246..415725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0427"
FT                   /product="PUA domain containing protein"
FT                   /note="PFAM: PUA domain containing protein; SMART: PUA
FT                   domain containing protein; KEGG: hma:rrnAC2087 PUA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46561"
FT                   /db_xref="GOA:C7NXX3"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX3"
FT                   /inference="protein motif:PFAM:PF01472"
FT                   /protein_id="ACV46561.1"
FT                   /translation="MNVKSRHHLRADEIDAIEESVAANLGVELDADTFEKVEFEDSDWD
FT                   VVLVDGDPLVLYVEGEPFLTVEGLNAYPPTDHVVTVDSGAISFVSDGADVMRPGITEAD
FT                   DGIAAGDLVAINEESHGKFLAVGRAKASGDGMVGDSGKVVESIHHVGDDLFEFSV"
FT   gene            415832..416050
FT                   /locus_tag="Hmuk_0428"
FT   CDS_pept        415832..416050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46562"
FT                   /db_xref="GOA:C7NXX4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46562.1"
FT                   /translation="METATRLYDRIDAWLRDLSRVPYAAILGTATGLGVLVVGAVLGSG
FT                   LLVVQAVTMAVVVFGLECVFGLHQTDE"
FT   gene            416220..416657
FT                   /locus_tag="Hmuk_0429"
FT   CDS_pept        416220..416657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsl:OE1708R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46563"
FT                   /db_xref="GOA:C7NXX5"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46563.1"
FT                   /translation="MREELTARQRVEKREQYSQWINRSVGFGVLSFFVATALWMLTDRA
FT                   VVLFAGLGLYWLGCLGMAVGYWQSPVSVGDELERRMEREASQTTFLFVTVVTILGLPAD
FT                   VVLSTTGVYTAPAAVRGALWGYLLLILVFGAVHWFVKRQYE"
FT   gene            416671..416880
FT                   /locus_tag="Hmuk_0430"
FT   CDS_pept        416671..416880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0430"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: hsl:OE1707R
FT                   transcription regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46564"
FT                   /db_xref="GOA:C7NXX6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV46564.1"
FT                   /translation="MKNEIATYREQEGLSQGELAAAVGVSRQTINAVERERYDPSLALA
FT                   FTLAAYFDCRVEALFDPDLEPVGE"
FT   gene            416981..417625
FT                   /locus_tag="Hmuk_0431"
FT   CDS_pept        416981..417625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0431"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; heat shock protein DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   KEGG: hsl:OE3974R DnaJ N-terminal domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46565"
FT                   /db_xref="GOA:C7NXX7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACV46565.1"
FT                   /translation="MASPFEVLAVDPNASDEAIERAYRERVKETHPDHGGSLEAFQSVR
FT                   AAYERILSGEADGTERQRADDDSDDGGSIHPRVEYLNYEVLDDHGWHADDDDLFEKAAG
FT                   AGLDDVDYGSFHVYPRESVLEAAERNDFAWPFACRGGACANCAVVVLSGALTTRVDHVL
FT                   PDEIVDRGFQLACNGIPTSDELQLLYNVKHMAELEELLLPPRPFEQAHSDD"
FT   gene            complement(417776..418444)
FT                   /locus_tag="Hmuk_0432"
FT   CDS_pept        complement(417776..418444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46566"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2988"
FT                   /protein_id="ACV46566.1"
FT                   /translation="MTADGRDGPSHAERESPVGKPVIRGDPSLTGQRAQEAVEFDPDDP
FT                   ESLELAARTVRAFSENTAGADDNVYMLRGAAACAALVRGEGSYKAAAERAGGDATVSFI
FT                   RKWSRVHDLPRSIRRHVAMGHIAPTAAKHIARVGGEARLHLAWAALDHDLTVRQVRSVA
FT                   SDVNEGQSVASALEAEGVRLGELELELDPAVYRELRRRAALDGASPGAVVSELLADRLD
FT                   "
FT   gene            complement(418525..418686)
FT                   /locus_tag="Hmuk_0433"
FT   CDS_pept        complement(418525..418686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46567"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXX9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2989"
FT                   /protein_id="ACV46567.1"
FT                   /translation="MHKPMTDAQQSSREDAEAEEPATDHLDDVEDGCGCTEIWEHLSEN
FT                   RDDAAADD"
FT   gene            418939..419280
FT                   /locus_tag="Hmuk_0434"
FT   CDS_pept        418939..419280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46568"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2990"
FT                   /protein_id="ACV46568.1"
FT                   /translation="MTTDVHQLDDGAWISVNDSREVNVSDLWLLAESEFCGCEPTDFLA
FT                   EGFVDTGVDPPNIQARIAGRCIACGTEGVTDWLTVGRVIDPESGEFYGVVHDSVHIPEK
FT                   RHRLADPKQ"
FT   gene            419373..421133
FT                   /locus_tag="Hmuk_0435"
FT   CDS_pept        419373..421133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0435"
FT                   /product="Ferredoxin--nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: hma:rrnAC2992
FT                   ferredoxin-nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46569"
FT                   /db_xref="GOA:C7NXY1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY1"
FT                   /inference="protein motif:PRIAM:1.7.7.1"
FT                   /protein_id="ACV46569.1"
FT                   /translation="MPTKVENWKDEVYGNEIRDHLMEFAEEGWDAIPEDEHDAWFERFK
FT                   WWGLYHQRSGQESYFMMRIGTPNGVIEPGQLEVIAEVADKYARGPEENPEFGDAYCDWT
FT                   TRQSIQLHWIKIEDIPEIFELLESVGLSTQQACGDSWRNIVGCPVAGKDKHEHIDAWPI
FT                   AEDLHETFKGDDDYANLPRKWKVSITGCDQGCGQGDINDLAYEPAEKDGELGFNVRVGG
FT                   GLSRKEPRLARDIDVWVPPEKAADIGHGMSALFREYGDRDDRFNARIKFLMDEWGPEKM
FT                   RSVLQEEFVDFELPRAGEDMRDQYTYNAGGNEHGDHVGVHEQPDGNYYVGLDVLVGRMG
FT                   VDDVYELAEIAEEYGSGEVRLTQRQNVIVTDVDSDRLDAFLDEPLLDDYSPDPHPFMRG
FT                   SIACTGTEFCSLSIVETKNRQVRYARWLKDNVSLPEGVEDFHIHLSGCTASCAQPQIAD
FT                   ISLRGMKTRKDGEPVEAFDIGLGGGLGENPQFADWVEMRVAADEVPGYIENLLDAFEAE
FT                   REGDETFREFVADRDEEALQSLADPEETSYDDPYLGNTKMTWYPYAEDNDMQSSPAPTD
FT                   ANDEPLPSDD"
FT   gene            421186..421449
FT                   /locus_tag="Hmuk_0436"
FT   CDS_pept        421186..421449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46570"
FT                   /db_xref="GOA:C7NXY2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0015"
FT                   /protein_id="ACV46570.1"
FT                   /translation="MASDGGRSNLKTIALGLAVLFVPALIIVATLEFLILTGDLVLNEL
FT                   TPLELVELYLIDLVLFAGGAYLLYRLLLYSIGGPLGGTDDEE"
FT   gene            421610..421894
FT                   /locus_tag="Hmuk_0437"
FT   CDS_pept        421610..421894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46571"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2242"
FT                   /protein_id="ACV46571.1"
FT                   /translation="MVDRIMRVNAYTTFDLLEGRVKGHGFDEDAYAVLNVSTDTREDPD
FT                   AVEVQIEMDNTEVDAVEPHADTVSLSPAQAREMAAELEKYASKVDASEE"
FT   gene            421963..422265
FT                   /locus_tag="Hmuk_0438"
FT   CDS_pept        421963..422265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46572"
FT                   /db_xref="InterPro:IPR025983"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY4"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2243"
FT                   /protein_id="ACV46572.1"
FT                   /translation="MSTDSPGNPASRELGFCPCCGYRTLPEGHPGSYEVCPVCHWLDDP
FT                   VQFGDAEYVSDTNHVSLSDARTNFEKHGACTPEAADQTKRPADAPRDPNWPYAEE"
FT   gene            422345..423184
FT                   /locus_tag="Hmuk_0439"
FT   CDS_pept        422345..423184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0439"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hma:rrnAC2927
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46573"
FT                   /db_xref="GOA:C7NXY5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46573.1"
FT                   /translation="MSHPTRTLPSGDELPIVGVGTWNIDGDTLRDSVRAGLDAGYTHVD
FT                   TAEGYKNEDVIGDVLADYDREELFLTSKVLPKNLDYESVIASCEASLERLGTDYLDLYL
FT                   VHWPNPAISLRETMNAMATLHDRGLIRNVGVSNFSAYQLSCAHHVSDVPIAVNQIEFHP
FT                   YLQRPDLVDYCRETDTVIEAAAPLARTEVFDDPVIQELAETYDKSPAQIVLKWAVEQDV
FT                   VVLPKSSSPEHVRQNGALFDWELAAEDRERLDDRDRDQPVYDHPARDWTGDTYGISQ"
FT   gene            423288..423539
FT                   /locus_tag="Hmuk_0440"
FT   CDS_pept        423288..423539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46574"
FT                   /db_xref="GOA:C7NXY6"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46574.1"
FT                   /translation="MDADIDTAAEDPPLGLLAVAVVGLLLTAAGAIAVVLDLVGTSDIV
FT                   LGVVPALTPLFDLSLFVTVLGVALFLFAMTEWSPDLDT"
FT   gene            complement(423608..423946)
FT                   /locus_tag="Hmuk_0441"
FT   CDS_pept        complement(423608..423946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnB0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46575"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY7"
FT                   /inference="similar to AA sequence:KEGG:rrnB0330"
FT                   /protein_id="ACV46575.1"
FT                   /translation="MVAHSARRGDEDSATLPDAVPFELPILTRLSWELGARVVADDEAT
FT                   VHSRWDCTNRPWTLSLFHVTEHTDLVRVRTPVGRERFYGATRSELDDALGALVDAPGWK
FT                   RVDDTVRY"
FT   gene            complement(424217..425239)
FT                   /locus_tag="Hmuk_0442"
FT   CDS_pept        complement(424217..425239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0442"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: hma:rrnAC2382
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46576"
FT                   /db_xref="GOA:C7NXY8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV46576.1"
FT                   /translation="MSDDLMDLSPEEGIERYLRHCEPSVRDSTMRNAKTRLRFFEEWCE
FT                   LRDIENLNHLTGRDLADFVAWRRSDIAALTLQKQLSTIREALRYWADIEGVDDGLAEKV
FT                   HAPELPDGAESRDVHIGADRAHRILDYLHEYRYASRDHVVFLILWKTAMRRSALRSLDV
FT                   DDLRPDDNALVLEHRIDEGTRLKNGEDGERWVYLGPNNYQVIDDYLDNPDRYERTDDHG
FT                   REPLITSMHGRPTGDTIYKWVNKLTRPCVIGGCPHDADPSDPSTCEALGTGATLSKCPS
FT                   SRSPHGIRRGSITYHLNSNVSPEIVSGRCDVSLEVLYEHYDVRTNQEKMAVRKKQLEQI
FT                   "
FT   gene            425683..425949
FT                   /locus_tag="Hmuk_0443"
FT   CDS_pept        425683..425949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0443"
FT                   /product="PhiH1 repressor-like protein"
FT                   /note="KEGG: hma:rrnAC2383 PhiH1 repressor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXY9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2383"
FT                   /protein_id="ACV46577.1"
FT                   /translation="MRKQADWMVPSDNRILELIREYGNLTPSAIEAKGGPVRQHASTRC
FT                   SELAEYGLLQQVHRGLYGITEDGIAYLDEELDASELAPVEDAE"
FT   gene            complement(425957..426193)
FT                   /locus_tag="Hmuk_0444"
FT   CDS_pept        complement(425957..426193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46578"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2384"
FT                   /protein_id="ACV46578.1"
FT                   /translation="MQDSMEVYTGEEVTVEHVKTLSSGGARFDITTDDGRKWRVDVTRD
FT                   GDVEIVTSWRDGTLADLELPDWADDVTARLARV"
FT   gene            complement(426268..427056)
FT                   /locus_tag="Hmuk_0445"
FT   CDS_pept        complement(426268..427056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46579"
FT                   /db_xref="GOA:C7NXZ1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46579.1"
FT                   /translation="MSLKYLFTPIGFLIHLFYALGLLILPFAFIYTILGPGIVVAFIIS
FT                   VIIAVILAAIQYFYKKYSRFNDGSKDISSTRRSILIGSVGTLSLGAVIFAVKNSTHSIG
FT                   DTQEIGGLEITVTRAYTTGSIETGEGEVVPMDLTGDNVTEDLTQFVVILVDVDQTEDAT
FT                   AYNDRVSETSLLHNGSVYFEGQPVVVEEQGVNSIINEVKVEDRFLTRFGGSADRDYESD
FT                   LQVVTFPIESSDLSNYGLKMERNGHSSFDSSRRWQLTPEE"
FT   gene            complement(427168..428220)
FT                   /locus_tag="Hmuk_0446"
FT   CDS_pept        complement(427168..428220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0446"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: hma:rrnAC2385 ORC / cell
FT                   division control protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46580"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ2"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACV46580.1"
FT                   /translation="MITDSAVFEDEQLPRRLLHREAAVDHLSRAWEPALDGEQAHDVLI
FT                   HGPSGVGKTSLARFALQKLTRHADIHSAHVESLGKSTAGVVRSILHDLPGSDPATNTPR
FT                   EDLCIELRERVDQPTIVILDEADDLPATDALDRLADVDGLSVVAICHDKEQWLSQLDNQ
FT                   LRRRLLLKELALDRFGVNELADILEARARRGLPSGVVTREQLEEIADEVAGVARKGIQS
FT                   LRQAALLAEERDHSEIGADDVADSYERAQRYILEQNLESLPFHHQLLYELIRVGSGLKA
FT                   GELHDRYEAVAEEVYHGRGLTPISERSRRLKLSKLEDYELIEVEGENRHRKYSVTETDI
FT                   ELSFSLNLIV"
FT   gene            complement(428297..429151)
FT                   /locus_tag="Hmuk_0447"
FT   CDS_pept        complement(428297..429151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46581.1"
FT                   /translation="MLEDVPEEYEIDPESDFKQLEDIFVEEFPDAVEHSVEDVIFADDG
FT                   PVNHLTWIALDGYSRHEFFYDDDNPDSDTLYSLLSLSPGKDDMMALRAYLAKEFDVVKS
FT                   LENAALLGIPDTYQPGSKAQAHVAFYRDPRNGELNVGLNATPAQKEAEILDDVNRLVPT
FT                   KNLEKLIRKVADIFYDEVEQTARDTIISGDVLSVLDDDPDFRYQTTKPLPDGVNPMYRG
FT                   REAQLWQKPISKDSVIEGSQGFIQIWVPEEEESTGFISVTNGEYDNREALSEVRTAMEA
FT                   ALN"
FT   gene            complement(429258..430046)
FT                   /locus_tag="Hmuk_0448"
FT   CDS_pept        complement(429258..430046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0448"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; SMART: HhH-GPD family
FT                   protein; KEGG: ape:APE_0875.1 U/G and T/G mismatch-specific
FT                   DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46582"
FT                   /db_xref="GOA:C7NXZ4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ4"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACV46582.1"
FT                   /translation="MGLRLPFGKTEVSAEEIDSLVDRDLAVEHAKTGNVNQPEERIQEF
FT                   IETVPELLSWLEANGRVYLWRETTDPWKVYLAEILLQRTRGNAVEKIYDDVLRQFPDPE
FT                   TLVEATEGEIEDVVRSLGFVNHRTRTLTEVGEIFTEDFGGEVPGSLDKLKRPWRVGDYS
FT                   ARATQLFAREQPMALVDSNFARVIGRVLGYEMPSQPHKSDDVYALMEALTPDDPDLARS
FT                   FNLAILDLGALVCTSEDPDCPSCPLNSACSYYESEQGRPD"
FT   gene            complement(430049..430303)
FT                   /locus_tag="Hmuk_0449"
FT   CDS_pept        complement(430049..430303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0449"
FT                   /product="putative transcription regulator"
FT                   /note="KEGG: msi:Msm_1777 putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46583"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ5"
FT                   /inference="similar to AA sequence:KEGG:Msm_1777"
FT                   /protein_id="ACV46583.1"
FT                   /translation="MDVEEYSWVKASEYREKLLLAMDEKPRTPKELSEITDYYLSHVSN
FT                   VLSDLDSHGLAECITPEKKKGRLWTSTEKGDELIEDLKR"
FT   gene            430420..431778
FT                   /locus_tag="Hmuk_0450"
FT   CDS_pept        430420..431778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0450"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: amr:AM1_A0017 C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46584"
FT                   /db_xref="GOA:C7NXZ6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ6"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACV46584.1"
FT                   /translation="MSEERLTAIDLFCGAGGLSQGLHDAGFETLWGIDHEENTKPTYEA
FT                   NHDCEMTVGDIREEEPPDLGLEEGELDLVAGGPPCPTFSLVGRSKINSIEGRDNQSDDR
FT                   HLLYEDFLRFVDHYQPKAFLMENVEGMLSAENEDGKPVVDTIKEQMRGEREVADLDLDL
FT                   NYSVRVQLLDSADYGIPQHRKRLFFIGNRIGEENPDMTEWETHRKPKNEEEKKIKYKED
FT                   PSERSEEDQSTLHGFVDEDGTEEFPAFRKNRQSKEPWNTVADGILDLPPVSPSGDTPPT
FT                   KAEEYEIGPVSEFQYWARNLSEEQDWEDQPLLNHECRGHNMRDLTLYKLLGEGTSYIIG
FT                   DIPEEHQPYRTDIFPDKLKKQNPKEPATTIVAHLYKDGHMFIHPNEARSITVREAARLQ
FT                   SFKDTFEFPVSRTHAFKQVGNAVPPLLAQALATAIRTEIFHSPVERTEPREAY"
FT   gene            complement(431790..433445)
FT                   /locus_tag="Hmuk_0451"
FT   CDS_pept        complement(431790..433445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tne:Tneu_1340 iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46585"
FT                   /db_xref="GOA:C7NXZ7"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46585.1"
FT                   /translation="MNSSNGRSFENSIQLVIDIPKEKDIQDNSLIENHTDCLKTQVISR
FT                   VSECLDEVDRWDIDLTAKNYSITTYDRKDKVRLYDASISGQINTDISSAIEKLLVDIAQ
FT                   ATNSVDLVQHSKIKFQNLLYLWSGYSFEAYDVEFVGKSDGSEFELMRSRENFRFKGRIS
FT                   KKKIEEIAEIDPFDSDETEVFIQQMKGGSKREEVVQQIPDEVEQATFLFIRSLQDYGNT
FT                   APSEVFISELLDLQSKYPFLFQPDSEEWDTLLEMSDGEREKILKIILNRISGLLRRSFE
FT                   GVIGDWIAMIRYLRDRCNGDPRTFFEQIANELGVNTSDPDALEKVQSKIEKFDKEDARD
FT                   RIGIQFSFSKKIGRLLFTLMTKNERGYDLLNGVSRDQVENFNLPVDAQIIRVTLNLGLL
FT                   KIETTAKEDVTFEASKDGKKEEVTKEGIELQRSDLDQVCRRVWQELAAEVSRAPAELDH
FT                   ILWSVGSTLGNRRGALCMTCPLGSVCDAWKQKEIYEAGGSQWNDGGYTFARAHTDRDKM
FT                   IILEEWHPFKVETYTEEQPRLTFNNIEEVLSRED"
FT   gene            complement(433455..434528)
FT                   /locus_tag="Hmuk_0452"
FT   CDS_pept        complement(433455..434528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Ccdc91; coiled-coil domain containing 91"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038365"
FT                   /db_xref="UniProtKB/TrEMBL:C7NXZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46586.1"
FT                   /translation="MADYSGDPSEFKVYWFARDLIASSYGSYAKKEKPTLKQLSTRLGE
FT                   ELEDERFSGDSSLDRQKRIIRDTITDSVNKTYAGDVSKRYRQTEDLVERILRRIDTEDD
FT                   IREFRIAIDAVVRTSEILETTPSFGKSEIIKIVDETLQTESGTLDPARTYDALFNVDFE
FT                   GEAYQLGAQREPLIDYIYEKMADLRSDPQIEEKEVARIVSGIVQEYERRAGQSRASTAG
FT                   NVLETGLQYIFDQFGIPATGDPAHFGDLEIDNMVEGPEGSIGFSCKRTLRERFRQSLSR
FT                   EAEIGVDEVWFVSLLMADVSREKVQDISNDGSRIYVPRDSFVWNRYKDDSDLSYTLRPA
FT                   DEFIEDIVEFTGLTDNT"
FT   gene            complement(434642..434899)
FT                   /locus_tag="Hmuk_0453"
FT   CDS_pept        complement(434642..434899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46587"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYC6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2389"
FT                   /protein_id="ACV46587.1"
FT                   /translation="MTRRTSLKITDERQRLLDKASAIVASAPHDDPPMSDVLDAALTHL
FT                   VESKENIDSARGELDPETIQRFNTSVIGLRYRTSVESRWR"
FT   gene            complement(435123..435305)
FT                   /locus_tag="Hmuk_0454"
FT   CDS_pept        complement(435123..435305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46588"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYC7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2396"
FT                   /protein_id="ACV46588.1"
FT                   /translation="MEMRKLSPAGGCVTVSIPIEDLRERGIVDEDGELNGDHWAKVQSL
FT                   DENNEGDYRLELVSP"
FT   gene            435432..435863
FT                   /locus_tag="Hmuk_0455"
FT   CDS_pept        435432..435863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46589"
FT                   /db_xref="GOA:C7NYC8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYC8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2397"
FT                   /protein_id="ACV46589.1"
FT                   /translation="MYGKIDIEDALFGTIFAASAFVTNGIATINILGNDLGAAVWTGQG
FT                   TEITFAFLLTLVSLFGAYATNRVNRSSGKSYEIDTDLANIARGEAPIETYLAVGTALLV
FT                   LVTGLNILGAQEVIAGTAAFGLVVVAVEASGYYVISYMG"
FT   gene            435860..436105
FT                   /locus_tag="Hmuk_0456"
FT   CDS_pept        435860..436105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46590"
FT                   /db_xref="GOA:C7NYC9"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYC9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2398"
FT                   /protein_id="ACV46590.1"
FT                   /translation="MILVRLDTLLGYGLLGTIGVSASTIAAAVVGQPFPVVVPTIFAAA
FT                   VVAAHHVRTKDSDPSDDQLDDATGDAPAVATDGGRQ"
FT   sig_peptide     435860..435946
FT                   /locus_tag="Hmuk_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.354 at
FT                   residue 29"
FT   gene            436102..437874
FT                   /locus_tag="Hmuk_0457"
FT   CDS_pept        436102..437874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46591"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46591.1"
FT                   /translation="MRDRQTITRRGLIKTVGGTAAVGAGLSATNGTAIDPVGEADAIAC
FT                   GGACLVAVGIAGAAAVGMVTGAVAAHHLGQKRQDELSGSEETADLHANLRSRLTALKAA
FT                   NNSVLTGVQNRIKDARNVAWPEAKKEAIKAFNNGDDKSAVKTAGKDPVDAHYVTIQQNI
FT                   LNRGTEWANTIQYITDLHESDSGLSQPDGGTPAFRITSEHNYDGSSRQVTLSPHEFSML
FT                   ETTTTLVDGQSFTHKIIRANESDNSTPNFQHEVDLDPTGITGRITDGSSSWAGVASATV
FT                   DPVETGSTATWLNLGAWDSAWSAIVDDHSQMVSNIQTFVETLFENHSPGDIDVSEYIDA
FT                   TTLASEFATDYENTGYRAYAAAEAAVAGIPGSMDQSMQIRLEDSGIEVRGSVWTEWRPY
FT                   DGSSTATTTETATETATETATTTETEPANSAFEVGTTYDPSNTNKLVLMSYEFQGEGWI
FT                   QGSDVFVKDDSDNWTQDTNITSADGWTALDGEKIQTGYGELQQPFTILSAQDTETGEDV
FT                   DVVGTESRNHQTAEVDLTEEQLQMILDYRKTVRNNDSPGGGGGGAGFLGGGSIDPTVAG
FT                   LVAAGLVGLGLLSR"
FT   sig_peptide     436102..436203
FT                   /locus_tag="Hmuk_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.676 at
FT                   residue 34"
FT   gene            437882..438409
FT                   /locus_tag="Hmuk_0458"
FT   CDS_pept        437882..438409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46592"
FT                   /db_xref="GOA:C7NYD1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2400"
FT                   /protein_id="ACV46592.1"
FT                   /translation="MRFFVFITAAVVSLALLTVPIGATPTDSGNASTASPDGERIDGAT
FT                   VLVNSEWREAQSVALITLRSEINQTVTLTDAGAFSQGGTVPERTVEIEAGETTHIEIPV
FT                   TEVSGRVGVGISTRYTLYSEIIESGSGGGLDILRALSSLQAWLAGAAIAFVWMAIAGYN
FT                   VIRRENGRPEVA"
FT   sig_peptide     437882..437953
FT                   /locus_tag="Hmuk_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.691 at
FT                   residue 24"
FT   gene            438410..439204
FT                   /locus_tag="Hmuk_0459"
FT   CDS_pept        438410..439204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46593"
FT                   /db_xref="GOA:C7NYD2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD2"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2401"
FT                   /protein_id="ACV46593.1"
FT                   /translation="MPAPTFQTNRDRLTWLLGEYKLLVTGMILGAVGLVIYYQPQLPTP
FT                   PAWIAGVLVGWLLLGVPCYLVGAKIARWLRNRNWIEVHHVNAAEDTVQKHYVPPQLWRE
FT                   KEIEGPDPYPINGGSAWAVREYEYLDDIEQVRVQGVWLEGCQDTQLMTSKKQMEDIHGW
FT                   LIDRAEELAAIRGRWSRGAVELQKKLVTAESEANERGQMIQKTAAKDTFGDLVDDGEDF
FT                   DEAPTIHDLDDHDPTADAVVGDGPADVSVPDQQNQNPQMNDD"
FT   gene            439197..440369
FT                   /locus_tag="Hmuk_0460"
FT   CDS_pept        439197..440369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46594"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2294"
FT                   /protein_id="ACV46594.1"
FT                   /translation="MTDDSGDLYTPAQFREYQDGYGQREPDETHAHAGIVRDEKLSRYL
FT                   SILETHYDPQRCDRPAKMPGQAKDLQHVRDIVRIEGTETARRALENGDMQSLKHFTGDA
FT                   GQRADISGIKAIDQLRAQMTGPAPMFYEWAEPGTGKSNFACLLGQLWKEQHPDGLVASN
FT                   IRTLEETDEWTGDDGDRRDGWLANYGDLNEWLKQDGDPMHNTQSPKLFIFDEASSNAGG
FT                   GGKDGYDTKTKLGPLTYKIRKYGGSLIVIGHDGRDVHPLVRELAVCVHKEGLKEATFYE
FT                   DVKGRSGVNEIFSVSGIPETDWRYDDKEPTTWSWSGGEEDGDEVDPADLSRKLAVYTVI
FT                   TAKEANPEKPNHEIADFVPYSAEWVRQRWNEYQHDGDHRNVVGDVEGLTA"
FT   gene            440533..440922
FT                   /locus_tag="Hmuk_0461"
FT   CDS_pept        440533..440922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46595"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46595.1"
FT                   /translation="MNRSHRANHYGTLVERQAVKRYNLELDRCSWHDAKRSDGTPVEIK
FT                   AAMHRHSDGQPGTFKLYDQYHEQLRAANGWYIFGVYRIRGSGVEVLQWEMRHSSRLPQL
FT                   EWHGGGDHREAHQAKIGISLLTQNQ"
FT   gene            complement(441624..443480)
FT                   /locus_tag="Hmuk_0462"
FT   CDS_pept        complement(441624..443480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0023 secreted protein containing
FT                   thrombospondin 3 repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46596"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46596.1"
FT                   /translation="MTTVDGEKRWTPVVRSNPTRVDTDGDGLSDDIEVRGWDIPVINSS
FT                   SVSKPVQFNTDCEWVSTEDRDILWTGSGCDLSENINVSSDPLREDTDGDGLEDNVERNV
FT                   TYTDPASPVTYAVTERHQQYLTGLEGESSFLQLMHVTGGNEPQQDLELTDKTDDFDIVL
FT                   NDSVKGPRERSVFTALDGTPRSDTWLSNGEEVNSGTDPWDPDTDDDGLTDGQEIHGLTE
FT                   ATRLVSHSVVGGNSEWILHEGERLGTNATNPDHDGDGYWDGWIGVYGVGRTENVILYRE
FT                   HLRDDDGDGAPSGIQEDEIVDEQVGVHEVTSDPMTSSATSTTLPDRSGQFHSNLHIGEL
FT                   HWGADPKETADQPDTSLTVEVDYLSGRNPFQMNISNNNSVIDATRRNYLLYDINLTFVE
FT                   SDELSRSQLESVCSAASTGNGGLYAPSVDTYCIEPDSFNVWETDLVEDRFHNDTATLHL
FT                   FWTNKYGSDKPMYKPHDSFIPSSVRGMEGHTGSEAQVAFVENGFGTPHGTIMFDEEFST
FT                   NASRHKVLMEEIGHSLGAGTADDEQLRIGECYSGLQCPYGIDGNGIIQDGDPEPTPEYI
FT                   NYYENPAWPIMGFAYYIDGNRTAFSIEEISTVDFDEIPSVDD"
FT   gene            complement(443869..445626)
FT                   /locus_tag="Hmuk_0463"
FT   CDS_pept        complement(443869..445626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46597"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2296"
FT                   /protein_id="ACV46597.1"
FT                   /translation="MSRYLKCAPHEGDVRFTVGVHPDPAVQDHGLAPYYAMHSLMKEWG
FT                   DRWQTQGKPTRDIGFNGQQWATAFDYSKSGLDPWDNPSFEIEEVREFQFYFVAKDSPHY
FT                   SGEPADQDPRIKGGTITVRPRWPNLTSDGKPVSVPDYGEPYIDVQVQASNIPHEKYLTL
FT                   VQRVIDAYGISSRYFDQPHPDSHVSDLAYYVRLYRDASGPLYAPDGPIARCHTLIQGDR
FT                   SGYRKHVEDNTKLPGYYVTATVEDEKADELVRGHGLGKELKHYYPNHPDEYEPGDAPYH
FT                   PKFEVSYQTSRTDDTVRWSDLDDARRELEETILNCLEWTGIATTADSGAFVEFDPYWSV
FT                   EDTTEARKLVKCPLPEIEDEQEHRVMHLWGDMSRADRDVTELLLTDGGKVSPQEAAEQT
FT                   GYTYRTIRTVIDRLEGLIHHTYGEMELESKKIQQELLKRVRAAGERFEQSVGSAVMDLA
FT                   DAAEEQEKTRWSRLRREYAITVREGDDCRKLLQMGYQPEDRAEAREIMREVKTAYTQFV
FT                   ENNVYGVHVVVTYADGARDRFRDLRNVFQGQRSGEYITREQQERRNEGFNFEAWKAAGC
FT                   PPADEWSGG"
FT   gene            complement(445629..445784)
FT                   /locus_tag="Hmuk_0464"
FT   CDS_pept        complement(445629..445784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46598"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2297"
FT                   /protein_id="ACV46598.1"
FT                   /translation="MSEFVRASRLYDVEASEPLRFDWAKMQPLRESQQEVERAVGNLPG
FT                   RDTVAR"
FT   gene            complement(445975..446829)
FT                   /locus_tag="Hmuk_0465"
FT   CDS_pept        complement(445975..446829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0465"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: pol:Bpro_3728 DNA adenine
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46599"
FT                   /db_xref="GOA:C7NYD8"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD8"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ACV46599.1"
FT                   /translation="MSLSAFPYPGGKTYHVDEILGYFPDHELYVEPFGGSASILLNKAP
FT                   SHIEVLNDLDRDVVHFYQVLRQQREELQKWLRTVPFSRELHGRWARKFYDGHRPDDDIV
FT                   RAGRWFYLRYTQYSGKLDGISGFKASTIRNEARRLQNATDALDQVADRLQHVTLECLDY
FT                   NRLCEKYDRSEALLYFDPPYVGPGDDLYTHDGEFDHDKLVATLTELEGKWICSYGDLPD
FT                   ELESAIKEFGWSKRQYQIHYSINGDQREPATERLVMNFDPDEAIPFRSTQQTGLESFGG
FT                   EWR"
FT   gene            complement(447233..447349)
FT                   /locus_tag="Hmuk_0466"
FT   CDS_pept        complement(447233..447349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46600"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46600.1"
FT                   /translation="MNSMLKITQNRMTAPRKTCPASPYRFFVLANYPEKRLL"
FT   gene            complement(447346..448356)
FT                   /locus_tag="Hmuk_0467"
FT   CDS_pept        complement(447346..448356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0467"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase domain protein SAM domain protein;
FT                   integrase family protein; KEGG: hma:rrnAC2382 phage
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46601"
FT                   /db_xref="GOA:C7NYE0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE0"
FT                   /inference="protein motif:PFAM:PF02899"
FT                   /protein_id="ACV46601.1"
FT                   /translation="MSDLQPLTPEDGVERFLRHREPSVRESTLQNANTRLNYFLDWCEE
FT                   REIEDLNTLSGRDMADFVAWRRGDIAPITLQKQLSTIRQACRWWADIDAVEEGLAEKIH
FT                   APELPDGAESRDVHLDPERAEAALEYFEQYQYASRDHALIALIWRTGMRRGAVRSLDVE
FT                   DLQPDDNAVRVEHRIDEGTKLKNGEAGERWVYLGPKWFQVLDDYVSNPGRPQGTDEYGR
FT                   RPLFTKEDGGRPSAQTIYKWLMRALHPCTYGECPHDRTPETCDARGRTANVADCPSSRS
FT                   PHAVRRGAITHHLTEDTPPETVSERMDVSLDVLYQHYDARTEREKMDVRTDHLPE"
FT   gene            complement(448353..448571)
FT                   /locus_tag="Hmuk_0468"
FT   CDS_pept        complement(448353..448571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0468"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: nph:NP5330A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46602"
FT                   /db_xref="GOA:C7NYE1"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE1"
FT                   /inference="similar to AA sequence:KEGG:NP5330A"
FT                   /protein_id="ACV46602.1"
FT                   /translation="MRGRQKSLAHFESHQPCSDLSDLTDAERDVFEAIEQGEYGPREYA
FT                   DETSRSPGTIGNLLARARVKVDGGDAS"
FT   gene            complement(448568..449122)
FT                   /locus_tag="Hmuk_0469"
FT   CDS_pept        complement(448568..449122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46603"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46603.1"
FT                   /translation="MTVTQKIWDGDDCPRVLCDGTLQQDEAAVECSECGETWSQQTADS
FT                   EHLLISRAGKIVKRKQRVLPDGGEIEPESDRVDPERLPDTYTPAYVDVRGQGPVYVANY
FT                   ETLSSGWLSLTEWRGTRTKLPPHRVGGVREVRTETYDPAPETDRYTRTKRVADEQRREQ
FT                   ARPDDAGGKTVVDGHSIEIDA"
FT   gene            complement(449205..449414)
FT                   /locus_tag="Hmuk_0470"
FT   CDS_pept        complement(449205..449414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0470"
FT                   /product="CopG family protein"
FT                   /note="KEGG: hma:rrnAC0583 CopG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46604"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0583"
FT                   /protein_id="ACV46604.1"
FT                   /translation="MPVANTTIGFPPEMLVEIDDHADENNMSRAEYVRHCVRQAHDTPF
FT                   DEPRGTLTKDEHENIEDRRSEGAA"
FT   gene            complement(449776..450435)
FT                   /locus_tag="Hmuk_0471"
FT   CDS_pept        complement(449776..450435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0471"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: hma:rrnAC0589
FT                   putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46605"
FT                   /db_xref="GOA:C7NYE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV46605.1"
FT                   /translation="MRLKDYDDDDGKRVWLSDDELARLIDEAETPHQRLAFLLAGRVGL
FT                   RRSEITGVCPEDLVEGPTGDHIRIWEDYAKRDKYREPPVPSEVVTIAETLAYQQDDDEP
FT                   LIGVAGSTVYRWVRRAAERLEDETDDRGWSYLDVHDLRRTWGTYLLEQGVIPSVVMSWG
FT                   GWEDWETFRQHYLGEFSPEAIKRERGRVEYLEGGDENTEIVHPGTMPSESGQHTAD"
FT   gene            complement(450792..450989)
FT                   /locus_tag="Hmuk_0472"
FT   CDS_pept        complement(450792..450989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46606"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE5"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0594"
FT                   /protein_id="ACV46606.1"
FT                   /translation="MPDAQTVALAVLMLVAGMAVPTRYGMERVEGFGRAVASKLPYRPP
FT                   PGTDEQEAMADAVDDGGGES"
FT   gene            complement(451022..451234)
FT                   /locus_tag="Hmuk_0473"
FT   CDS_pept        complement(451022..451234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46607"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46607.1"
FT                   /translation="MGVQIGLGAVAALLSVLVAIELAQLEVLRRTAQRSRSNRKRLRAL
FT                   LRAFGVHDEGPTYDVDADAIGGEGS"
FT   sig_peptide     complement(451163..451234)
FT                   /locus_tag="Hmuk_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.413 at
FT                   residue 24"
FT   gene            complement(451234..451677)
FT                   /locus_tag="Hmuk_0474"
FT   CDS_pept        complement(451234..451677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46608"
FT                   /db_xref="GOA:C7NYE7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE7"
FT                   /inference="similar to AA sequence:KEGG:PHYPADRAFT_64058"
FT                   /protein_id="ACV46608.1"
FT                   /translation="MSPAPAAAAAGGALADNADEVADVAKQGSADARQVAESRGGQILM
FT                   VVIGLGLLYYVYTAVTVGSDVADGAQDAADDVGGAAGDSWDGATDVADGTGDVVSDGMD
FT                   WWLGGAADTVEGAGDAAGNGFSWATGGAADTVEDAGDAIGGLL"
FT   sig_peptide     complement(451621..451677)
FT                   /locus_tag="Hmuk_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.483 at
FT                   residue 19"
FT   gene            complement(451674..452246)
FT                   /locus_tag="Hmuk_0475"
FT   CDS_pept        complement(451674..452246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46609"
FT                   /db_xref="GOA:C7NYE8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46609.1"
FT                   /translation="MSDHDTAMTRYLDRHDTIDSAGDGSYTAGDNDDDSSSSSSRGSEQ
FT                   TQDLIDRQTDDSRDDGYSPPDPDAGSGTNGSDHTIISGRNEGSSDTTVGPSEGVEDTDG
FT                   DGSADAVVTTPDSRTDGTPNSSQADRGTTAPDGSTDWPGDGTPGTDTSDSPGSDDRSPT
FT                   GPAGVPIEAVGTVGAIALLVAIWGWSR"
FT   gene            complement(452337..452876)
FT                   /locus_tag="Hmuk_0476"
FT   CDS_pept        complement(452337..452876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46610"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46610.1"
FT                   /translation="MASYTRAAQSATLTDGGHDRRALALSGTANGIEDTDGGHDRRLFG
FT                   LGASAHRVGSGRGIVIPTGNFRRVHVTLKDTDGQPLSDAVWVQSAGVFPTAARVDDNGE
FT                   ADLWLLNVLYETFVVIASSDRSGVDYVWYQLADDDDVDGTQTIGTQDREATLYFDPVKL
FT                   KGLSVGRGGNLGGPLA"
FT   gene            complement(452883..453767)
FT                   /locus_tag="Hmuk_0477"
FT   CDS_pept        complement(452883..453767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46611"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46611.1"
FT                   /translation="MTFDGPIATTWGKALAALRDKVTSMTGYSVVDTSSGGGDASVPTN
FT                   DWFVIATPFNEYIRFRPNTDQDNRGLTPEYGVDWDTGSSSWNDRYPNDPGNRLKEIGRN
FT                   DGTTGKITAHQSDGGGIQEGDAVTYWLEYVDSGFALYFQREEADGNDGDGMIFFEEVTQ
FT                   LWDYDDAATHEANMIFGVAGHVADSIDYNPIKQVALDCRMAQSGSSPHHYAQGVANPDA
FT                   NYNNYPYTDGVARSSSYRNASGADAVIGRYEMVLQERSGGDAAHRDTIQDADGNDLYTI
FT                   LNRDAASVALRMD"
FT   gene            complement(453770..454225)
FT                   /locus_tag="Hmuk_0478"
FT   CDS_pept        complement(453770..454225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46612"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46612.1"
FT                   /translation="MSTVGPDSVIERVLSEYSLGADSWHEDLLESDTDRLLLALLLDQR
FT                   GDQYLGETSTSDEPTYFVTEVPVAVDGVGQQSLDWGFPADTVTVWGFDGPVLVSFQQTG
FT                   TNREIPLTASEAPFSLSPPGGLNASKLWYRKMTESDADTTLKVLALK"
FT   gene            complement(454284..454547)
FT                   /locus_tag="Hmuk_0479"
FT   CDS_pept        complement(454284..454547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46613"
FT                   /db_xref="GOA:C7NYF2"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46613.1"
FT                   /translation="MPSGGLVTRDATGREASGTGRNQPGEPRTAAATTSTGQGNGQQYG
FT                   PDDSALDEILRGRPINRDDLLLASTLCMLVLLLYTAMEDGTI"
FT   gene            complement(454552..455277)
FT                   /locus_tag="Hmuk_0480"
FT   CDS_pept        complement(454552..455277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46614"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF3"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0603"
FT                   /protein_id="ACV46614.1"
FT                   /translation="MNEQIMQRLREANTSRDNITNGDFSFSTGSPGQPTTVAEYQPKRA
FT                   LSVDATRPFDLSLVARETFTTDGNAGDGETFSVSHELIDSSVVTNSLVLYEGDKRVQPD
FT                   SIDYAGDSFNYTDDGTDNTLTAYYTSGAQALVELQKVAPNGTPDVLFSADMGMIHRRDQ
FT                   GKEPITVDADQSPLHPFVPADFTLALTITAPYTVAFATETGSGTEVVATNALTDLPVRG
FT                   AEGPIDGLKQAVATDAARR"
FT   gene            complement(455282..455764)
FT                   /locus_tag="Hmuk_0481"
FT   CDS_pept        complement(455282..455764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46615"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF4"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0604"
FT                   /protein_id="ACV46615.1"
FT                   /translation="MSESLTNLGSAKVDATEETNIPDTDSTILTWSPVDGLVIEIDNHV
FT                   YGGSGVPIYAELKDADGNDLPRDTEVILRWDTPSRDQPMIVSERLSNIRQYRTLSLKEQ
FT                   QNEEYREQTRTELKSDGLIVLDFEEVQVAINSSTQIDWDNSRLEIDRKAVTVRAED"
FT   gene            complement(455764..456027)
FT                   /locus_tag="Hmuk_0482"
FT   CDS_pept        complement(455764..456027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46616"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46616.1"
FT                   /translation="MEFSNAIDTLASEDYVMDVALIGGGYMAPELVQYAVEDKMGRDLP
FT                   NEAYGATVAAGGALYGGAGRKVAIGGGINVLEELRARVSEGN"
FT   gene            complement(456111..456254)
FT                   /locus_tag="Hmuk_0483"
FT   CDS_pept        complement(456111..456254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46617"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF6"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0605"
FT                   /protein_id="ACV46617.1"
FT                   /translation="MTRTQITLYGDDSDRFDAMQEAMAENQPGSKPGNAEAVRRLMDMA
FT                   SF"
FT   gene            complement(456251..457051)
FT                   /locus_tag="Hmuk_0484"
FT   CDS_pept        complement(456251..457051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46618"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0606"
FT                   /protein_id="ACV46618.1"
FT                   /translation="MNLAFIAQSGWGKSYHAQAWMESNAMAYEAVVVLDYCAEYRGLVK
FT                   EGLARHLIVGRVEEQWGVQQWQTFLRQNPYIVLERHKQHLGTDRWRDVCTTISKALRRL
FT                   DRDQLIAADEAHFIAPQKQKLPQAIKELATTGRGAGTSTIWITQRPAEIDKTILTQCQA
FT                   WMVGALDGSDLDAVKPYIEYPENLHNKGTSPPASTVPDELLPPDRERPTSVRKHEDDEG
FT                   NTIGSEWIYSDDDGEKKRVNTQNVTMASTHHGSEGNDLNPPSYS"
FT   gene            complement(457170..457448)
FT                   /locus_tag="Hmuk_0485"
FT   CDS_pept        complement(457170..457448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46619"
FT                   /db_xref="GOA:C7NYF8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46619.1"
FT                   /translation="MTVSAYDMQKWAEAGFWLLALVWIAWLIAEMLRDRSSQTEMNVDR
FT                   PDSAYLTDLDLDAIGDGEQRRIRTTGGDTLRLEGEPVEEGDGEEGEQ"
FT   gene            complement(457445..458020)
FT                   /locus_tag="Hmuk_0486"
FT   CDS_pept        complement(457445..458020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46620"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYF9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0608"
FT                   /protein_id="ACV46620.1"
FT                   /translation="MMQKLNEMREMKKQLDNPHDSEKIRAAARVLAEMENRPRESYIDV
FT                   METAGMEPETDPLDIESRVDELCDVIAAKVPGGPSMIEVWLSNCLPDDIETDDPQTLLT
FT                   YAEMDRGEWEGQVARWADTVRHQQDGLDGYDDRLLADKHVQGHWGVSLARFEQAVVELD
FT                   DQRAMEDLLGEPTDETVDAIESLTEVVA"
FT   gene            complement(458017..458622)
FT                   /locus_tag="Hmuk_0487"
FT   CDS_pept        complement(458017..458622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46621"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0609"
FT                   /protein_id="ACV46621.1"
FT                   /translation="MTVSETEEPVEEEPADEQGEETEEEPADEQGEETEEDLPDIEPDE
FT                   QADLDGLELDTEAIEEQAAPDDEGGDDSGDETTGTDDPDSEETDETATQPALPDGESWG
FT                   EQYVTMLALLLGEIAEASDGETGKDAEAIEDLARSPPVEMDDAVDEWLQDAGIGADTSP
FT                   GTKVAVGTAGLALVVILTETDMAQDAISDIAEDMDLSL"
FT   gene            complement(458619..459200)
FT                   /locus_tag="Hmuk_0488"
FT   CDS_pept        complement(458619..459200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46622"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC0610"
FT                   /protein_id="ACV46622.1"
FT                   /translation="MSNYTCPIDGCDYSGDSLAGLRSHSNSMGSDGKHDWPKIRAAVEG
FT                   QQDDETNEDSSDDDPPGTGGAAATEGDEDEGQQDPAREQPETEETSEKDQPEMDQTEEY
FT                   EQQIEQQTSEEGSENTEENQSDGQNQQSGGQPDTGQSGPSGLVILGATLALGLAILLAT
FT                   GTDSDDDQEPMEVESEVSDADPVEEGEGWV"
FT   gene            complement(459197..460657)
FT                   /locus_tag="Hmuk_0489"
FT   CDS_pept        complement(459197..460657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46623"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46623.1"
FT                   /translation="MTTRIEYGSKDAADAARDRHEEYLCTDDDRRLKTVAYSDADTPDH
FT                   VLDAERLEAEDSRGEGSDGPGQVPLSDGERDRIDFGKARASVPHAKAVKGIARSEGVED
FT                   WVSYYDGTLTVDEHREVMADASRESGKRTDEQESADEKAADAAQTAKGERCDHARGHCE
FT                   AGDPEACEFLTETCGYDEEEVQQFLDEDHADDGEQTELVTVGGDEYPEMELRPEVAGAL
FT                   RRSWGGYKNAVGDLETAIADARQAVIDARQSWRAINRIREANGQPELHPNRLHTLLDSL
FT                   DSMPGSVPIVKTLDHFAQEPGGDRDELADSELAEREPTRPDPADRRPDDLRGDDRDDEP
FT                   AEVIETADTFASEGQAQLSAGVSPEETPGEDRQVTLTGENEDDAVGPLPSAWTREGTTW
FT                   TAGPYKVAIDRAARNDWVVRLHGPPGTIDVASGLPDAPEAEAVAMEYVDLIDPDEIGFK
FT                   STNETVQVAAAEAKKAALDDEGGILNYT"
FT   gene            complement(460759..461385)
FT                   /locus_tag="Hmuk_0490"
FT   CDS_pept        complement(460759..461385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_p110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46624"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46624.1"
FT                   /translation="MTVERIKIGGKTEDGEPVHLSPWTFEVPQIRAIVEKWLAGEVLNA
FT                   CAGKTSLDHDGPITRNDIDEDRDVDTHFDVREIDDHFDRDHFDTVVYDPPYTAEMAERH
FT                   YDGNHVGRKWEARGAIANVTAPGGHVLTFGYNSDGLDGWDGWERVATYYFRTPNWSGYD
FT                   IALSVDRKGGGAPVAGEVPDVTEQTTLVAATDGGNDCAVDTATDR"
FT   gene            complement(461534..461875)
FT                   /locus_tag="Hmuk_0491"
FT   CDS_pept        complement(461534..461875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46625"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46625.1"
FT                   /translation="MSESTEQLEFDEAYAGEILGGEKTATVRYDMELPAVGSYVPATTQ
FT                   DGLEFAILKIKRTASVLAVEVPDLLDLFGANYGSSTVHEVVDGVNSHYQKTILPATNVE
FT                   VIVFEVVST"
FT   gene            complement(461868..461999)
FT                   /locus_tag="Hmuk_0492"
FT   CDS_pept        complement(461868..461999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46626"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46626.1"
FT                   /translation="MNRDDLLDEIEDDDTRRRVGAITDLCQTHLTRRDARDWGGSRE"
FT   gene            complement(461996..462397)
FT                   /locus_tag="Hmuk_0493"
FT   CDS_pept        complement(461996..462397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46627"
FT                   /db_xref="GOA:C7NYG6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46627.1"
FT                   /translation="MQTAGGASVSFSADDDLVDAFDSWVEESQYGSRSEALRTLMAQTC
FT                   DTEHDNTTPLAPPQDDRLGTAYKRLCEHASPEGYVRGSVALTLLASVLNIPKSEIRTQV
FT                   LRKLHKRGYLRRQNNVYGDTSYQLMGWES"
FT   gene            complement(462537..462680)
FT                   /locus_tag="Hmuk_0494"
FT   CDS_pept        complement(462537..462680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46628"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46628.1"
FT                   /translation="MSTHEQTPAPSDRRIWFEGRCTCGNVGECTYVDGEETCTDCFWEV
FT                   RR"
FT   gene            complement(462681..463160)
FT                   /locus_tag="Hmuk_0495"
FT   CDS_pept        complement(462681..463160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0495"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   hma:rrnAC0615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46629"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG8"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ACV46629.1"
FT                   /translation="MPEQLTSSTPWERAQTEVDQGGPINDAERMVRLSGGEGSHRVTWA
FT                   LQGQTLLADCDCRGHRFNDGWCAHVASLWWQWVRGRIVVSHLHTGRDYPEPPAWLRFDP
FT                   PSRPLDDLSPAELDAFLHCDVADAGVRPFARRTDRSPGTIGNLLASAREKLGGDL"
FT   gene            complement(463412..463483)
FT                   /locus_tag="Hmuk_R0004"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(463412..463483)
FT                   /locus_tag="Hmuk_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(463724..464035)
FT                   /locus_tag="Hmuk_0496"
FT   CDS_pept        complement(463724..464035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0496"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: hma:rrnAC2405 30S ribosomal protein
FT                   S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46630"
FT                   /db_xref="GOA:C7NYG9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYG9"
FT                   /inference="protein motif:TFAM:TIGR01046"
FT                   /protein_id="ACV46630.1"
FT                   /translation="MSQQARVRLAGTSPEDLDDICGDVREIANKTGVELSGPVPLPTKT
FT                   LEVPTRKSPDGEGTATWEHWEMRVHKRLIDIDADERALRQLMRIQVPNDVSIEIVLED"
FT   gene            complement(464039..465301)
FT                   /locus_tag="Hmuk_0497"
FT   CDS_pept        complement(464039..465301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0497"
FT                   /product="translation elongation factor EF-1, subunit
FT                   alpha"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: hma:rrnAC2406 elongation factor 1-alpha;
FT                   TIGRFAM: translation elongation factor EF-1, subunit alpha;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46631"
FT                   /db_xref="GOA:C7NYH0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH0"
FT                   /inference="protein motif:TFAM:TIGR00483"
FT                   /protein_id="ACV46631.1"
FT                   /translation="MSDRHQNLAIIGHVDHGKSTLVGRLLYETGSVPEHVIEQHKEEAE
FT                   EKGKGGFEFAYVMDNLAEERERGVTIDIAHQEFSTDAYDFTIVDCPGHRDFVKNMITGA
FT                   SQADNAVLVVAADDGVAPQTREHVFLARTLGIGELIVGVNKMDLVDYNESDYEQVVSEV
FT                   EDLLKQVRFGTEDASFIPISAFEGDNIAERSDNTDWYDGDILLEALNDLPEPEPPTDAP
FT                   LRLPIQDVYTIDGIGTVPVGRVETGILNVGDNVSFQPSDVGGEVKTVEMHHEEVPKAEP
FT                   GDNVGFNVRGIGKDDIRRGDVCGPADDPPTVAETFQAQIVVMQHPSVITAGYTPVFHAH
FT                   TAQVACTIESIDQKIDPSSGEVAEENPDFIQNGDAAVVTIRPQKPLSIEPSGEIPELGS
FT                   FAIRDMGQTIAAGKVLDVNER"
FT   gene            complement(465550..466503)
FT                   /locus_tag="Hmuk_0498"
FT   CDS_pept        complement(465550..466503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0498"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; dihydrodipicolinate reductase;
FT                   KEGG: hma:rrnAC2408 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46632"
FT                   /db_xref="GOA:C7NYH1"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH1"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ACV46632.1"
FT                   /translation="MKLAVLGAGAVGRSVAELAGDYGHTVTALADSSGAVVDADGIDVD
FT                   AVLAAKEADGTVGSARPETALEAEYDALIEATPTTLGDAEPGFGHVEAALERDRHVVLA
FT                   NKGPVAERYADVRALERESAGEVLFEATVGGAMPVLSTIDDFDPEHITAARGVLNGTAN
FT                   FILSRMAAEGLGYEHVLAEAQDLGVAEADPTFDVEGTDAALKCVIVANVLAGERREYTL
FT                   DDATVEGISSIPGSALELAQEDGRTIRLIGEVADGDVRVGPRLVPENAALSVSGTRNIV
FT                   QLETEHAGRLNISGRGAGGPETASAVLADVGRLPEA"
FT   sig_peptide     complement(466444..466503)
FT                   /locus_tag="Hmuk_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.478 at
FT                   residue 20"
FT   gene            complement(466500..467033)
FT                   /locus_tag="Hmuk_0499"
FT   CDS_pept        complement(466500..467033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0499"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   hma:rrnAC2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46633"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH2"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ACV46633.1"
FT                   /translation="MSDSQDEVRAYTVRLELVDEPGELLRALHPIADNGGNLLSIFHER
FT                   GNMTPRGHIPVEVDLEATPERFEDIVEALQAENFNIIQAGAERYSEALTIVLSGHLVNT
FT                   DLSHTLSHIQEATEATVTDLSLSAPEGTEDVSSARLRLATEAGNADNALAAVREIAAEK
FT                   ELTVVEPLTAGGDA"
FT   gene            467387..469246
FT                   /locus_tag="Hmuk_0500"
FT   CDS_pept        467387..469246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hau:Haur_2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46634"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH3"
FT                   /inference="similar to AA sequence:KEGG:Haur_2192"
FT                   /protein_id="ACV46634.1"
FT                   /translation="MTTDDLRRRVERLEAMVAAADDGPEGEDGLTRRTVLKGLGLAGVG
FT                   SYAVGKARADPQGQLGTDTDPVATVYAQQLHGGLTGNTAVSSLLGPGLGIDSGSLSADV
FT                   SGATSTGSGTDIYTGTTDGDLQFRSLVGGTNVSLSSASGAVTIDATAGSSVWSDPDADD
FT                   LLEPTSSYRGIDLSGVSNPRVVTPWIGTTTATAFEAFVGTTRVARFTPTGTDGNAETAA
FT                   GNVLLGQYAQIGDGATGVAVGGGGSPTNSHENVAYDNYGTISGGQNNTVGSDDGDPVTA
FT                   AHATIGGGYSNTASSVYATIAGGTANTASAKSVAVGGGNGNTSSGNYAAVAGGYSNSAR
FT                   SRYGTIGGGSTNTASGQHATVGGGNSNTAGGDQSTVGGGQNNSATGPDAAVPGGQSNTA
FT                   AGSHSLAAGRRAAANDAGAFVWADSQDADFASDADYNGSGVTGNDTFHVRAQNGARIVN
FT                   GAGTTYIPSGSTGWTATSTRAAKTNFQPIDPDSVLDGVRSLDVATWEYKTRDGEAAGVE
FT                   HMGPTAEAFDDAFGLGESQRHINSINADGVALAAIQGLADRADELAAELERKDERVGEL
FT                   EDRLAERDERVDELAAELERKDERIDELESRLDDLETLVQQGE"
FT   gene            469494..472331
FT                   /locus_tag="Hmuk_0501"
FT   CDS_pept        469494..472331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0501"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   hma:rrnAC1114 HTR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46635"
FT                   /db_xref="GOA:C7NYH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46635.1"
FT                   /translation="MKPFTRRAVVAGTVVAVVLVWSGLVPLSAGAAGVSGLDCQPGSEG
FT                   AVFAADSGLEAVYDGETLDGNPFVDDTTLAFPNVTVSATDTASLRIVAATDDGVCLRSI
FT                   EPTSAPVRVTPDAGETVVVRDSLVNLSYGSFRYARSAGGVDLAYNASAPAAITVEDGDL
FT                   SAGRTVEAVDADSGTQLTTGTVSADDTVDLQLPAGHRNVDLRYASTQTATATSTVQPAA
FT                   ATATDTATPTATDTATQTATNATTRTQTATETATPTARETPPDSDSATGGSSAGDDTAT
FT                   PTPTPDRTQTATPTATPANATEFTVPEWTGELVAYEPTPQTQHVGGLLPLTVSLWGLAL
FT                   WLVVARRGPETRLLALVLVVASVRATSDLTQIVLDGFVGVEAPLATLNLLLEFATAVLF
FT                   AGFAVQYADIGERRTRHAKRALGVLGAVGATAVLTNPIHGQVFTDAAVAAGPFTYVTAS
FT                   VGPVGWLLFALATGLVAAGGVLVARTFVVGSPRGAWRPVAVIGTGLAVAIGIAALDVLE
FT                   LGPVTGYDYSATGVNYFLLATTVSLLGYGFQRLKPSGQRSIVADLDDAIVILDDAWRVV
FT                   EWNGAAEEIVPELSTGRSFDAVFSEPLARPTVDQTVTREMSLEVDRWVTDSGTDAEPPT
FT                   DSDDRTDGDSNGTDGQAAGSSERSETTEPGTNGTELDGAAEGHGEPLDTERRHFIVNAR
FT                   AVTTETSDVIGYTVRFADVTALKRHMSQLERRNEQLDQFAGAVTQDLRGPLGEAREETE
FT                   RVRAVLEDADEPEAVDRRALTTALGSIDAALNRMARLVEDILGLARDRDLQTDPEPIPF
FT                   DAIVESVWDRFDPKEATLSVEATGEISADREHLDRLLAVLVRNAIQHGGEGVTVRVGLD
FT                   DDGFYVADDGPGIDPSVRDRAFEAGVTTRDAAAGLGLTMARQRAAAHGWEIALDDGATG
FT                   TRVVVSGCETEGPDE"
FT   sig_peptide     469494..469589
FT                   /locus_tag="Hmuk_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.919 at
FT                   residue 32"
FT   gene            472328..474187
FT                   /locus_tag="Hmuk_0502"
FT   CDS_pept        472328..474187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0502"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; KEGG: nph:NP1506A
FT                   signal-transducing histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46636"
FT                   /db_xref="GOA:C7NYH5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV46636.1"
FT                   /translation="MTDGGLSRAVATALSELRFDYAPSLQTQHLLLFATMALVTVGLAY
FT                   WITRTRQTRGAKLFGLTLVVLGARLASDVVHGLVGELWPLLEVLVALNPLLELGVLVLF
FT                   VRFAGRYAGVERVGSDRARRAMGGLVVVAAIAIATNPVHGLVFDAVRRVSIPFTHVVVE
FT                   RGVLGFGLLGVNVVLLLAAAGLLAHAVTTGFRPAWWPAIVLSIAVSVALVVIALQLRVG
FT                   GVVPQYDYTAIGYAGFFFLTTLALVEHGLRRIEVVAREEILDDIDDAVVLLDTDGTVVT
FT                   TNAAAEGLFGTLDGAEGFLDRFDELGSEQLDGDRERTAITIDPQTTEWDTLRNTTETAQ
FT                   RGPRHFLVYTEYVTTRTTRVIGHVVRFVETTELERRSRELERKNDQLDQFASTVSHDLR
FT                   NPLNVATGYLQMATEGVDPDDDAAFDVAAALTYLDKVEVSLDRMATIIDDILALIDNTD
FT                   PVTDTEAVDFESVVSAAWSTVDTRSATLELTGEGTVDADETRLQRLLENLFRNAIDHVG
FT                   DNVTIEVGLTGEGFYVADDGPGIPEDERERIFEHGYTTGDGGTGLGLSIVQQLAEAHGW
FT                   TVSLDPDADGAAFVVEGCATTRRPAQTTESTEPERRHRSRRER"
FT   gene            474238..474594
FT                   /locus_tag="Hmuk_0503"
FT   CDS_pept        474238..474594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0503"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_5120
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46637"
FT                   /db_xref="GOA:C7NYH6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV46637.1"
FT                   /translation="MTELQFITFACDAPERLATFWEAALDGERRDTEVPETALVDRPGD
FT                   GPDLLFKRLQAGTKWRMAIHLDLSVEDRAQSVERLRELGATVRETKTEHHDGTTAEWTV
FT                   LEDPEGNAFCVSEY"
FT   gene            complement(474851..477040)
FT                   /locus_tag="Hmuk_0504"
FT   CDS_pept        complement(474851..477040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0504"
FT                   /product="translation elongation factor aEF-2"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: nph:NP0130A elongation factor EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46638"
FT                   /db_xref="GOA:C7NYH7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7NYH7"
FT                   /inference="protein motif:TFAM:TIGR00490"
FT                   /protein_id="ACV46638.1"
FT                   /translation="MGRRKKIVQECETLMNTPEQIRNIAIAAHVDHGKTTLTDNLLAGA
FT                   GMISDDTAGEQLAMDTEEDEQERGITIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGD
FT                   VTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEE
FT                   MQKRLMSVIADVNELIRGMTEEMDDIDEDWTVSVEEGTVGFGSALYKWGVSMPSMQRTG
FT                   MDFGDIMDLERSDKRQELHERTPLADVVLDMVCEHFPNPIDAQPRRIPRIWRGDDESEV
FT                   AESMQFVDEDGEVVLMVTDIGVDPHAGEIAAGRVFSGTLEKGQELYVSGTAGKNRVQSV
FT                   GIYMGGEREEVEEVPAGNIAAVTGLKDAIAGSTVSSVEMTPFESIDHISEPVITKSIEA
FT                   KNMDDLPKLIETLRQVSKEDPTIQIEINEDTGEHLISGQGELHLEVQTQRIERNQGIPV
FT                   NTGEPIVVYREAPQQPSREVEGISPNRHNRFYISVEPLEQDIVDAIKLGDASMDMPELE
FT                   RREALQEAGMEKETSQNVEHIHGTNVFIDDTKGIQHLNETMELLIEGLEEALNDGPLAA
FT                   EPVQGSLIRLHDARLHEDAIHRGPAQVIPAMREAVHNSLIDAEIRLLEPIQNVRIDVPN
FT                   AHMGAASGEIQGRRGRVDDMYQEGDLMVVEGVAPVDEMIGFSSDIRSATEGRASWNTEN
FT                   AGFQVMADNLQPDKIDEIRTRKGMKLELPETIDYF"
FT   gene            477286..478038
FT                   /locus_tag="Hmuk_0505"
FT   CDS_pept        477286..478038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46639"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH8"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2415"
FT                   /protein_id="ACV46639.1"
FT                   /translation="MDVHVRGGPAAPFLSAADLFATEYEIDGDVTVRVCEDPDERTRVS
FT                   HDEESHCLTISRQAATSAMARELALHEFAHMHRYEEAHPSHTQSTREAIYLALAGQSVE
FT                   RRTLSHCYQIANHMKDIYADDVWLDVVPADKLVAFLESSLAAAVADTPRDRGAWDRLTP
FT                   ATDPDINAVNAAFALALVERHDLVGPDHPIYDLAHAAAEDAPHVSFEGFKRRFRTLARD
FT                   TDESEYRKALVDVTRAYAVASNGDSAAD"
FT   gene            complement(477999..478739)
FT                   /locus_tag="Hmuk_0506"
FT   CDS_pept        complement(477999..478739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0506"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: hma:rrnAC2417
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46640"
FT                   /db_xref="GOA:C7NYH9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYH9"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV46640.1"
FT                   /translation="MLSYRPGETFAHRLDPRSKLCFQAGFAIAAFADTALSWLAGVYAL
FT                   AALALLAGRLDPRRVVRAYWVVFLVLALGPVIAGIAVGPPWFRVEPALTSLRAVARVPP
FT                   VLAVSAVYVHTTPVRGTRAAIERLVPGRAGQLLGVGTGLVVRFFPLVVSDLRRIRTAMV
FT                   ARGGANRPVTDRARRLAVQGIDRAMARSDRLAVALRARCFAWNPTLPALTFGRMDYPVA
FT                   GIGVVLALSPLAQSAALSPLLATA"
FT   gene            complement(478733..479437)
FT                   /locus_tag="Hmuk_0507"
FT   CDS_pept        complement(478733..479437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0507"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hma:rrnAC2418 cobalt transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46641"
FT                   /db_xref="GOA:C7NYI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46641.1"
FT                   /translation="MIAVRGLTARRGDVVVLDGVDLTIADGESVLLVGPNGSGKTTLVR
FT                   QFNALLTPDEGTVEVDGRDAHDDPVTARTSVGMVFQHPRDQFVAATVGADVAFGPENLG
FT                   LERSEIDDRVDRALAAVGLTGERQRRIADLSGGQQARVAIAGALAMEPAHLVLDEPLTG
FT                   LDLAARRSVLEHLETLSDSGTSVVVVTHDLRDLTDIADRIVALVDGEIALDGPPSAVLD
FT                   ELDGLGVRDPRC"
FT   gene            complement(479434..480018)
FT                   /locus_tag="Hmuk_0508"
FT   CDS_pept        complement(479434..480018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0508"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: hma:rrnAC2420 dethiobiotin
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46642"
FT                   /db_xref="GOA:C7NYI1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI1"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACV46642.1"
FT                   /translation="MAQQHDSVALVGDETVEHFATAVLLAALTAALAQVSIPLPGSLPP
FT                   FSLQPFGAFFAGLLLGPLWGGLALALYTLVGIAGAPVFSNANAGLGYVLVGQGTGGFLV
FT                   GFLLGAVVAGGIAHRQITPRSLETIGVATQVLALVAAVVVIYAVGVPWMSWALGLSVQR
FT                   AAATMAPYAPFDLLKVAVAIAIVRGGYLVRE"
FT   gene            complement(480190..480804)
FT                   /locus_tag="Hmuk_0509"
FT   CDS_pept        complement(480190..480804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0509"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: hma:rrnAC2423 30S ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46643"
FT                   /db_xref="GOA:C7NYI2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI2"
FT                   /inference="protein motif:TFAM:TIGR01028"
FT                   /protein_id="ACV46643.1"
FT                   /translation="MSADDAPEPDAPAGTDDEAAPAQLFGEWDVTEIEFSDPSTERYVT
FT                   VTPIAHTMGRHSEKQFKKSEISIVERLINRLMQTDENTGKKQLATTIVKDAFETIHERT
FT                   EENPVQVLVEAVENSAPREETVRLKYGGISVPKAVDVAPQRRVDQALKFLAEGVYGDSF
FT                   KTTTDAEDALAQQLIGAANNDVQTYAVNQKEEKERVAAAAR"
FT   gene            complement(480806..481234)
FT                   /locus_tag="Hmuk_0510"
FT   CDS_pept        complement(480806..481234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0510"
FT                   /product="ribosomal protein S23 (S12)"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: hma:rrnAC2424 30S
FT                   ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46644"
FT                   /db_xref="GOA:C7NYI3"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI3"
FT                   /inference="protein motif:TFAM:TIGR00982"
FT                   /protein_id="ACV46644.1"
FT                   /translation="MANGKYAARKLKKDRQNHRWSDSDYARRERGLGQKSDPLEGAPQG
FT                   RGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKQVSAFCPGDGAISFIDEHDEVTIAGIG
FT                   GAKGRAMGDISGVNYKVEKVNGVSLIELVRGNAEKPVR"
FT   gene            complement(481458..481883)
FT                   /locus_tag="Hmuk_0511"
FT   CDS_pept        complement(481458..481883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0511"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH
FT                   type 2 domain protein; KEGG: hma:rrnAC2426 transcription
FT                   elongation factor NusA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46645"
FT                   /db_xref="GOA:C7NYI4"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI4"
FT                   /inference="protein motif:TFAM:TIGR01952"
FT                   /protein_id="ACV46645.1"
FT                   /translation="MPVELSDEARRLIALFETEADVTVRDCLIDDDNDRVIYVVKAGEM
FT                   ADAIGPGGVVVDRIESKLDRAVKLIEDADTAANFVANTLAPAAVYNVTISENDDTIAYV
FT                   EVAQEDRGVAIGADGKNIDAARRLAKRHFDVDGIELT"
FT   gene            complement(481883..483070)
FT                   /locus_tag="Hmuk_0512"
FT   CDS_pept        complement(481883..483070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0512"
FT                   /product="DNA-directed RNA polymerase, subunit A''"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, subunit A'';
FT                   PFAM: RNA polymerase Rpb1 domain 5; KEGG: hma:rrnAC2427
FT                   DNA-directed RNA polymerase subunit A''"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46646"
FT                   /db_xref="GOA:C7NYI5"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI5"
FT                   /inference="protein motif:TFAM:TIGR02389"
FT                   /protein_id="ACV46646.1"
FT                   /translation="MTRANVTDDIEAIVEDTDLPRRLKDDVYSTIEERDVTVEEADQIA
FT                   KAVQSRYQETRVDPLDPVGTVSAQSIGEPGTQMTMNTFHYAGVAEIDVTQGLPRLIELV
FT                   DARKTPDTPMMTVHLEDEYATDREKAHEVVWKIEATRILALGDISTNVADMLVQIDLNE
FT                   ETLMERWPTVDQVEDVAEEIAETIESKLAVQTRQAGTMIEFGPEEPSYRDLLQLVEELR
FT                   EVVFKGIEDISRVVIRKEETDEGEEFVLYTEGSAFGDVLGIEGIDASRTTCNNIHEIYR
FT                   NLGIEAARETLINETMHTLEEQGLDDVNIRHLMLVADIMTNRGEIESIGRHGISGNKES
FT                   VLARAAYEVTVNHLLDAAIHGEVDVLEGVIENVIVGKPVQLGTGDVDLRMGASQD"
FT   gene            complement(483070..485988)
FT                   /locus_tag="Hmuk_0513"
FT   CDS_pept        complement(483070..485988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0513"
FT                   /product="DNA-directed RNA polymerase subunit A'"
FT                   /note="KEGG: hma:rrnAC2428 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase subunit
FT                   A'; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   Rpb1 domain 4; SMART: RNA polymerase I subunit A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46647"
FT                   /db_xref="GOA:C7NYI6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI6"
FT                   /inference="protein motif:TFAM:TIGR02390"
FT                   /protein_id="ACV46647.1"
FT                   /translation="MSAQQTPKSISSISFGLMDPEEYRDMSATKVITADTYDDDGFPID
FT                   MGLMDPRLGVIDPGLECKTCGKHSGSCNGHFGHIELAAPVIHVGFNKLIRRLLRGTCRE
FT                   CSRLCLDEREREEFEDRLERSEELGKDVNDVTKAAIRQARKKDRCPFCGEPQYDIKHEK
FT                   PTTYYEVQDVLSSEYSQRIVAAMEPDEEAGRERTTPSELADETGIDPSRVQEIISGEFR
FT                   PRQDDRRAIESALDVDLTEEDENKLMPSDIRDWFEDIPDEDVEVLGMKPARSRPEWMIL
FT                   TVLPVPPVTARPSITLDNGQRSEDDLTHKLVDIIRINQRFMENREAGAPQLIIEDLWEL
FT                   LQYHVTTFMDNEISGTPPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVIS
FT                   PDPTLSLNEVGVPDRVAKEMTQTMNVNERNLDNARRYVANGPEAHPGANYVKRPDGRRL
FT                   KVTEKNCEELAEKVEPGWEVSRHMIDGDIIIFNRQPSLHRMSIMAHEVVVMPYKTFRLN
FT                   TTVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFGENIIGAIQDHISG
FT                   TYLLTHTNPEFNETQALDLLRATRIDELPPESGVDDDGTPYWTGRDIFSELLPDDLDLT
FT                   FTSEAGDDVIIEDGQLVEGTIDDSAVGGFGGEIVDTITKEYSNTRARIFINEIAALAMR
FT                   SIMHFGFSIGIDDESVPEAAEAQITEAIDNAYDRVEELIETYDRGELESLPGRTVDETL
FT                   EMKIMQTLGKARDSAGDIAGDHFDDDNPAVVMAESGARGSMLNLTQMAGCVGQQAVRGE
FT                   RINRGYEDRTLSHFKQNDLSSDAHGFVEASYRSGLNPKEFFFHAMGGREGLVDTAVRTS
FT                   KSGYLQRRLINALSELEAQYDGTVRDTSDNIVQFEFGEDGTSPVQVSSNEETPVDVEEI
FT                   ADSVLDAEFESESIKSEFLGERTEPTNLSEHTDDWWMAEGDD"
FT   gene            complement(485991..487817)
FT                   /locus_tag="Hmuk_0514"
FT   CDS_pept        complement(485991..487817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0514"
FT                   /product="RNA polymerase Rpb2 domain 6"
FT                   /note="PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase Rpb2, domain 5 protein; RNA
FT                   polymerase Rpb2, domain 4 protein; KEGG: hma:rrnAC2429
FT                   DNA-directed RNA polymerase subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46648"
FT                   /db_xref="GOA:C7NYI7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI7"
FT                   /inference="protein motif:PFAM:PF00562"
FT                   /protein_id="ACV46648.1"
FT                   /translation="MSQGRDAKVYVNGSLVGTHPDPEQLADQIRQARRRGDVSEMVNVS
FT                   VKDRTDEVIVNADAGRARRPLLVVEDGEPLITESEVQQVKDGELGFEELVERGVVEFID
FT                   AEEEEDILVAVSEEDVTDDHTHLEVDPQLMFGIGAGMIPYPEHNASPRITMGSGMIKQS
FT                   LGLPSANYRIRPDTRQHLLHYPQLSMVKTQTTEQIGYDDRPAAQNFTVAVMSYEGFNIE
FT                   DALVMNEGSVERALARSHFFRTYEGEERRYPGGQEDRFEIPDDEVRGARGEEAYTHLDE
FT                   DGLVNPETNVKENEVLLGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTVT
FT                   LMEGEDGSKLSKVSVRDERIPELGDKFASRHGQKGVVGHLAPQEDMPFTEAGVVPDLIL
FT                   NPHALPSRMTVGHVLEMLGGKVGALEGRRVDGTAFTGEDEAELRGALEDRGFKSSGKEV
FT                   MYSGVTGEKVEAEIFVGTIFYQKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLRV
FT                   GHMERDVLIGHGAAMVLKERLLDESDREWIKICGECGMTAVENVEQRRIYCPNCEEETD
FT                   IHEVEMPYAFKLLLDEMKALGIAPRIELEDAV"
FT   gene            complement(487821..489383)
FT                   /locus_tag="Hmuk_0515"
FT   CDS_pept        complement(487821..489383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0515"
FT                   /product="RNA polymerase beta subunit"
FT                   /note="PFAM: RNA polymerase beta subunit; RNA polymerase
FT                   Rpb2 domain 3; RNA polymerase Rpb2 domain 2; KEGG:
FT                   hma:rrnAC2430 DNA-directed RNA polymerase subunit beta''"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46649"
FT                   /db_xref="GOA:C7NYI8"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI8"
FT                   /inference="protein motif:PFAM:PF04563"
FT                   /protein_id="ACV46649.1"
FT                   /translation="MDVNDRRAISREYFSRERLAEHHFRSFNSFLDRGMQQVVDEKETI
FT                   ETDIGDKEGQEPVFVELGDVRVVTPRVREADGSEELLYPQEGRLRNITYSAPVFMEMAI
FT                   VRGGDEEEEVVVDQTETKIGRMPIMVGSNKCNIDGFTDEELIDIGEDPADPGGYFVVNG
FT                   SERVLMTSEDLAPNKILAEHDTKYGDDVQVAKTFSQRRGYRALVLCERTRDGILEVSFP
FT                   SVSGSINFVTLVRALGLESDEEIVHRVSDDPEIVKFMLENLEAADVQTTEGAIETLGER
FT                   VASGQGKNYQLKRANYVIDRYLLPHLHEEGVDEEDVRINKAFYLCRMAEACFELALGRR
FT                   DADDKDHYSNKRLKVSGDLMKDLFRTALNKLARDVKYQLERANMRNRQLSVSTVVRSDV
FT                   LTERLEHPIATGNWVGGRSGVSQLVDRTDYMGVLSHLRRLRSPLSRSQPHFEARDLHAT
FT                   QWGRICPSETPEGPNCGLVKNFAQAMELSQNVEDEQDLKQELADMGVQGIPGIERIEQP
FT                   ADD"
FT   gene            complement(489383..489610)
FT                   /locus_tag="Hmuk_0516"
FT   CDS_pept        complement(489383..489610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0516"
FT                   /product="RNA polymerase Rpb5"
FT                   /note="PFAM: RNA polymerase Rpb5; KEGG: hma:rrnAC2432
FT                   DNA-directed RNA polymerase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46650"
FT                   /db_xref="GOA:C7NYI9"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYI9"
FT                   /inference="protein motif:PFAM:PF01191"
FT                   /protein_id="ACV46650.1"
FT                   /translation="MVDVSQHELVPDHSIVDEDVLDDVLEEYNIKKTDLPKIKRTDPAT
FT                   PDEAEVGDVIKIVRNSRTTDQAVVYRLVVS"
FT   gene            489936..490008
FT                   /locus_tag="Hmuk_R0005"
FT                   /note="tRNA-Asp1"
FT   tRNA            489936..490008
FT                   /locus_tag="Hmuk_R0005"
FT                   /product="tRNA-Asp"
FT   gene            490052..490124
FT                   /locus_tag="Hmuk_R0006"
FT                   /note="tRNA-Asp2"
FT   tRNA            490052..490124
FT                   /locus_tag="Hmuk_R0006"
FT                   /product="tRNA-Asp"
FT   gene            490366..491019
FT                   /locus_tag="Hmuk_0517"
FT   CDS_pept        490366..491019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46651"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2433"
FT                   /protein_id="ACV46651.1"
FT                   /translation="MEDVDREAMPRAIVEEFLARERGTRALLDDLEKLAIEGRTEELHD
FT                   RIENLAENDEAVFYTVAFSLADSVQFFGDVEAQLDVTAADRLRDLAETYPTLAEPFAVV
FT                   RTELSEDRKNPVTNVSYSVAYHRGIESPIVTYRPLSGGRELYESRATPSEVLGTAADLV
FT                   AATTDALDVALESDHSVNTEELSELIDRRERLETELSRLRDDLDELRRTPIDGE"
FT   gene            491075..491374
FT                   /locus_tag="Hmuk_0518"
FT   CDS_pept        491075..491374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46652"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2434"
FT                   /protein_id="ACV46652.1"
FT                   /translation="MGLDRLAEQVEKERRDLQILEAVIEHGPIGIVHLAEEAEVPEHKV
FT                   RYSLRMLENDELVQPTPEGAVPADDIAARIATMNQGLERLRDRTETLKTIFDAE"
FT   gene            491446..491832
FT                   /locus_tag="Hmuk_0519"
FT   CDS_pept        491446..491832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0519"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   hma:rrnAC2252 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46653"
FT                   /db_xref="GOA:C7NYJ2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ2"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ACV46653.1"
FT                   /translation="MSESTSHHTIETLALVGVGGFGGAIARYVAGQFVAGPAGTMLVNT
FT                   VGSFALGVLVYEAVHLGRLSSAARLAAMTGFLSSFTTYSTFAVETAGLAPAWALANVVG
FT                   SYALGLAGVLAGRTLVQRVGRRGG"
FT   gene            491832..492188
FT                   /locus_tag="Hmuk_0520"
FT   CDS_pept        491832..492188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0520"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: hma:rrnAC2253 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46654"
FT                   /db_xref="GOA:C7NYJ3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ3"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ACV46654.1"
FT                   /translation="MVGIETATLVGIGGALGALCRHWLATAVDREAVPLGTLTVNVAGS
FT                   FVLGLVTFATPSEGVALFVGVGACGAFTTFSSFAVETVQLWESGRPLVAVGNAVANLVG
FT                   ALAAVGLAWLVLSV"
FT   gene            492237..492686
FT                   /locus_tag="Hmuk_0521"
FT   CDS_pept        492237..492686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0521"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: hma:rrnAC2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46655"
FT                   /db_xref="GOA:C7NYJ4"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ4"
FT                   /inference="protein motif:PFAM:PF02369"
FT                   /protein_id="ACV46655.1"
FT                   /translation="MFVELWRDDRAIEGLPIRLVIALVVGVASLSVMMNTISGLDTMTV
FT                   SEIDVDPSKEVVGEGETDVTLTVVDPDGQPVSDATVVVTGGTATMDGAVTATTDSRGNA
FT                   TVTITPQLGPNQQEGTVTIDVKPPASGGYSDRRRNTRILVVDDGG"
FT   gene            492831..494012
FT                   /locus_tag="Hmuk_0522"
FT   CDS_pept        492831..494012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0522"
FT                   /product="Tubulin/FtsZ GTPase"
FT                   /note="PFAM: Tubulin/FtsZ GTPase; KEGG: hma:rrnAC3284 cell
FT                   division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46656"
FT                   /db_xref="GOA:C7NYJ5"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ5"
FT                   /inference="protein motif:PFAM:PF00091"
FT                   /protein_id="ACV46656.1"
FT                   /translation="MNLAAIGFGNAGGKIVDRFLAFEERSGRSLTTEALAINSAEIDLA
FT                   KLEVLPPDRRLIIGQTDERVKGRGVGADPELGSEIARQDLTEIERQLDTVPIHETDGFL
FT                   VVAGLGGGTGSGGAPELAERLGRIYEEPIYGLGVLPSADEGGRPSLNAARSLQAFADAT
FT                   DNLMVFDNDAWRQTQGSVAAGYDRTNREIARRFVTLLAAGELDGSQVSESAMDASDIRR
FT                   TLATGGLSTIAFSQADVEAETKSKQGLLGRLRSNGESHTDEGDLAKKIHGLVRKAVQSR
FT                   LTCPADVASAERALVVVSGPPREVSQKGLQRARQWLERETDSVEVLAGDDPRTDADALS
FT                   VAVLLSNVTEVPRVDELQERAVTAQENSRQQAAERRAEIDELLTDEENELDPL"
FT   gene            complement(494009..494746)
FT                   /locus_tag="Hmuk_0523"
FT   CDS_pept        complement(494009..494746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0523"
FT                   /product="Protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; KEGG: hma:rrnAC2256
FT                   protein-L-isoaspartate O- methyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46657"
FT                   /db_xref="GOA:C7NYJ6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ6"
FT                   /inference="protein motif:PRIAM:2.1.1.77"
FT                   /protein_id="ACV46657.1"
FT                   /translation="MEQAVLREDMVDSLTHESKGCLQTPRLADAMRTVSREAFVEDDRA
FT                   AYSDRSFERFGTRVLAPSTAARLLEALAPEADDDVLIVGVGVGYTAALVAEIVGPERVH
FT                   AIDITRRLVYDARSNLATAGYEAVLVDRRDGAEGLPEYAPYDKILLEAAAVEPPRALRE
FT                   QLADDGRLVMPLGAAEQTLTVVAADGSQRRLGGVAFQPMLVEGEQADTVERNRTHREDR
FT                   ERAQQAAQSRAGWEQEWIDWDDY"
FT   gene            494908..495417
FT                   /locus_tag="Hmuk_0524"
FT   CDS_pept        494908..495417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ2094A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46658"
FT                   /db_xref="GOA:C7NYJ7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ7"
FT                   /inference="similar to AA sequence:KEGG:HQ2094A"
FT                   /protein_id="ACV46658.1"
FT                   /translation="MPGTPEPVVGSAVVTLGLAVAVGTLVAVVPLVVGRRPSPRRYAAV
FT                   GGGVYALAVGGLWAVPRIGVAGLGCSLPGDVGTCGPFALIGVVVLAGQGAVALYTYSEY
FT                   GYVVPLGATASATLVLAWSFLRIGGESDPMTLYALFFGPAAVGVTCVLGVCEGIVRRQG
FT                   TTVTAS"
FT   gene            complement(495404..496024)
FT                   /locus_tag="Hmuk_0525"
FT   CDS_pept        complement(495404..496024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0525"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: nph:NP0018A protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46659"
FT                   /db_xref="GOA:C7NYJ8"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ8"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ACV46659.1"
FT                   /translation="MDWAARRRALVEALAESDRIDDERVLTAIESVPRHEFVPEQHRER
FT                   AYDDRPLPIGDGQTISAPHMVAIMADLLELAPDDRVLEIGTGCGYHAAVTAELADTVYS
FT                   VEYHATLAETARERLANLGYDTVAIRAGDGRGGWPEHAPYDRAYLTCGPVRFPRAVVEQ
FT                   LRPGGVVLGPLGRRPQTLVRARKRADGELEREHHGSVRFVTMQ"
FT   gene            complement(496026..496682)
FT                   /locus_tag="Hmuk_0526"
FT   CDS_pept        complement(496026..496682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46660"
FT                   /db_xref="InterPro:IPR012041"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYJ9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2259"
FT                   /protein_id="ACV46660.1"
FT                   /translation="MTDATPGDRLALPCPACSPAFETVHEVLSPGSHVTVRCTECDHTH
FT                   KEQLPDDDEVQRRVVVSQDGESFSAQVDVPAEEELAKGEEFLLDAEEALMTVRITAVEL
FT                   DEGGRVDEGTAEDVETIWTRAVGNVAVDVTMHPKDGRHDSTESFKLNVPGDYEFTVGAT
FT                   DEFGDNEFTVEGFHVRDDAHGYDREQYDQDRDSALAKDIKRLYVRDESTTAWSAW"
FT   gene            496819..497994
FT                   /locus_tag="Hmuk_0527"
FT   CDS_pept        496819..497994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP5018A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46661"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK0"
FT                   /inference="similar to AA sequence:KEGG:NP5018A"
FT                   /protein_id="ACV46661.1"
FT                   /translation="MAPIRRRRALQLAGGSLSALVAGCVGGSPSAGTDEQTDTPTDEPT
FT                   ETTTDGRTETPTSATEVTGSEQVRYPSGPSEPDWAGADAVGHVALAASRERARALLAPF
FT                   ELPEARREPVVELLRETDFERSLLALVETVGPNGCYRTVEVSNLALSGDRLVGDASAVD
FT                   ESDGETACTEALTYPATLVRVTFDGRPPERATFTITDGWGESADVTGTVEDRIGPDPDD
FT                   LAGHVRPDDDPVVREPLSCDREGFQRHGSWVDDPPWGLATDDDGAPTFALRVDRLEAGV
FT                   GETVTVTMTNVGDGVLSTGNRHKYGLQTQTESGWEDVRGATDGDPLSYTDEAIGHAPGD
FT                   GFEWTLELTEEGLVADHVHADRLVVCPDLEPGRYRFVFWEPAVAVAFDLVE"
FT   sig_peptide     496819..496920
FT                   /locus_tag="Hmuk_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.746 at
FT                   residue 34"
FT   gene            complement(498063..499013)
FT                   /locus_tag="Hmuk_0528"
FT   CDS_pept        complement(498063..499013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0528"
FT                   /product="aminopeptidase"
FT                   /note="KEGG: hma:rrnAC2261 aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46662"
FT                   /db_xref="GOA:C7NYK1"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2261"
FT                   /protein_id="ACV46662.1"
FT                   /translation="MNSSLRKPARTAVEQCLNLQSTESCAVVTDEKRTAIGEALYRVAS
FT                   EISDDTVFLRYPPGEQHGEEPPEPVAAAMAGADVVLAPTTKSLSHTQARSEANEAGARV
FT                   ATLPGITEGVFLMGLDADYEAIAGHCRDVLAQVEDADEIRVTSPQGTDITFGLGDREWQ
FT                   LDTGIVHEPGEMSNLPAGEVFCSPTTADGTFVVDGTMMPHGQLEGELLEFTVEDGLVTE
FT                   IGDDAVRQQIEAAAETVGDAAYNLAELGIGTNVAVRDLVGSVLLDEKAGGTVHIAIGDD
FT                   HAIGGDTTAPIHLDGILREPTVFADGVAVELPQAE"
FT   gene            499137..500219
FT                   /locus_tag="Hmuk_0529"
FT   CDS_pept        499137..500219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0529"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type
FT                   II"
FT                   /EC_number="1.2.1.59"
FT                   /note="KEGG: hma:rrnAC2262 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type II; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46663"
FT                   /db_xref="GOA:C7NYK2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK2"
FT                   /inference="protein motif:TFAM:TIGR01546"
FT                   /protein_id="ACV46663.1"
FT                   /translation="MLRVGINGFGTIGKRVADAVRAQPDMTVAGVAKRTPDYEAEIARD
FT                   RGYSLFAAAETTPFTAAGIDVAGQVRQLVAASDVVVDATPAGVGERNRALYEELETPAI
FT                   YQGGEDASVAPVSFNARANYDEAVGADAVRVVSCNTTGLSRVLAPLEERYGIEKVRATL
FT                   VRRGGDPSQTGRGPINDTLPDPVSIPSHHAPDVKTVFPELSIDTMGMKVPATLMHTHAI
FT                   NLTLRATPTAEDVRDLLTAEGRLLVIPERLGIDGAGKLKEYTRDAGRPRGDVWENCIWA
FT                   ESLTVEPLSDGRADCYLFQAIHQEADVVPENVDAIRAIAGLADGPESVERTNEALGIGC
FT                   GLAGIEPDTTAPARDAASDD"
FT   gene            complement(500290..500778)
FT                   /locus_tag="Hmuk_0530"
FT   CDS_pept        complement(500290..500778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0530"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: hma:rrnAC2263 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46664"
FT                   /db_xref="GOA:C7NYK3"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK3"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACV46664.1"
FT                   /translation="MHVGIVSDTHDDTDLVAAAIEQFDAVGVDAVVHCGDFVAPFSAAP
FT                   FERAFDFYAVRGNNDGEWALAAQIDEFGTYLGEMGELTLDGVEVAVYHGTSPAIVDALV
FT                   GCGNYDYVLHGHTHERVLEEHGGTVRINPGGIPIEAAPEPLHVAVLDTESGEIEFHRL"
FT   gene            complement(501192..502367)
FT                   /locus_tag="Hmuk_0531"
FT   CDS_pept        complement(501192..502367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ2282A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46665"
FT                   /db_xref="GOA:C7NYK4"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK4"
FT                   /inference="similar to AA sequence:KEGG:HQ2282A"
FT                   /protein_id="ACV46665.1"
FT                   /translation="MVADNPAHRRSTVALALLVNAVPLVGVFAFDWELLPVLVLYWIEA
FT                   VAYVTRSSVEALFATRPVDDDFYGIQVPLERLREKRGSVTLVDWLPPIYPRNLPFALNA
FT                   GWVLFGLGVVAILVWGYARSSGSLAGLVLPGVVVGAVIVVVRHAGTLSEFVRAKRYEHH
FT                   SALSTFSRRRWMAVVIAGFLLPIAGAGADSAGVGLTATLAVVVAAKLVADVLDVTSTTD
FT                   DGAQPEVEADDPITVPDGEPITVVGTDDRGVVLHALGLGVLLALLPPYGFLVALVSVGV
FT                   GLWFGLVAAVSTVVALVAGRAVLEIPVARLAYGAVEYRVYGDVVVAYDRRLDAPQWSVA
FT                   RHEIADVRVGSGIASTFFSNDFGTVRLVRDDDTKVLSVVDDPEALARVVTR"
FT   gene            complement(502539..504548)
FT                   /locus_tag="Hmuk_0532"
FT   CDS_pept        complement(502539..504548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GM16292 gene product from transcript GM16292-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46666"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46666.1"
FT                   /translation="MSSDDNNQNKSRREVLRGIAVAGATAIGASTAGAASDASLNDITE
FT                   RGTPSLAASEVTRSVSIRASGEASYTFSVTGLVSATDAPSESLDAGAATATIEGETHSY
FT                   DFSGEFTELDVSGGAEVVVDGDSVDPDAFPQQTLTVIAPGHVDVDISASGRVEADDDEL
FT                   EKPNARTVRGTINGRTDISYAGELTYFDASDQVWVRRDDQKLEPDDALPASLPGEMEIS
FT                   GDGRGVTVEVSGDADSDHAHASVEDGSVSAYSTQRGTTARYDGRVERIEHESGATVEIV
FT                   PESKRVVCTAPENRSVEFSTESTEAFIYEEEVHKNPTVTVAAGETERIQYFGDVTSVGI
FT                   ARMTVSFDYMAYESAQSSARLQMAAKFERLDAYDQLASAVEGRIRHDADGLYTITSDTA
FT                   TDPVDSVTFKLTDLETGDEGTVSVTKRHDTDDVVAGKNTYQWRNDAGNIEQFRHDTLEV
FT                   GSLSTAAAGLSTETYEFDAPETTQPETQGDWIPTIPWGDWIGDIYDGLKDVSDGIQDVS
FT                   ADYLAEAIEYADVSSSEIAVTGGKIVANTINSFQSLATKFIDDFKIKALWKLRITGYSS
FT                   MISLVGSGVFEAIGDENYDCGACVAFIRLSLDVGLCGYGVAAFCGAFSLTTLGLGTVPC
FT                   AVLGGAICSLTISALPDAKDICSSDTYPTQAGFC"
FT   sig_peptide     complement(504444..504548)
FT                   /locus_tag="Hmuk_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.875 at
FT                   residue 35"
FT   gene            complement(504677..505717)
FT                   /locus_tag="Hmuk_0533"
FT   CDS_pept        complement(504677..505717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0533"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   hma:rrnAC0248 phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46667"
FT                   /db_xref="GOA:C7NYK6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK6"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACV46667.1"
FT                   /translation="MREPSSLQERDPDPFSEQMIALMVAAAGIECEVLDAEPLRTGSAT
FT                   TYRVDVRDQEGDRRTVVFKAAVEGDATGLRREPALLRYVADHTSIPVPDVYGSHLQPDD
FT                   LPAPSFVMEHVEGGSPTQASARENGDTGWPDGILDDIVRQAGRHLAALHDCGPVSGFGP
FT                   ITVDDGTLTVTDPASSWQSWLWELAAEIEGDTRLDGLASTVQSVLDSEIPELPDVDPVL
FT                   AHYDYQPRNVVVDEGAGRVRAVLDWGGARSVHDEFELAVTEQYCSGWAPLGSDKRQRVR
FT                   ASLYEGYRDRRSLATDEAFRRRRRLYLLLSTVASLSWAPYWSGPRAERFVASQRSLVES
FT                   LLDQGP"
FT   gene            complement(505883..507100)
FT                   /locus_tag="Hmuk_0534"
FT   CDS_pept        complement(505883..507100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0534"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hma:rrnAC2364
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46668"
FT                   /db_xref="GOA:C7NYK7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK7"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACV46668.1"
FT                   /translation="MAAFQTLDDLADGQRVLVRLDLNSPVEDGAVQDNRRFERHAKTVR
FT                   ELADRGFETVLMAHQGRPGRDTFVSLEQHADILSGHIGTDVDFVADTFGEDALAAIDDL
FT                   GGGDVLLLENTRMCDEELPEEDPEVKAETEFVRTLAPEFDAYVNDAYSAAHRSHASLVG
FT                   FPLVLPAYAGRVMETEYEANTAIAQKEFDGQVTMAVGGTKATDVIDVMDHLGDTVDDFL
FT                   LGGIAGELFLRADGAPVGFDLDPDLDLYDSQWADNHELIERILEENREKITLATDMAYA
FT                   DEDGDRAETNVADIDEKTVSFMDVGSDTAEGYADVIRDSEAVFVKGALGVFEEERFSVG
FT                   TVSVLEAIAETDCFSVVGGGDTSRAIEMYGMSEDDFGHVSIAGGAYIRALTGASLIGVE
FT                   VLQRED"
FT   gene            complement(507226..508059)
FT                   /locus_tag="Hmuk_0535"
FT   CDS_pept        complement(507226..508059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46669"
FT                   /db_xref="GOA:C7NYK8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46669.1"
FT                   /translation="MTEFSVVERVRRPEYTGPNRCVPCTAVNVVIAAVASTLVGVVVPL
FT                   AGVAVLALSLVSIYLRGYLVPGTPTLTKRYLPESIRARFDDHEADDEEWETIQKIEQHR
FT                   ENAVDPERFLADEGVVARDGGTDRFTEDFAALRDEHVEANRDSLREPATLATLFDAAPD
FT                   SVATTDRDYPAIEIDNRIRKWPSEAALLADVATDAAMAAWTDRWTDVPVEQRATIREEL
FT                   RTLGDDCPACGGQITTTADTVESCCGLHEVIAAECGSCGDRLRELDENHEAKLTR"
FT   gene            complement(508100..508630)
FT                   /locus_tag="Hmuk_0536"
FT   CDS_pept        complement(508100..508630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46670"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYK9"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2045"
FT                   /protein_id="ACV46670.1"
FT                   /translation="MRGLLGGGPPDDVDPFTPDDDDDEYRPQSARSVNSGLLSRWLVPR
FT                   AIRRWAISLSIETPQAEYELGSAIPFRVTMKNALPIPITLTTRSPVLWAWTVEGLTEAS
FT                   HVDQYDPPDEEGKLHFERGERKQFAGEWSGRFRVTEREWEPADPGEYALGAHVNVDGHE
FT                   DSLADECVVRLVR"
FT   gene            complement(508730..510064)
FT                   /locus_tag="Hmuk_0537"
FT   CDS_pept        complement(508730..510064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0537"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: hma:rrnAC2043 oligopeptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46671"
FT                   /db_xref="GOA:C7NYL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46671.1"
FT                   /translation="MSRTILRTEGLTKYYESDEGFVDRLLGEPQLVRAVDGVDIELEAG
FT                   ETLGVVGESGCGKTTLGRSILQLVEPTEGSVYYHDGQQEIDLTEVSNSKLRSLRTDLQY
FT                   IFQDPFSSLNPRLTVGDIIGEPLDIHDIASGDARMERIYELLETVGLNPSHANRYPHEF
FT                   SGGQRQRIGIARALAVDPEVIICDEPVSALDVSVQAQILNLLEDLQEEFGLSYVFIAHD
FT                   LSVVEHISDRIAVMYLGQVAEVGPTESVFNPPHHPYTEALLSAIPEPDPLWEADQTLLS
FT                   GSVPSPIDPPSGCRFHTRCPRVIQPDEYDLDQSVWRAVMDLKIRLSGTDSLKSLTAIPA
FT                   DEDTDPHDAGRDELDRLVREEFGLPEQVGDPQVESVLSDLVDDLAQADLDGARSRAAEA
FT                   FESPCERRDPPLTHTRGGQQIACLLYEDDYPDPPAVLRDGELAGD"
FT   gene            complement(510057..511124)
FT                   /locus_tag="Hmuk_0538"
FT   CDS_pept        complement(510057..511124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0538"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: hma:rrnAC2042 oligopeptide ABC transporter
FT                   ATPase component; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46672"
FT                   /db_xref="GOA:C7NYL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV46672.1"
FT                   /translation="MALVEINDLTVNFYTEEGVVRAVDDLSYTIERGEKFGVVGESGAG
FT                   KSVTAMSLMRLIEDPGQIESGEILFKGEDLLEMSEERVRSIRGNEIAMIFQDAQTALNP
FT                   VYTVGEQISEVIRHHLDYGEQEAKERTIRLLDEVGIPEAEARYSDYPHEFSGGMQQRAV
FT                   IAMALSCDPDLLIADEPTTALDVTIEAKILDQLEDLADEFDTSIQLITHDLGVIAQVCD
FT                   RVMVMYGGRPVEKAPVEELYYDPKHPYSVGLMSSIPRIGDTRERLQTIPGTMPDLVDVP
FT                   TGCSFHPRCPYAEEACTRKDPVLVDPETGHEASGDPGEHAAACLEYTDDLTGGLDYTVE
FT                   VDGEEPQITPGDQRE"
FT   gene            complement(511124..512167)
FT                   /locus_tag="Hmuk_0539"
FT   CDS_pept        complement(511124..512167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0539"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2041 oligopeptide
FT                   transport system permease protein OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46673"
FT                   /db_xref="GOA:C7NYL2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46673.1"
FT                   /translation="MSTQRGRIQISGFDTEQVTEREPLSDWTAGGTDRGTEGRWQRAWR
FT                   QFKSNRTAMIGLSVVAIMVVLTTFARPVEIAGITVQPISLAPFEPQKSLFLEPGSNVGA
FT                   YDPPSLAHPMGTDASGRDMFSRVMVGGRASISIGFVVVFITAGFGLVYGAVAGYYGGWV
FT                   DEVMMRIVDTVFAFPALVLALVIIAILGGGYWQLVAAFAFPGWAGYARLIRGEILSVKQ
FT                   NQYVTAAQALGARDRSVIFRHIVPNAIAPLIVQASLSIGTVVIGVAALGFLGLGFPPGT
FT                   PEWGTMLDATRETLIQGPGGSIPWWATVFPGGAIFIFVMAMNMIGDGVNDALDAQSNVD
FT                   VEQGGGN"
FT   gene            complement(512170..513126)
FT                   /locus_tag="Hmuk_0540"
FT   CDS_pept        complement(512170..513126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0540"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hma:rrnAC2040 oligopeptide
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46674"
FT                   /db_xref="GOA:C7NYL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV46674.1"
FT                   /translation="MGLRRFIVKRVLLTIPILFGVSIVTFGMVHLTPGDPIDVLVSFNP
FT                   DVGPAEEAALRERYGYDLPVWEQYLRWIGNVLQGDLGPVITRSGVSVNDVIMNRLPETI
FT                   VLGLFGWVFALVIAIPTGIYAAVNKDDLGDHVSRFIALSGISVPNFWLGLMLILFGALV
FT                   FNIWPVLPPRNGLLSLDTLWFLVMPGITIGTASASTLMRIMRSSMAEELNKEYVTAARA
FT                   KGLPEQTVILKHVLRNSLISVTTVAAFLTANIVAGSVVVEVVFSWPGLGREFVQAITSR
FT                   EVNLILAITLFTGVALVLANLLADIVYAMLDPRIRYD"
FT   gene            complement(513139..515037)
FT                   /locus_tag="Hmuk_0541"
FT   CDS_pept        complement(513139..515037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0541"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hma:rrnAC2039 oligopeptide ABC transporter
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46675"
FT                   /db_xref="GOA:C7NYL4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL4"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV46675.1"
FT                   /translation="MSLAGCSDQLGGGGDGGDGGDGGVDPVQDRVTVDPADIEEGGTFR
FT                   AAIGEGPDSFDFAYSSSASASILHNLIFEGMVTTDASGEIYPWLAESYEQVDVQDVSPA
FT                   DYADYMTSVPYTETEDGAMVIDTDAQIVLEHPDNDPASGDDARVLTVEEAGDAVADGTY
FT                   GMHFRFDLHEGVTFHNGNEMTADNVVESYERIRNSTLSGQYYDSMLDIQADGDYTVHLY
FT                   IQEPDAAAVLELGDAPIYPSESATLPPEAMDPRQGNTPMGTGMFELDEFQEGEYVVFTA
FT                   FDDYWFDTEMKDWFEGSSEFPNGPVVDEVDVSFVSEDASRSAALQEGEIDMSYGLTAST
FT                   LNDYQNSEDFRTAPTDGAGYTFLQHPVTVEPFTDKRVRQAINHLIPRENIAQNIFSGWE
FT                   NPAWTPLPPVAAGAGTDDYEQLVEDGREYNEYDQERAAELVEEAIEDNGWETPIEVQLE
FT                   TNSDNDDRVRTVELIQEALNRSEYFEASLETYEFLDFIGQLLSEEYYDDGKFAFIGLSG
FT                   GFNPHGYAKSVHSQDNFAQCCNFQNINDDELSQLLRDARYGVDVAQDPELRQERYNAVW
FT                   ERVLELSANSYGTHSTLVGVVDDTVVNGFNTYPSTQDIIGYGLFAPQDEQITYLSR"
FT   gene            515533..516795
FT                   /locus_tag="Hmuk_0542"
FT   CDS_pept        515533..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG6088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46676"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL5"
FT                   /inference="similar to AA sequence:KEGG:pNG6088"
FT                   /protein_id="ACV46676.1"
FT                   /translation="MQPTQRGVSRREFVKAAVAIGGSAALSACLERESPDLATGDPSSV
FT                   PDRQHAWDEALPRDDHGNVRIPRHHVLLLVEYSETGVPDDDARETVEAAFRSLERAYPW
FT                   SNEGLLFTAGYAPAYFDRYDAGPDGVALPAPTALAPFEDPELDEPDAVIHLTSDYGSVV
FT                   LGAEQALVGERSTLNGVDVSGFGEVFDRVDKRTGFVGDGLPAENQDVDGIPDDEPVDED
FT                   APLFMGFESGFEKNQASEDGVTIESGPFAGGTTQHLSKIRLHLDQWYNQDSRSQRVAKM
FT                   FCPAHAEDDRVEGVGENLGDDNQVGDCVDDIEADAGSHGIVGHAQKNARARDEDDTPVL
FT                   LRRDFDSTDDGAAGVHFLSLQSSVADFVATRAAMNGSDVSEESSVGTRLNNGILQYMTV
FT                   QRRGNYLVPPRSSRALPRPSP"
FT   gene            516850..517902
FT                   /locus_tag="Hmuk_0543"
FT   CDS_pept        516850..517902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG6087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46677"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL6"
FT                   /inference="similar to AA sequence:KEGG:pNG6087"
FT                   /protein_id="ACV46677.1"
FT                   /translation="MDRSQYTRRALLGGVAGLGATATAGCSGLLESQAVGEPPVVEERP
FT                   NAVYYPTHVEGMEMIGMTDAGDRQIGLMYSYAHRFWTMDVGDTARVSAGDADAHLMASV
FT                   WDPDTGQVLPVRSGLSVAIERDGQTIDERTPWTMLSQNMGFHYGDNVSLDGDGTYTVTV
FT                   EAGGLGIDRLGAFADRFAEPVTAEFEWEFSRSRRNEISFRQLDGAGDPGALDPMEMKMP
FT                   LSVAPAREDLPGRIVGTGETGDATLVVAVTDRGGEPYLAVAPRTPYNRYVLPAMSLSAT
FT                   LTREGEAVLDDSLSAAIDPDLGYHYGTAVDGVDSGDELTIAVDSVPQIARHEGYETAFL
FT                   SMPDVELTVE"
FT   sig_peptide     516850..516924
FT                   /locus_tag="Hmuk_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.253 at
FT                   residue 25"
FT   gene            518003..518854
FT                   /locus_tag="Hmuk_0544"
FT   CDS_pept        518003..518854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46678"
FT                   /db_xref="GOA:C7NYL7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL7"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2986"
FT                   /protein_id="ACV46678.1"
FT                   /translation="MQRRAAAIYFVFFLVVGAGAYAYIGVAEQTSQPQYDLDGTMVESN
FT                   ETVAIGETEYTLNGIHRTEGEHGSGGELVSELTWTNDSYVGTGSISHNSTTEYQNESYR
FT                   VLVANETGVSEFTLEAQQNVSAILQADPAVENTTATRDGTEYVVYRNNDTIQPLAEYLP
FT                   EPERRTVSEGETFPYEGNDATVVNVTTSEVRLEWDSSEENTVELIEGGNVTLADGQQYF
FT                   ANYHGEESVSLVPASQYSEYVQTNNERDSFQTRLNGLWGIAIISGLAALTALSTAYLPV
FT                   RG"
FT   sig_peptide     518003..518071
FT                   /locus_tag="Hmuk_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.932 at
FT                   residue 23"
FT   gene            complement(518963..519175)
FT                   /locus_tag="Hmuk_0545"
FT   CDS_pept        complement(518963..519175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46679"
FT                   /db_xref="GOA:C7NYL8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46679.1"
FT                   /translation="MNALTERFDDLAEPLGIGTGVVLVLIGLGTVAGTPWTTNGSLVVS
FT                   VLQILGVVATIALGAALASLSWSGR"
FT   gene            complement(519476..519548)
FT                   /locus_tag="Hmuk_R0007"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(519476..519548)
FT                   /locus_tag="Hmuk_R0007"
FT                   /product="tRNA-Lys"
FT   gene            complement(519589..520578)
FT                   /locus_tag="Hmuk_0546"
FT   CDS_pept        complement(519589..520578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0546"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; Nucleolar
FT                   GTP-binding-1 domain protein; KEGG: hma:rrnAC2374
FT                   GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46680"
FT                   /db_xref="GOA:C7NYL9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYL9"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACV46680.1"
FT                   /translation="MSHPFEDLPTTPTAEEVIDKAFSRAARAGKAKTGIEGQQSMLQTA
FT                   SNIVSDNLQNVVTAWPDIDTLDPFYVELADAIITSNVEGEGGIDALRQHLSEVQWASRK
FT                   AKDIHSEYQGRMTGDADTARKLRKQAFARMADIVEEVEDDLAGISAARDALKTLPDIRP
FT                   DEPTIVVAGYPNVGKSSFVNLVTNARNETASYPFTTTQIRVGHVERDRIRYQLVDTPGL
FT                   LDRPEAERNDIESQAVSAVEHLADAVLVFLDASGNCGYPIEVQLELRDALEDRFDAPVL
FT                   TIANKADLTRDVEADHYMSVTEGDNVDGVLDAAIEAVGYEIELPFDDE"
FT   gene            complement(520686..521060)
FT                   /locus_tag="Hmuk_0547"
FT   CDS_pept        complement(520686..521060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46681"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM0"
FT                   /inference="similar to AA sequence:KEGG:rrnAC3431"
FT                   /protein_id="ACV46681.1"
FT                   /translation="MTGPVDGRRSTERWDTMFRVLAAEPRRRLVVALADARADETLALP
FT                   EAAHSSPPQRDRDLLHRQLVHLHLPTLAEADLIEWDREPLRTRRGPRFAEAAAIVDLLH
FT                   DHVEELPSSLRRHCDLLTEQ"
FT   gene            521169..521486
FT                   /locus_tag="Hmuk_0548"
FT   CDS_pept        521169..521486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46682"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2373"
FT                   /protein_id="ACV46682.1"
FT                   /translation="MSEIDAGEILPNEHVQQMAADGTVTQMHRGHAYASEGDTFVIDGQ
FT                   RFEVTDVTHRTLGDLTDEDARREGSDDLEAYKRRLERVHDEFEWDPESDVVRHRFEPVE
FT                   D"
FT   gene            complement(521668..521967)
FT                   /locus_tag="Hmuk_0549"
FT   CDS_pept        complement(521668..521967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0549"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   hma:rrnAC2371 phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46683"
FT                   /db_xref="GOA:C7NYM2"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM2"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ACV46683.1"
FT                   /translation="MTDADADEILDELFSVIEQRKADLPEDSYTASLFTHEKGENAVLE
FT                   KLGEETTELILAAKDDDHEEIAHESADIVYHLLVMLAMKDLDVSDLRDELAERR"
FT   gene            complement(522110..522289)
FT                   /locus_tag="Hmuk_0550"
FT   CDS_pept        complement(522110..522289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46684"
FT                   /db_xref="GOA:C7NYM3"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46684.1"
FT                   /translation="MTRSLTLGTSVVLLFASLMVSAVLFGDLLPNHWIAFVLLPIIAGL
FT                   LYYGALTAYYYSNN"
FT   sig_peptide     complement(522221..522289)
FT                   /locus_tag="Hmuk_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.657 at
FT                   residue 23"
FT   gene            complement(522371..522964)
FT                   /locus_tag="Hmuk_0551"
FT   CDS_pept        complement(522371..522964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0551"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   hma:rrnAC2369 glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46685"
FT                   /db_xref="GOA:C7NYM4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM4"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACV46685.1"
FT                   /translation="MTLTAGVIAVQGDVSEHATAIERAARAHGEDAEIHEIRHSGTVPE
FT                   CDALLLPGGESTTISRLLRDEGIAAEIVDHVDAGKPMLATCAGLIVASTDPQDDRVDEL
FT                   DLLDVTVERNAFGRQKDSFEAPLDVAGLDEPFPAVFIRAPVIDAVGEGVAVLAEWDGRP
FT                   VAVKQGPVVGTSFHPELTEDSRLHDLAFFESVEA"
FT   gene            523052..524071
FT                   /locus_tag="Hmuk_0552"
FT   CDS_pept        523052..524071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46686"
FT                   /db_xref="GOA:C7NYM5"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM5"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2368"
FT                   /protein_id="ACV46686.1"
FT                   /translation="MGNRRRDPVSVRDDGSQDLYDVSEWEVRSWLDRVAWLCYAALVYS
FT                   LRGFVVLAAIAILLSQFLVGGLGALSNPVLGAFTVLSAVPALALAAYAWHTDVTTKEPL
FT                   ALLVATFVLGVLFASFAGIANSGLGPAVQGIGSGFLASIVGTVLFYFLVVGPVEEGVKL
FT                   LSVRLVAYRSDRFDAVIDGAVYGAVAGLGFATIENALYITQNADAGVTVANAVMEAGSI
FT                   TFLRSLAGPGHVIYSAFAGYYLGLAKFNREHAGPIVIKGLIVASLIHATYNTLVGVVPA
FT                   VVSVLTGVSPLVAFLGFVLVYDGVFGALLLGKFNAYERAYERAHTDEVPAPELTEFEP"
FT   gene            complement(524072..524650)
FT                   /locus_tag="Hmuk_0553"
FT   CDS_pept        complement(524072..524650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0553"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: hma:rrnAC2367 riboflavin
FT                   synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46687"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM6"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ACV46687.1"
FT                   /translation="MFTGIVEATGEVRAVEDTADGRRLRIGSPFEELSHGQSISVSGAC
FT                   LTVEEFEPGEWFSVFLAEETIDRTFFDEIAEGDELNLERAMPADGRFDGHIVQGHVDAT
FT                   ATVEEIERVGEDWRFTFSLPADIERYVVEKGSITVDGISLTVADRREDSFSVAIIPTTY
FT                   DVTTLSEKSPGDAAHLEVDVVAKYVERMV"
FT   gene            524749..524982
FT                   /locus_tag="Hmuk_0554"
FT   CDS_pept        524749..524982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ1362A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46688"
FT                   /db_xref="GOA:C7NYM7"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM7"
FT                   /inference="similar to AA sequence:KEGG:HQ1362A"
FT                   /protein_id="ACV46688.1"
FT                   /translation="MPRGILELIGLAGSVLFASSVGLFGLQTVTDGDTLAGVGYLAVAA
FT                   LMVLVPYYVTTPDDVAGSAAERAVGWVVRDDD"
FT   gene            525178..525369
FT                   /locus_tag="Hmuk_0555"
FT   CDS_pept        525178..525369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46689"
FT                   /db_xref="GOA:C7NYM8"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46689.1"
FT                   /translation="MVVEIFGGIVLLIILLLLGAMSAWVYKDGKRHNVDYPVIWALATF
FT                   IGGIGGLILYILAREMYY"
FT   sig_peptide     525178..525246
FT                   /locus_tag="Hmuk_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.502 at
FT                   residue 23"
FT   gene            complement(526552..528393)
FT                   /locus_tag="Hmuk_0556"
FT   CDS_pept        complement(526552..528393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0556"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: hma:rrnAC2267 repair
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46690"
FT                   /db_xref="GOA:C7NYM9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYM9"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACV46690.1"
FT                   /translation="MTDTSPQVVRLFGGPGSGKTTALLDRVEELLSEDDADVRDILVVS
FT                   YTRAAAAEIRERLAERLDINPRSLKGNVCTMHAKAYELLDLSRGDVVGESDKEDFCDEF
FT                   GLEFEDEYEGSRRRSARSTTLGNKVIATSQWLQRTRRDVADWYDVPFKWDEEEVRLPPE
FT                   IDDNAQTGNKYTPTWPGDDDRLDVPEAIRAWRTYKGDNDLTGFADMLERVKQRSLLPNV
FT                   EYLIIDEFQDITTLQYDVYEEWKPRMTKILIAGDDDQVVYAWQGADPDLLLEEDVDVDE
FT                   VLPNSYRLPSSILNVVNREVRHIEKRQEKDLNPRKEGGEVLPMLNPSMLDLVREIRRTV
FT                   DDDEGTVMILFRARYQMFQFMDEFIGEGIPFTCLTDQRMWTDRLTEYVRGVEALDADER
FT                   LSVLEGRRLADMLADSAFGTGDRDDLFDELDEIADASEKDDLADIEMDPDVIREHAPFA
FT                   PDPRAAADMLRKVTNFQERTVEAYFHGEYAGMDADQVRLGTIHSAKGREADHVFVGTDL
FT                   TEKVVEQMAAQVEQNDRHVPGDEEFTKHTDPIPTLTDNERRVFYVGMSRARERLVLMEN
FT                   LVDGAPTLPIDVILENEPRPDSPEELLIEAQEPLPTP"
FT   gene            complement(528503..528661)
FT                   /locus_tag="Hmuk_0557"
FT   CDS_pept        complement(528503..528661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ1109A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46691"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN0"
FT                   /inference="similar to AA sequence:KEGG:HQ1109A"
FT                   /protein_id="ACV46691.1"
FT                   /translation="MPKCQNCGSFVTKDYVRVFTPQEDTDPRVCPDCEDMIRDGADVRE
FT                   ARSPRHS"
FT   gene            complement(528798..529097)
FT                   /locus_tag="Hmuk_0558"
FT   CDS_pept        complement(528798..529097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46692"
FT                   /db_xref="GOA:C7NYN1"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN1"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2268"
FT                   /protein_id="ACV46692.1"
FT                   /translation="MVDGVVIASGVLALLRMVVFGLTLGITLISFQAYRKRPSERLQAA
FT                   FVGFAFISMGVAVSSVITQLSVSDTGEATRLFFQFAETIPFIIGFSMLYLSLYR"
FT   gene            complement(529110..529460)
FT                   /locus_tag="Hmuk_0559"
FT   CDS_pept        complement(529110..529460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0559"
FT                   /product="transcription regulator"
FT                   /note="KEGG: nph:NP2558A transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46693"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN2"
FT                   /inference="similar to AA sequence:KEGG:NP2558A"
FT                   /protein_id="ACV46693.1"
FT                   /translation="MNDEKSIEEILDTIGDQHARQVLAAISRESQSAKELAEECDMSLP
FT                   TVYRRIEMLTEYELVTARTLVADDGNHYKVYESNFESTVISLEDDEYKVRIYREENLPD
FT                   RFSQLWDELNPD"
FT   gene            529593..530093
FT                   /locus_tag="Hmuk_0560"
FT   CDS_pept        529593..530093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0560"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: hma:rrnAC2270 ParR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46694"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN3"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACV46694.1"
FT                   /translation="MTEDELRHVPTGDAGHASADERLTPLVGGRDTETSSDRSSRDGVP
FT                   ETLLSSVGETLADGDAAIDEGLVTQSLDEILLALIASSTDQTHGTELMDELERCFDAQL
FT                   SPGTVYPRLHELDSEGLLEMHELVQTKQYSISDDPAARDRIERAVYQHLAIGMFLHASL
FT                   DDA"
FT   gene            complement(530340..530519)
FT                   /locus_tag="Hmuk_0561"
FT   CDS_pept        complement(530340..530519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hsl:OE4676F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46695"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN4"
FT                   /inference="similar to AA sequence:KEGG:OE4676F"
FT                   /protein_id="ACV46695.1"
FT                   /translation="MATAPSTDDMIDEFLSQRGHDVETSGWEESYNKKQCPDCGGLHDG
FT                   AATECSVCGWGPAN"
FT   gene            complement(531046..531121)
FT                   /locus_tag="Hmuk_R0008"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(531046..531121)
FT                   /locus_tag="Hmuk_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(531391..531463)
FT                   /locus_tag="Hmuk_R0009"
FT                   /note="tRNA-Asn1"
FT   tRNA            complement(531391..531463)
FT                   /locus_tag="Hmuk_R0009"
FT                   /product="tRNA-Asn"
FT   gene            531556..532908
FT                   /locus_tag="Hmuk_0562"
FT   CDS_pept        531556..532908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0562"
FT                   /product="tRNA cytidylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: tRNA nucleotidyltransferase, substrate binding
FT                   domain protein; DNA polymerase beta domain protein region;
FT                   KEGG: hma:rrnAC2298 tRNA CCA-pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46696"
FT                   /db_xref="GOA:C7NYN5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN5"
FT                   /inference="protein motif:PRIAM:2.7.7.21"
FT                   /protein_id="ACV46696.1"
FT                   /translation="MSDEVDAVVERVRERVTPGDDERAELQAVADRLTERGEDAIASLP
FT                   VDAHVVRVGSTARGTWTAGDRDLDLFVCFPPELDREELEEYGLSVGHAVLPAGHEEYAE
FT                   HPYVKGTVDGYDVDLVPCYDVADAASIQSAVDRTPFHTRYLAERLDETLAADVRVCKQF
FT                   MKAIGVYGSDLRTEGFSGYLTELLVLEHDGFRPLVEAAAAWTPPVEFDPADHGRESFDD
FT                   PLVVIDPTDPERNVAAVLSTEQLATFQHYARELAAEPRTDLFEPSESEPVDAETVRAWF
FT                   ERRGTTPVAVRFDAPDLVDDQLWPQLERSLSGVTDALNRRGFDVLRSAAFADETAVLLA
FT                   ELEVAERPAVERHEGPPVHVRDHAEGFYETYADSDATGPYVDGDRYVVERDREFATASA
FT                   FLRSDALSNVALGTHVASALESEYEVLVGEEVAPLAGEFGVELADYVDPKP"
FT   gene            complement(532887..533894)
FT                   /locus_tag="Hmuk_0563"
FT   CDS_pept        complement(532887..533894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0563"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   hma:rrnAC2299 acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46697"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN6"
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /protein_id="ACV46697.1"
FT                   /translation="MNFGYREVCLDHDTGPRHPESADRLRAIRRGLAEYHGVEYVAAGD
FT                   ADEELICKVHDPDYVEEIKAFCQEGGGNWDADTVAVEDTWKAALASAGLAEWAALSALD
FT                   GDDGRETPFALGRPPGHHAVADDAMGFCFVDNAVVAAQSALDEGADGVAIFDWDVHHGN
FT                   GTQDICYDRDDIFYASIHEEGLYPGTGEVDETGTGDGAMRTLNVPYDPGADTVDYLAAV
FT                   DELIAPEIESFDPDLLLVSAGFDAHRHDPISRMRVSSEGYGLLTQRMRDLTDRCDAGLG
FT                   FVLEGGYSLDTLTDSLTTVHEVFDGYQPSQPDGSVSEDARDVLDALVDQGFGST"
FT   gene            complement(533895..534332)
FT                   /locus_tag="Hmuk_0564"
FT   CDS_pept        complement(533895..534332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0564"
FT                   /product="Transcription factor CBF/NF-Y/histone domain
FT                   protein"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/histone domain
FT                   protein; Histone core domain protein; KEGG: hma:rrnAC2301
FT                   histone A1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46698"
FT                   /db_xref="GOA:C7NYN7"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN7"
FT                   /inference="protein motif:PFAM:PF00808"
FT                   /protein_id="ACV46698.1"
FT                   /translation="MSVELPFAPVDSVIRRNAGGLRVSAEAAEELARRIQEYGARLAAD
FT                   AAETATADGRKTLMPEDFDTEGVRDKDELELPVAPVDRIARLDIDDSYRVAMDARVALA
FT                   DILEAYADDVAAAAATLARHADRRTIKAEDVETYFELRQYY"
FT   gene            complement(534388..535836)
FT                   /locus_tag="Hmuk_0565"
FT   CDS_pept        complement(534388..535836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0565"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: hma:rrnAC2302 replication factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46699"
FT                   /db_xref="GOA:C7NYN8"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN8"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ACV46699.1"
FT                   /translation="MGAIGDIYADLETDEVSEEEFREAVEEKVEQMGGLADEETAAMLL
FT                   AHELNENEVNTVADIEPGMNEVKFIAKVMSVGDLRTFERDGDGEDEPDEGRVINVEAAD
FT                   ETGSVRLAFWDQEAESIAEGQLDVGDVLRVAGRPQEGYNGLEVSVDKAEPDADATVDVE
FT                   PGGGSTIDALSMGQSDVDVRGVVLDTDSIRTFDRDDGSEGRVANLTIGDETGRVRVTLW
FT                   DDRADRAEEIDPGTAVEIVDGYVREREGSLELHVGDHGAVDEIDEEVAFEPDAAAIERV
FT                   EIGETVDIAGVVRSADPKRTFDRDDGSEGQVRNVRIQDATGDIRVALWGDKADKEIAPG
FT                   DEILAADVEIDDGWQDDKEASAGWQSTVVVLDGAASAPESGGGDQQTASADGGNESAGL
FT                   DAFADDGADEHTDDASETAGDADATTGETIEFTGTVVQTGDPVVLDDGEETMSVETDER
FT                   VQLGQEVTARGTLRDDRLDADDVF"
FT   gene            complement(535984..536337)
FT                   /locus_tag="Hmuk_0566"
FT   CDS_pept        complement(535984..536337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46700"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46700.1"
FT                   /translation="MTPTLDDATIAVQRNDCGQTTSDATVSFAENVAVSGTIWAPDPGW
FT                   TAVLSAASYDADADELTVAVGVEPRDDSGPVVQCIAEIEYRVTATFLDGLPGSVTVTHE
FT                   TDEGVETVATATA"
FT   gene            536611..536683
FT                   /locus_tag="Hmuk_R0010"
FT                   /note="tRNA-Arg1"
FT   tRNA            536611..536683
FT                   /locus_tag="Hmuk_R0010"
FT                   /product="tRNA-Arg"
FT   gene            complement(536749..537534)
FT                   /locus_tag="Hmuk_0567"
FT   CDS_pept        complement(536749..537534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0567"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG:
FT                   bvi:Bcep1808_4933 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46701"
FT                   /db_xref="GOA:C7NYP0"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP0"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACV46701.1"
FT                   /translation="MTLTDTQFEQYQRDGYVVVEDALDAETVDRVKRRLRAYTHGDRAV
FT                   EGFQSQIEPAVERGEVDVEESGDAVRKFEGLGMVETDDVFRSVADDDTIVDTAAELLGP
FT                   NLKLLRSAAMFKPPAVGSEKGFHQDAAYYPIQPMDHVTVWIALDEATTENGCMNVVPGA
FT                   HTDGLLGHEAADYDTDIVIAEGDVDRADAVPVPMEPGDALFAHCLVPHFTAPNTTDQWR
FT                   RALIMSYMDARSRFTKSAAERPPWVDSVHIRGEDFPGCV"
FT   gene            537644..538252
FT                   /locus_tag="Hmuk_0568"
FT   CDS_pept        537644..538252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0568"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   hsl:OE1215R hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46702"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP1"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ACV46702.1"
FT                   /translation="MRDPLRAGVAIYNEGRYHAAHDAWEDHWLDLSRGTDDERLLHGLI
FT                   QFTAVVHHLDDGNYSGATGLAESAAAYLADLPAAYRGVELDAVRSFLGRVATAPRELTP
FT                   DDAPPLVYEGRRLTYDDLDFEATAVAARVLAEGDDEHAVEAGVEYAREEVAADESGTYT
FT                   GLVFAFVRERDRRPIVTTRLGEHVQRREHRESDVNGLFE"
FT   gene            complement(538438..539712)
FT                   /locus_tag="Hmuk_0569"
FT   CDS_pept        complement(538438..539712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0569"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: hma:rrnAC0816 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46703"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP2"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV46703.1"
FT                   /translation="MTTAQALVKTLDFQLDIQSDNESLLYDATLEARSVYNETIRLAKE
FT                   GVDWDTTPDCVADDADLVKNTTQRVVAKALGAMENYYEYDDFSQPSHTKDGAYPLRANY
FT                   EEGYNLSLTDDGGVAFRISTEPYKHVKGFLTGSDAHLDILKTALTSDEWKIGTAEALFH
FT                   NDDAELHVNVTNTEQTVRDKEDSRTVVGVDVNEDNVALTALSGDGVKRTLVIDFPEIKF
FT                   ERHRYFTMRKRVQNAGKDSIHDTLEGREERFVRDRLHKVSRHIVEWSQQFEKSCIVFED
FT                   LKEMRDSIDYGTRMNRRLHHLPFRALQYYTSYKASFEGIPTAWINPEYTSQRCPMCGHT
FT                   ERANRNKKRFECKSCEHQDHSDRSASVNIAVKGVKKLDWNVPALNSLPVVRKVRRQASG
FT                   AVDAPTVTHSTVRGYQADGRMGVSD"
FT   gene            complement(539709..539864)
FT                   /locus_tag="Hmuk_0570"
FT   CDS_pept        complement(539709..539864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ3732A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46704"
FT                   /db_xref="InterPro:IPR019205"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP3"
FT                   /inference="similar to AA sequence:KEGG:HQ3732A"
FT                   /protein_id="ACV46704.1"
FT                   /translation="MANRFEIDGEEVLDGEVKPFGNSAHVTVPKRWRGADVKVVRTSEP
FT                   TEQDEE"
FT   gene            539918..540367
FT                   /locus_tag="Hmuk_0571"
FT   CDS_pept        539918..540367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0571"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   nph:NP4630A IS200-type transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46705"
FT                   /db_xref="GOA:C7NYP4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP4"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV46705.1"
FT                   /translation="MGEKRSNHTVYNVNYHFVWCPKSSKAKLCVPRGIEDPAQYRYTIL
FT                   EPIEDSLEASFRDVCDEYGYEILSLHISPDHVHLFLSAHPKYGPSEIVRTIKSITAREM
FT                   WEQHEPFLEEYLWGGGFWEESYYVGTAGDVSTDTIEQYIERTEHV"
FT   gene            540454..540699
FT                   /locus_tag="Hmuk_0572"
FT   CDS_pept        540454..540699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46706"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP5"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2332"
FT                   /protein_id="ACV46706.1"
FT                   /translation="MSVLSTADEGKFLMDNEAEQIGVVTEVDPDEQVAYVEPEPGIAES
FT                   VIQGFGFGSADEDDIEVPADSVETVTDTELRVATDL"
FT   gene            complement(540754..540996)
FT                   /locus_tag="Hmuk_0573"
FT   CDS_pept        complement(540754..540996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP3000A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46707"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="UniProtKB/TrEMBL:C7NYP6"
FT                   /inference="similar to AA sequence:KEGG:NP3000A"
FT                   /protein_id="ACV46707.1"
FT                   /translation="MPEEQLFKTEEQSPRAEIARALRDAADQIDSGHVTLASDTAEQRV
FT                   TVPEQPRFEVELERLTDSDSGEQRYELEYEIRWTQ"
FT   gene            complement(541189..541311)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0574"
FT   gene            complement(541395..541517)
FT                   /pseudo
FT                   /locus_tag="Hmuk_0575"
FT   gene            complement(541601..542368)
FT                   /locus_tag="Hmuk_0576"
FT   CDS_pept        complement(541601..542368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0576"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD; short-
FT                   chain dehydrogenase/reductase SDR; KEGG: hma:rrnAC2305
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46708"
FT                   /db_xref="GOA:C7NZ22"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR032884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ22"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACV46708.1"
FT                   /translation="MNEPVLLTGAGGAVGEAILGGLEDDYEWKLMFHSPPVEEPDHDYV
FT                   VGDVSDDEDVRAAVEGVGAIIHLAGDPRPDAPWNSVLANNIDGTQKMYEAAVDEGVERF
FT                   VYASSNHAVGAYEDERKPDLYRTHDDFRLDGSEFPRPGNLYGVSKATGEIIGRYYHDEY
FT                   GIDVCNVRIGNLTKGHPPIDYERGQAMWLSYRDCAHIHERALLADYDFEIVYGISDNDR
FT                   KYYSIERAKEVLGYEPQDNSAHFDGEERVADPT"
FT   gene            542459..542812
FT                   /locus_tag="Hmuk_0577"
FT   CDS_pept        542459..542812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0577"
FT                   /product="Protein of unknown function DUF381"
FT                   /note="PFAM: Protein of unknown function DUF381; KEGG:
FT                   hma:rrnAC2306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46709"
FT                   /db_xref="GOA:C7NZ23"
FT                   /db_xref="InterPro:IPR007179"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ23"
FT                   /inference="protein motif:PFAM:PF04038"
FT                   /protein_id="ACV46709.1"
FT                   /translation="MDPTDPQVACFEAGVKFGSLYHQFAGTPISPDSADSLAAAMAEAI
FT                   ENQPHCEDVTVEIREDALRAEIEDQSADYTEFTGRFAEVEMTVDYEGVAVETSMRMDGD
FT                   YPLMAVDDVDAPE"
FT   gene            542874..543884
FT                   /locus_tag="Hmuk_0578"
FT   CDS_pept        542874..543884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46710"
FT                   /db_xref="GOA:C7NZ24"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ24"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2307"
FT                   /protein_id="ACV46710.1"
FT                   /translation="MGYAALDAIDDAIDATKGFLLPFDRGTWLRLAVIMFFVTGGGGVL
FT                   NNAGNAGQFAGNGDPGTAPGAGAGTVMPDIAFGAVAIAVAGFAVLFVFLMLLASPIMEF
FT                   VFVESLFEREVHVRRYFSRNVGNGLRLLGFQIAVVLAAGVFVVGLFLVGLLVAGGLDSI
FT                   AASLGLLVLAFPLTVLLVIAIGIVNGFTTVFVVPIMLAEDRGLLSAWSRLWSSITSHLA
FT                   EYLVYLVVSVLLGIGVGIVGSIVMLFALALAAIPFGLVAFGVYTFAAFSTAGIAVYAVL
FT                   GLGFLVVALLVGGLVQAPLQSFLRYYAMLVLGGIDADLDPIPEIREGLRDDDAMQ"
FT   gene            543983..544441
FT                   /locus_tag="Hmuk_0579"
FT   CDS_pept        543983..544441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46711"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ25"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2308"
FT                   /protein_id="ACV46711.1"
FT                   /translation="MSQSTLDDDELFGEAASEMREDVEASLDEARAVLPVADDIWNVEA
FT                   DNTLGVLNALKGALDVDDAEEHLRDAKKWYTMGERADAFEDADDLEADIAALETLLEDV
FT                   ETAREQVGELTSTVPQLRGTLEEFAAEDADEETDDAEADDDAEAEAEA"
FT   gene            complement(544438..545151)
FT                   /locus_tag="Hmuk_0580"
FT   CDS_pept        complement(544438..545151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0580"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: hma:pNG7317 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46712"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ26"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ACV46712.1"
FT                   /translation="MHLSEATWTDAADLDTDLAILPVGSTEQHGPHGPLGTDVLTAEAV
FT                   AEAGAEAYDGEVVVAPAIPVGVAEEHRHFAGTLWVGEDTFRDYVRETVASLASHGWDRV
FT                   VVVNGHGGNVDALREVCGRVTRDGTAYAVPLTWFDAVDAPDMGHGGPVETSLLLSTAPE
FT                   LVRTDRLEASAANGADSWGAFEHGVNLAYDTEEFSENGTVGDPRDANRERGDALLDAAS
FT                   DALADVLASVRERDR"
FT   gene            complement(545207..545734)
FT                   /locus_tag="Hmuk_0581"
FT   CDS_pept        complement(545207..545734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46713"
FT                   /db_xref="GOA:C7NZ27"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ27"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2309"
FT                   /protein_id="ACV46713.1"
FT                   /translation="MADAPHGVDDPVDDPVDELSETEEFDSLIGIVGDGVVGAAGGLVG
FT                   TALSTVVLLIAESLGVFERSAFALLTELVGIEELVPPILAGYLIFLAGGMVPWPLLYVS
FT                   LKEYLPGRRDPVSGAFFGFAIWTGFALGFYTGQSGLALVGYAVLTLLAHVVYGVGLGLV
FT                   FEYFQSRPSSIV"
FT   gene            complement(545885..547087)
FT                   /locus_tag="Hmuk_0582"
FT   CDS_pept        complement(545885..547087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0582"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: hwa:HQ3060A
FT                   serine/threonine protein kinase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46714"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ28"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ACV46714.1"
FT                   /translation="MDRRTFLTTTCAGTAALSGCLSSLPWTSGGNTPLPEVPGGSWTQH
FT                   GADAANTFAPDVAAPSRASHAWTSAAFTRWDPVIADGTIYTTNFDPSHDGSAIALDAQD
FT                   GTERWRTTLDREGRHGRALVDGRFVVAHDSGLVALDRQGGGVDWERSVEGLETSFAELL
FT                   AVDRSTGTIVVPYADGLKAFGATDGQRRWKAPELPGQRVTPAIADGTVYAVGSVDGAAT
FT                   LAALALADGSVRWTRSLDGRSPSAPVVTDRGVLVVDDRTLVVHDRETGDRRGERHSFDY
FT                   DGTTFDATVATDGTTAFVTSDDGLTAVDIADGTTRWEYDEWVYTAGCSVGTETVVAMAD
FT                   RGEYTDRTITAFDRETGEARWDYVMDDFHTPSIPPILADGAVFFATSSSDGLVAIGDVP
FT                   E"
FT   sig_peptide     complement(547004..547087)
FT                   /locus_tag="Hmuk_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.435 at
FT                   residue 28"
FT   gene            complement(547271..548425)
FT                   /locus_tag="Hmuk_0583"
FT   CDS_pept        complement(547271..548425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0583"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: nph:NP3502A tryptophan synthase subunit beta;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46715"
FT                   /db_xref="GOA:C7NZ29"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ29"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACV46715.1"
FT                   /translation="MSDGDFAGYGGRHVPDPLVAPLEQLATTYDDIRETTAFQTELRDL
FT                   LESFAGRPTPLFHAETLSDSWGAEIFLKREDLLHGGAHKINNTLGQALLAKQAGKERLI
FT                   AETGAGQHGTATAMAGALLDLDTEIYMGKQDVERQRMNVFRMRLMGATVNEVTRGEEGL
FT                   AEAVDVALEDFAHNVDDTHYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFQDRTGELPD
FT                   AAVACVGGGSNAMGLFHAFRDDDVAFYGGEGGGEGADSERHAAPLAAGTEGVLHGMKTR
FT                   VIDDDVSVHSVSAGLDYPGVGPEHAMFRELGRAQYRGITDEEALGAFRELSESEGIIPA
FT                   LETSHGLALAKQLAEDGDHETILVNLSGRGDKDMAQAAEQFDLS"
FT   gene            complement(548499..549035)
FT                   /locus_tag="Hmuk_0584"
FT   CDS_pept        complement(548499..549035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0584"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hma:rrnAC1701 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46716"
FT                   /db_xref="GOA:C7NZ30"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ30"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV46716.1"
FT                   /translation="MASDLTLRRYDPRDAHAVWELHEWAMRVAGTDPADVPGTDDLREI
FT                   ESRYLDVGGEFLVGIGDGEDESDAAVPETFDGPVVAMGGLLPSESGHDDERTVPGAGEL
FT                   HRMRVAPPMQGRGHGRDLLATLERRAAQLGFETLLATTAVRQEAAARFYPAAGYREVDR
FT                   STQGEYELIHFEKTL"
FT   gene            549257..550291
FT                   /locus_tag="Hmuk_0585"
FT   CDS_pept        549257..550291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0585"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: hma:rrnAC1526 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46717"
FT                   /db_xref="GOA:C7NZ31"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ31"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV46717.1"
FT                   /translation="MSDTNRVFLLAERPDGRPDEDTFELAERDLPTPGPGEALVRTLYL
FT                   SVDPYMRGRMDARESYADPWGVGDPMEAAVVGEVVESNGAGLEAGTVVTGELEWADYAT
FT                   APGTELYPIDPELAPISTALGVLGMPGRTAYFGTKEIAQPTAGDTFVVSGAAGAVGSVA
FT                   GQIAGLQGADVVGFAGSDEKVQFLEDELGFDAGINYKTTDDYGAALDEAAPGGVDAYFD
FT                   NVGGPITDAVFTRLNVDARVAVCGQISQYNATELPTGPRKLATLVETRATVEGFLVGDY
FT                   QPRFEAATRQLGEWVQRGQVQYRETVTEGLENAPDAFLGLFEGENIGKQLVKVAERDVR
FT                   SRGL"
FT   gene            550527..551456
FT                   /locus_tag="Hmuk_0586"
FT   CDS_pept        550527..551456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46718"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46718.1"
FT                   /translation="MPQEDPEFGEPEFLGWLLLKRLKEQSNDQISRSKFLKLCCIADRR
FT                   LIESRGYEVGLPRYWYMYGELANEHEFSKRFYNAPLAIGWDGQQYLPKELQVEAFDVSE
FT                   EGLESIPDAARWTVREFGRKNVEEIKQYQYEKHAENEFIRKYSELRWLLSTIDLGRQER
FT                   LENYSSGGESNEEYLKRQLDEMMATYPDGEARYDDLKTLYLRWDDTVRLMVDHSVEYSR
FT                   IAEFLDDFIRTLSKAVLRFAYNQNITDERLEDWEEDAVEEREKFTTHLTTIRSELLRGR
FT                   SRSTELDQVSDAYSQTIDEQIERLLARE"
FT   gene            551457..552119
FT                   /locus_tag="Hmuk_0587"
FT   CDS_pept        551457..552119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46719"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46719.1"
FT                   /translation="MADASFLDTGVVLGFCFRDDSHHHRCREYLDDHDFVLFVSDHVES
FT                   EYLNREPSLAQEVANGIFDHIDRLHDSEFEGQLDSMDTSRIRQNLVSGNNPAGTTLHTF
FT                   YSDEVPNFIQITDLTERLRDLARDIEQIAIENRETLMTKVEVWERDNEYAEIDDKLSEI
FT                   PWDDRRICLDAHDVAEVTGKPTELATTNPTDLVDHGYRTVILERTSLENVVSLAVRS"
FT   gene            552187..552771
FT                   /locus_tag="Hmuk_0588"
FT   CDS_pept        552187..552771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46720"
FT                   /db_xref="GOA:C7NZ34"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46720.1"
FT                   /translation="MLQGATPEPAPQPSTVAIIDEFVDGILASIPRLLSGLLFLVLAYL
FT                   TIKLVLAVVRSVVDRLYRDEEQLIVDLVVTVVGIFLWFGATLGLLKVVGLGDVAASLGT
FT                   ASGFIGLGVAFALKEMIADTVAGVYLLQDEDFSEGDRVETASVTGRLVSIDLRKTRIET
FT                   DDGNLVVVANRDVEKRWTRHARADEAAETDA"
FT   gene            complement(552826..553512)
FT                   /locus_tag="Hmuk_0589"
FT   CDS_pept        complement(552826..553512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46721"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46721.1"
FT                   /translation="MTRAAVRDGFERYVNGLASETSDAFSISRALRSATGPEGAVIDRL
FT                   LSNSETVDRKIVQPELQSYRDAILHQFDAVLSYAASDDDFEAFADEILARDLYWDALRS
FT                   DVPPDRKSELRETLLARQRRMGDAVAPLVAADADSLWAAAATAYDWEATTDLIDAQFAF
FT                   TEPLHASPEAYALTIDIDPGDLLGGLARALPSITVDYTDEALRAMTQAEAFVVDRAKAD
FT                   AESHFE"
FT   gene            553592..554047
FT                   /locus_tag="Hmuk_0590"
FT   CDS_pept        553592..554047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0590"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: hma:rrnAC2166 6-pyruvoyl
FT                   tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46722"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ36"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ACV46722.1"
FT                   /translation="MAEGLSTERSDAIADAGERELVVGGDRPIRISTGHRIMHHDGKCS
FT                   RPHGHNYEVTVRVTGALTAEGWVVDKGDVTDAIDEWDHRFLVEAGDPLVDAFERSGDGD
FT                   ALVVLDHPPTAEVMAIVLEERLAESLPDTVSDVGVTVRETGELAAGP"
FT   gene            554048..554824
FT                   /locus_tag="Hmuk_0591"
FT   CDS_pept        554048..554824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0591"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   hma:rrnAC2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46723"
FT                   /db_xref="GOA:C7NZ37"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ37"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV46723.1"
FT                   /translation="MPVDADPVAERAAETPPEADALPINELFHSLQGEGKLAGVPSVFV
FT                   RTSGCNLRCWFCDSYHTSWEPSHAWLTIDEIVAEIEGYDADHVVVTGGEPLIHEETVDL
FT                   LERLDERGYHTTVETNGTVAVDAPIDLASVSPKLASSTPTPERDPTGEGDWEQRHEQRR
FT                   LDHEALATLVERYPTQLKFVVTGPDDVAEIDRTVEELRERTETTIDDADVLLMPEGQTR
FT                   SDLDETRGVVADLALEHGYRYTPRLHVDLWNDAPGT"
FT   gene            554833..555459
FT                   /locus_tag="Hmuk_0592"
FT   CDS_pept        554833..555459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0592"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: hma:pNG7382 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46724"
FT                   /db_xref="GOA:C7NZ38"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ38"
FT                   /inference="protein motif:PRIAM:3.5.4.16"
FT                   /protein_id="ACV46724.1"
FT                   /translation="MTDETTMEDAAEATNAPATVPDGEGIDWEKAQEGTRLLLESIGED
FT                   PTADGLEATWQRRVPALFETFSEANREAEKPTMRTFEADQEGLVVKTGIPVYSLCEHHL
FT                   LPYHGTAHVAYRPDERVVGLSKLVRYVRWQGRKPSMQERLTRDIADGLAAELDAAAVLV
FT                   EIEATHMCEAMRGVETATTTTTRSVVGSPTTTERERFTDAVKKHE"
FT   gene            555452..556267
FT                   /locus_tag="Hmuk_0593"
FT   CDS_pept        555452..556267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0593"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: hma:rrnAC2163 succinoglycan biosynthesis ExsB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46725"
FT                   /db_xref="GOA:C7NZ39"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ39"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ACV46725.1"
FT                   /translation="MSDERSAAADAPSGDDQSAADGPTTDAPQTTDDPDSADDSPTADS
FT                   AVILASGGMDSATAAYEAVDRGYEALYLLHTSYGQATEETERACAQALADHVDAADFLH
FT                   VETGHLAQIGASSLTDEEMAVDDADLDSDEIPTSYVPFRNANLLSMAVSYAEANDCSAI
FT                   FIGAHSEDFSGYPDCRPQFFDAFQQVIDAGTKPETEIELVAPFVEWSKTDIAERGLELG
FT                   VPYEDTWSCYRESPPACGTCDACAFRLQAFQNLGERDPVEYAERPDYTE"
FT   gene            complement(556457..556843)
FT                   /locus_tag="Hmuk_0594"
FT   CDS_pept        complement(556457..556843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0594"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: hma:rrnAC2162 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46726"
FT                   /db_xref="GOA:C7NZ40"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ40"
FT                   /inference="protein motif:TFAM:TIGR00160"
FT                   /protein_id="ACV46726.1"
FT                   /translation="MTRVALIAHDEKKPAIIDLAREYEDLLSTFELVGTGTTGKRITEE
FT                   TNLTVERKESGPVGGDTQIGAEVVDGRIDGIVFLRDPQTAQPHEPDISALLRICDVHDV
FT                   PLATTETGAVYLLDGLATETGVES"
FT   gene            complement(556895..557158)
FT                   /locus_tag="Hmuk_0595"
FT   CDS_pept        complement(556895..557158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46727"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ41"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2161"
FT                   /protein_id="ACV46727.1"
FT                   /translation="MDSDDSTVYMIRGDTGDEWVSPTPAEDVIVESLRSASDLTAAEID
FT                   DLGSYVDADELAAVVNGSDEAITFAVEGYDVTVTSDGDVAVE"
FT   gene            complement(557550..558014)
FT                   /locus_tag="Hmuk_0596"
FT   CDS_pept        complement(557550..558014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0596"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /note="KEGG: hma:rrnAC2159 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46728"
FT                   /db_xref="GOA:C7NZ42"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ42"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2159"
FT                   /protein_id="ACV46728.1"
FT                   /translation="MYKSGRFVAEALGDLRPEQVQPNGVDLTLAAVSEQVEPGRIERGD
FT                   KHVGDRTEIDPDDGVYRLEPGAYVAEYGERVAVPEGHVGFVYPRSSLMRNSCMLHTAVW
FT                   DAGYEGRGEGLLEVHHEIELEADARIAQFVLAEAAHEETYEGSYQHEKLD"
FT   gene            558278..560254
FT                   /locus_tag="Hmuk_0597"
FT   CDS_pept        558278..560254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0597"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: hma:rrnAC2158 aconitate hydratase; TIGRFAM:
FT                   aconitate hydratase; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46729"
FT                   /db_xref="GOA:C7NZ43"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ43"
FT                   /inference="protein motif:TFAM:TIGR01342"
FT                   /protein_id="ACV46729.1"
FT                   /translation="MGQTLTEKILDDHLVEGELTPGEEIGIEIDQVLTQDTTGTLVWLQ
FT                   FEALGLEEVQTELAAQYCDHQTYQFDFKNTDDHRFLRSAAGTFGAHFSRPGNGICHNVH
FT                   KENFAAPGKTMLGSDSHTPTPGGLGELAIGSGGLDVAVAMGGGAYYIDMPEVVNVRLEG
FT                   ELPEWATAKDVILELLRRLSVKGGVGKVLEYTGPGVESLTVPERTTITNMGTELGATTS
FT                   IFPTDENTEDYLSRLGRDEEYVELQPDDDAEYADEIVVDLSDLEPLIAQPSMPDNVVPV
FT                   EEVEGVDVEQVMIGSCTNGAYEDILPSAKMLEGRNVDKKTEMIVAPGSKQASEMLAREG
FT                   WTAEMMAAGVNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDSVYLCSPEV
FT                   ATAAALKGEIVDPRNLADELGDLDAPGIELPDEYIGNSESDLIAPDEAVDDELIKGPNI
FT                   GDVPLKDPLGPDIEGEALLKMEDNITTDHIIPATADILKFRSNIDKLSDFTLSRVDDTF
FT                   AQRAKDNDGGVLVAGENYGQGSSREHAALCPMYLGIDAVLAQSFARIHKANLFNFGIVP
FT                   LEIDADTYEQIEQGDDIEIVTDVADAIQSGETEFTIRVNDDWEASATLDASDRERRFLA
FT                   SGGKLTHTKQQYEDDSGAAPADD"
FT   gene            560484..561650
FT                   /locus_tag="Hmuk_0598"
FT   CDS_pept        560484..561650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0598"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hma:rrnAC1899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46730"
FT                   /db_xref="GOA:C7NZ44"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ44"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV46730.1"
FT                   /translation="MGTFRSVTEDERATHQRIKDHVWGEGGVPDPDETVPRALGERWAY
FT                   VEDGRFRSICALLEIDVRLAGEWRTIGGIRGFVTPPEHRGQGYGRRLLRGAVAEFADRG
FT                   LSYAVLWPASIDYYRERGWGLVHTETAYAFPPEAMADPGPAGRFERVGPDDFGRLEAVW
FT                   ETEASDYELALRRTGQWWRERVLDDAWAYTWTPDGDDEPAGYVVYRLNRDAETLTVEEL
FT                   AVRSERARRQLLGFLERHAPQADRVEWTCPRERRLLREAADPDAVEASVEPGASGYVVD
FT                   VPAAIETLPAERGPAKAVTIEVTDPLAPRNDGQFRVEPDMTCRPLETGATIDDPGLVVD
FT                   AAVLAQLYVGTLSIETAAAREIVTATDDAVAALSETFGARDVYVSDFF"
FT   gene            561958..562449
FT                   /locus_tag="Hmuk_0599"
FT   CDS_pept        561958..562449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0599"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: hma:rrnAC2157 Pab N-terminal acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46731"
FT                   /db_xref="GOA:C7NZ45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ45"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ACV46731.1"
FT                   /translation="MTTVPDSDTEPPTVRPATRSDLLAVHRIESASFPQPWPFSAFESY
FT                   VGEPGFLVAVDERDDDPELLGYVVADTVPNHGTPLGHVKDLAVEEAYRGQGIGRRLLRR
FT                   AIDVLEDAGTGSVKLEVRVTNTAARSLYRSFGFEHRRTIPNYYGNGEDALVMIRALDDG
FT                   "
FT   gene            562488..562874
FT                   /locus_tag="Hmuk_0600"
FT   CDS_pept        562488..562874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46732"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ46"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2156"
FT                   /protein_id="ACV46732.1"
FT                   /translation="MGYACPVCEEPQADAGHLANHLAFTALTGGDDHEDWLDEHVPEWG
FT                   EFGEDELAAEVIELADETEFPFEADGHDHQHEHDHGHEVDPQQARQRATGELDDEAESI
FT                   LREAREMTESMHDEDDTSDADETE"
FT   gene            562898..563311
FT                   /locus_tag="Hmuk_0601"
FT   CDS_pept        562898..563311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46733"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ47"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2155"
FT                   /protein_id="ACV46733.1"
FT                   /translation="MHTEGTFLPETAREARERYEALGSTAQVVVKAVAKSMAFDSEEYD
FT                   ERVTSDVVETAREAMFGEELAVRVGTAAEFEEWRETADHEVEVFGADNVDAVAWHAPPF
FT                   AETAVAATFQEEEAAAVATLRRQAVARIYQDVV"
FT   gene            563311..563748
FT                   /locus_tag="Hmuk_0602"
FT   CDS_pept        563311..563748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46734"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ48"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2154"
FT                   /protein_id="ACV46734.1"
FT                   /translation="MRTVTRNLLLGIGVVLVLLLALGAAPSLLRSGDPYYVSATPVGEV
FT                   DANETNVTSGPNATAVGGDALSERTHPFTTTAIADAGANQTGYSEPYWRGPVGIKGAFT
FT                   HSPFDELAALRQRNPRAADGESVRLAHNGTLYRIGVTQDRA"
FT   sig_peptide     563311..563406
FT                   /locus_tag="Hmuk_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.398 at
FT                   residue 32"
FT   gene            563745..564311
FT                   /locus_tag="Hmuk_0603"
FT   CDS_pept        563745..564311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0603"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: hma:rrnAC2153 Mut/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46735"
FT                   /db_xref="GOA:C7NZ49"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ49"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV46735.1"
FT                   /translation="MSPDSNPDPSRQPSHEWPIVDSETEYETGWYTGGYDRVQQPDGSE
FT                   KSYYWAELPDAVVVVARSGDELILVDQYRPTIREQCLELPAGIVEDGESYTEAGRRELR
FT                   EETGFDAAGISLLEEFWCSTGVLRHRRGIVFAEGLEPVESDLDDNEFLTVTTVPIADAL
FT                   DVARREPANDATIEGVLLARAEGLL"
FT   gene            564308..564871
FT                   /locus_tag="Hmuk_0604"
FT   CDS_pept        564308..564871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0604"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: hma:rrnAC2153 Mut/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46736"
FT                   /db_xref="GOA:C7NZ50"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ50"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV46736.1"
FT                   /translation="MSRRHPWNRPDPEWPVHESVVVWETPFFEAGYDTIERPNGDLADY
FT                   YWLEPADAVIVVAPTAEDELVFVEQYRPRFRMRSLGLPAGGIDDGEEPIEAAHRELREE
FT                   TGYRAEELSYVDSYVPSGWTRYVRHVFFATGLVAGEPDPDEGEVIETLTVPVDEAVDVL
FT                   RSREGPVNGFALTPILLAREDGLL"
FT   gene            564959..565339
FT                   /locus_tag="Hmuk_0605"
FT   CDS_pept        564959..565339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0605"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: hma:rrnAC2152
FT                   putative rhodanese"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46737"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ51"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACV46737.1"
FT                   /translation="MDGEIGHEELETILENGADARVVDIRSPGAYERGHIPGSENVPLQ
FT                   QLVDDIEQFDGAERVVTVCPHGKSSVQAARLIASYEGFSGRAESFGPGLASWDGPIESG
FT                   RGEGEADEDAGAPADEGPDAPF"
FT   gene            565391..566137
FT                   /locus_tag="Hmuk_0606"
FT   CDS_pept        565391..566137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46738"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ52"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2246"
FT                   /protein_id="ACV46738.1"
FT                   /translation="MTVRHDGLAVEWLGYATIRLAGEETVVYFDPGRYGVLTGEWEPDE
FT                   AGLNHPPGRDYRPEDGDVICVSHVHHYDPDGIERVASADATVVAFEGIDGQDRERGLAP
FT                   ITELPYELRTVDATTNLTVDGVSVWSTPAHNEPDGPHTRPDGTPYHPEGFGCGFLVDVE
FT                   GTRAFWPGDTDVLPGHRSVDVSLFCPPIGQRFTMDRREAARLAATIEPNLVMPVHYNTF
FT                   STLATDSRAFAADVAAAGVPVVLDEQ"
FT   gene            566323..566883
FT                   /locus_tag="Hmuk_0607"
FT   CDS_pept        566323..566883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46739"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ53"
FT                   /inference="similar to AA sequence:KEGG:rrnAC1052"
FT                   /protein_id="ACV46739.1"
FT                   /translation="MDRSAESFAEALASGDSDSVNEAIDEIEAVESALRVEQYGALFDA
FT                   CHPVYESDDGYVRQSVVRFLRDAYPMLELTIAASERERVDGYTIGDLRENRTRLVEFLL
FT                   DALGDDDGRVRRAAVDGFDTLGVAIDLAEIDAEKRVLLDELDDLADDLPEEKAKHAEEA
FT                   RQSVARMGLVGSLVGDLDLDVPR"
FT   gene            complement(566946..567683)
FT                   /locus_tag="Hmuk_0608"
FT   CDS_pept        complement(566946..567683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0608"
FT                   /product="protein of unknown function DUF91"
FT                   /note="PFAM: protein of unknown function DUF91; KEGG:
FT                   hma:rrnAC2933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46740"
FT                   /db_xref="GOA:C7NZ54"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ54"
FT                   /inference="protein motif:PFAM:PF01939"
FT                   /protein_id="ACV46740.1"
FT                   /translation="MTTHGDATETLSDPDFDAAGDLVERGIDAGALVTLFGRCRVDYDG
FT                   RATSTLGPGDRHVMLKPDGAALVHTDEGQQPVNWQPPGCEHAVRVVDGEFVVESERSSP
FT                   DELLSIAFESLSHVGVFDVTDATDLSLTGTEEDLRERILDDPDLLEPAFTPLATERSTP
FT                   AGAIDIYGEDADGRTVVVELKRRRVGPDAVGQLDRYVQALGRDLHDEAEIRGLLVAPSV
FT                   TDRARELLAQKGLEFVSLAPPEE"
FT   gene            complement(567696..568247)
FT                   /locus_tag="Hmuk_0609"
FT   CDS_pept        complement(567696..568247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:pNG6131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46741"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ55"
FT                   /inference="similar to AA sequence:KEGG:pNG6131"
FT                   /protein_id="ACV46741.1"
FT                   /translation="MAHRALVAYRDGDGYRLHYAHRGTGLAAAITPETPFGGRRDRSRP
FT                   PPVPDRIAHQFDLASSRDDAVGTRVDPRPLARRLDPADVLAAVDPTIESLVVVGPADET
FT                   STYLVCPLGLDGGEPLAVAGPTADEERLRRTLVTAKDRLGERVDDGALSPERARRALWQ
FT                   TLARLAPLYPIDDASFLRPD"
FT   gene            568344..568631
FT                   /locus_tag="Hmuk_0610"
FT   CDS_pept        568344..568631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46742"
FT                   /db_xref="GOA:C7NZ56"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ56"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2931"
FT                   /protein_id="ACV46742.1"
FT                   /translation="MLGTEWVYAAIAGLLFAHLLTLLYAYRSNRSEPAADSVSDAAAVE
FT                   VADRADRSVCRCPECGTENDRAYRFCRQCVSELPSARLHVEHPSEQQQPY"
FT   gene            complement(568680..569294)
FT                   /locus_tag="Hmuk_0611"
FT   CDS_pept        complement(568680..569294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0611"
FT                   /product="transcription anti-termination factor"
FT                   /note="KEGG: hma:rrnAC2075 transcription anti-termination
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46743"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ57"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2075"
FT                   /protein_id="ACV46743.1"
FT                   /translation="MDADTFVERVRADSATKLDRLGSEKVLLAATDATLEPAAVRATLS
FT                   GREAGRRAVFDAWAGETDGPAADAFERASERAATRHGTLSAELDESPTETAWPVVEHLR
FT                   GLGADAERAGALVATGLVGDRTALQAINFFVNEGDDATADACRTVRSSYGEDADDGAAL
FT                   VVELGAQPDRAQRAAAETIAVAYEDYARRLDAMGLDPRPVC"
FT   gene            569377..570546
FT                   /locus_tag="Hmuk_0612"
FT   CDS_pept        569377..570546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0612"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: hma:rrnAC2076 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46744"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ58"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV46744.1"
FT                   /translation="MSESYPDPPVEPATITPETLAGRLADGERVRLLDVRDRDEYERWH
FT                   IAGPSVTATQHSFAKALQAQVRGSVDELAAQVAGEGPITVVCARGEASAYVAGLLTEAG
FT                   VDAHNLAGGMDGWARVYEAHELDADEATIVQYQRPASGCLGYQIVADGVAAVVDPLRAF
FT                   ADRYAADATRLDATIEYVIDTHVHADHVSGLRSVAAATGGEALVPARAHERGVVGTVGT
FT                   LADGETRSLGETTLRAVALPGHTTGMTGVAVGDVLLTGDSLFLESVARPDLEASDDAAA
FT                   FARELYATLTERLDAFDDETLIAPGHVGERTVRNDDGSYAATLGQLRERLWAFAVDEAT
FT                   FVERVTENVPPRPANAEAIVAANLGRRTPSDDDAFEWELGPNNCAATAE"
FT   gene            complement(570717..571010)
FT                   /locus_tag="Hmuk_0613"
FT   CDS_pept        complement(570717..571010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46745"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ59"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2078"
FT                   /protein_id="ACV46745.1"
FT                   /translation="MRAKPEYRDRPDTQVAVLDALGDRPEDGMTVFELRSRVDADIDHL
FT                   EDALAELKADALIEVTRDGERTVFSPQSGVVGEHEPTDEESLVDVIRRRFSL"
FT   gene            571128..572024
FT                   /locus_tag="Hmuk_0614"
FT   CDS_pept        571128..572024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46746"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ60"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2081"
FT                   /protein_id="ACV46746.1"
FT                   /translation="MSLKCSVLGHAYGETTVERDREEQGSEVVITIREVETCERCGTER
FT                   VVSENKEVTAIETPDDTETAASEGEAATTDAESESESDTAREEPSDEEDDVEDDDTEDV
FT                   PAAGEELSASEIVGGEETPSTPEAEAEPDTGAEIIDAESDEPVSEEAVDEELADPTVDP
FT                   EIDEQDGDEQLGGGAPAVDTEEIDADDPDADDAMIIDEDDDDPVEQGDRQPGEWPEEPD
FT                   TGDDEWQPDTIGTIDEDDEEQATETTTLTVPDGQFRCPECDFTTLVESSSLRRGDFCPE
FT                   CHRGTLVHEPEDETRKE"
FT   gene            572066..572443
FT                   /locus_tag="Hmuk_0615"
FT   CDS_pept        572066..572443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46747"
FT                   /db_xref="InterPro:IPR040713"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ61"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2082"
FT                   /protein_id="ACV46747.1"
FT                   /translation="MRRGEHLEDRVPDMEAFVEDYFGEITDTQERKGSDLLVVDDPDNP
FT                   VFERVVAGTVEYSGKKDKLALHIDERDAEDVIAEGNADAAQEAVTAKNDFLEEATGRDA
FT                   KARRDSMKRSVEDDADKPDSV"
FT   gene            complement(572754..573521)
FT                   /locus_tag="Hmuk_0616"
FT   CDS_pept        complement(572754..573521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0616"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: hma:rrnAC2083
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46748"
FT                   /db_xref="GOA:C7NZ62"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ62"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV46748.1"
FT                   /translation="MNRTATQLLTLVRREVLRFVRRPYNTFLPPIITNALYFAVFGVIL
FT                   GSRIGEIAGVSYIQFVLPGLVVLGAISDSFENASFTIFHGRWNEYIQAVTTSPMSHRSV
FT                   VAAYVSASALRGIVTSLLIVGVGLVFTSVSVAHPLYLIAFVLVITTLFGGLGVIGGLWA
FT                   SDFDYLTVMNQFILRPLVFFGAVFYSLEVLPPLWRTVSLFNPMVYMVNGVRYGMIGVTE
FT                   IEPTTSLLVLTGAAVAVLAVDLALFKRGYGLTE"
FT   gene            complement(573518..574477)
FT                   /locus_tag="Hmuk_0617"
FT   CDS_pept        complement(573518..574477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0617"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hma:rrnAC2084 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46749"
FT                   /db_xref="GOA:C7NZ63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ63"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV46749.1"
FT                   /translation="MTAPAIRTRELTKRYGDVQALAGLSLTVESGEFFGLLGPNGAGKT
FT                   TFINTLVGLVDADGGEATVFGHDVEDDYREARDAIGLAPQEYNVDRFFPIHEVLEHKAG
FT                   YHGVPEAEAEERAEDALKTVGIWDKRDTRFDWLSGGMKRRFMLARALVSNPDLLILDEP
FT                   TAGVDVQLRHDLWEIINRMNDGGTTILLTTHYIEEAERLCDRVAIVDDGRKVEVATPDE
FT                   LMERGTDTVEIGLESPPATAPTLSVEGARDARMEDETLLVSAAGGSSLAPAIMRELEAA
FT                   GHTVTSLDVRRASLEEVFVDMTRADHGGDTEVEMEVDA"
FT   gene            complement(574580..574936)
FT                   /locus_tag="Hmuk_0618"
FT   CDS_pept        complement(574580..574936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0618"
FT                   /product="Protein of unknown function DUF1621"
FT                   /note="PFAM: Protein of unknown function DUF1621; KEGG:
FT                   hma:rrnAC2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46750"
FT                   /db_xref="GOA:C7NZ64"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ64"
FT                   /inference="protein motif:PFAM:PF07783"
FT                   /protein_id="ACV46750.1"
FT                   /translation="MGLMSKILGESGSSRATEDYVELSADDLDDAVEVDRQVRIARIGE
FT                   KQDVVEIKDAVYDGDIVVADITRHSTQDRTMEHITDELKRVVNEVGGDIVQKDDDQLII
FT                   TPAGVAISRERLGQ"
FT   gene            575043..575774
FT                   /locus_tag="Hmuk_0619"
FT   CDS_pept        575043..575774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0619"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   hsl:OE4714F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46751"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ65"
FT                   /inference="protein motif:PFAM:PF06267"
FT                   /protein_id="ACV46751.1"
FT                   /translation="MTFSICVREEYTDEEGDEQTRFGVAVTTRLAAVGTLCPFVSENGA
FT                   VATQSRVNVDLGRRGIDYVDDGLAVEDALQSLLDADDGKAERQLHGVDADGEFAFSGGE
FT                   CGEWFGHEVGDDYTVAGNLLTGADVLTATATAYEEGRDGDAPLAERLIDALEAGHAAGG
FT                   DKRTELEVQSAALLVATTEDRPADPYYDDLRVDATETPIEDLRETYELARESYEQALAR
FT                   AAERADDEDERSGEEPDGGES"
FT   gene            complement(575815..576555)
FT                   /locus_tag="Hmuk_0620"
FT   CDS_pept        complement(575815..576555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0620"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   hsl:OE4633F hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46752"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ66"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ACV46752.1"
FT                   /translation="MRRSLPAVAVLATLVLLSGCTGALGAGDSAQTAATDNRTVDVGAT
FT                   GAVSAQPDQAVVRVGVETRAGDAATARQQLADNVTQLRDALADIEGAQVRTNGYDIGQD
FT                   YRRPPSETEDPEPRYVARQSFEITINDTSKAGSVIDTAVANGANDVDNVEFTLSADRRN
FT                   ELEEQALEGAMDRAETKATTIAERADLTIEGVETVTTVDRGYRPYAAEATATAAGDGAS
FT                   TDIDSGPVTVTAQVKVTYEAAESA"
FT   sig_peptide     complement(576478..576555)
FT                   /locus_tag="Hmuk_0620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.832 at
FT                   residue 26"
FT   gene            complement(576620..577903)
FT                   /locus_tag="Hmuk_0621"
FT   CDS_pept        complement(576620..577903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   nph:NP0578A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46753"
FT                   /db_xref="GOA:C7NZ67"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ67"
FT                   /inference="protein motif:PFAM:PF04087"
FT                   /protein_id="ACV46753.1"
FT                   /translation="MRLVQVTIPAGKRDAILRALDDEGIDYVVNDETSGREYTGVAYFP
FT                   LPSAAVEPVLEQLRAVGIDEDGYTVIVDANTVISRQFDELQERYDEEEDEDRIAREELT
FT                   ARASDMAPAFSTYVVMTVVSALIATAGLLLDSPAVVVGSMVIAPLIGPAMATSVGTVMD
FT                   DQEMFRRGVKLQLIGLVLAVVSAGLFAFLVRSVHLIPPLADVTSIPEIRERVAPDFLSL
FT                   VVALGAGVAGVVSLSSGVSTALVGVMIAVALIPPAATVGIGMAWGQPLVSLGSAVLLAV
FT                   NVLSINLAALVVLWYKGYQPSQWFRTDEAKSATASRIGVLVVSILVLSAFLGGVTLDTF
FT                   ERASTEEQIRSEAGEIVAEAGATMLEIEVQQTNTAVFQQPTRVVVTVGVPPGETFPTLA
FT                   DDIDAVADRIADRDVTTEIRFVTVDQAG"
FT   gene            complement(577973..581146)
FT                   /locus_tag="Hmuk_0622"
FT   CDS_pept        complement(577973..581146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0622"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Carbohydrate-
FT                   binding family V/XII; SMART: PKD domain containing protein;
FT                   Carbohydrate- binding family V/XII; KEGG: hsl:OE2206F
FT                   chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46754"
FT                   /db_xref="GOA:C7NZ68"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ68"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACV46754.1"
FT                   /translation="MRHTRRDLLRKASALSALALGASSTAAAHSGHCDAPDWDSSATYS
FT                   GGDQVVYDGALWTAEWWTQREPDADLGAWTREHDCDEENEEPTASFTMDVRSPAPGETV
FT                   SFDASASSDADGSIASYEWDFDDGDSATGETVTHSFDAEGEYTVTLIVRDDEEAPATAT
FT                   KTVAVGEGSNVAPDASFTVDPAEPDTGETVSFDAAGSSDSDGSLASFEWDFGDGATATG
FT                   ESVTHTYETADDYTVSLTVTDDDGASDSNDTTVTVSGTGSDGGSCDGVDAWDADATYTG
FT                   GDQVTYDGDLWEASWWTSGDEPGSSEYGPWENEGACGDTNEAPTASFTTDASAPAPGED
FT                   ITFDASESSDADGSIASYEWDFGDGSAATGEVATHGYADAGDYTVTLTVSDDAGATDST
FT                   STTVSISDADNPTQITIDSSIDGWLGAEPAAIEGERNPTISLTSGESYAFTYNNVDGIP
FT                   HDLVIRNAAGEELLATERVGQEGQSRTLEFEATEEMVEYICTVHPESMVGDLAIDGNAP
FT                   PMAGLTIDTANPDPGQEVSFDASESSDADGSIASYEWDFGDGSTATGETASHTYAEAGE
FT                   YTVELTVTDDGGASAVTSTDITVGSVNEGPTASFSVDPASPAPGEQASFDASESSDPDG
FT                   SIASYEWAFGDDSTATGETASHTYAGSGAYSVELTVTDDGGATATTTTTVQVGDGSDIT
FT                   ASTTLEEFYPAYDEDFNPTYTEGGVQGLLKNELNGDASEYGADVDAIQNNAGDGSMQLG
FT                   ALGDRGLELVKQFDAAGVPRENNARIMPWVVGLPEETEPIPFNDGGGRDGGLTADAGPV
FT                   AANNDPSVLVQDAWPSGEQFDDDYLQPDRVEWSSGVSDSQYNNTDNPIIEATTEKVHPV
FT                   TGESLGDGFTANAPVEATAELHGDGWLFDTSLIFENRTEVPLLIDGAIMWYVAPSKEAT
FT                   GLDQFSYDNAQRKNFSVGHPQRDVIEVALPDGAKPGPFEGTDAPLSAYAIRVTHHDNPY
FT                   MYRVLYPNQKFSMTYGNVTGPSQYDWPVDDLVDVMLDTLHLEFRTQMDSLEQNTELVDA
FT                   LDMRNRYGN"
FT   sig_peptide     complement(581060..581146)
FT                   /locus_tag="Hmuk_0622"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 29"
FT   gene            complement(581340..582587)
FT                   /locus_tag="Hmuk_0623"
FT   CDS_pept        complement(581340..582587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0623"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rxy:Rxyl_0394 oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46755"
FT                   /db_xref="GOA:C7NZ69"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ69"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46755.1"
FT                   /translation="MATNRLGVGFVGAGFITREFHAATFERIRDADVTGVMNPTVSKAE
FT                   AVADACREAGSGDPIATGDVRELVGHEDVDAVWVTSPNHTRVETVEAIVEEIQQGGADL
FT                   AGIAMEKPLARTVGEAQRIVDLVEETELNHAYLENQVYMPGVDRMKELLWDSAEGAGRP
FT                   YLARSAEEHAGPHSSWFWDPERQGGGVLSDMMCHSHKVNRHLLSRPGEDDLEPIAVTCD
FT                   ISTLKWGRDDYAAELAAEYDVDYHETPGEDYASASVFYETPEGDLVVGEATNSWCFVGS
FT                   GLRITIELLGPEYSGTINTLESGTDVFFSDRAAEGAGYVVEKQAADRGKMPVLPQEGAT
FT                   YGYLDQNEHVVSAFRAGENAREDLRDGLDVAKLVAASYLAAERGERVDFDDADLADYVP
FT                   EPARGEFAAGPAGVER"
FT   gene            complement(582654..583802)
FT                   /locus_tag="Hmuk_0624"
FT   CDS_pept        complement(582654..583802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0624"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   tpd:Teth39_0590 oxidoreductase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46756"
FT                   /db_xref="GOA:C7NZ70"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ70"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46756.1"
FT                   /translation="METVTIGIIGAGNRGEEHIRKYRGVDGATVKAIADIDTEAAGELA
FT                   DEFGIPDVYEDFEAMLDDPEIDVVNVCVHNNLHEPMAVAAFEADKHVFCEKPLAGSYTD
FT                   AENIVDAANAADKLLAVQNVELLTPETQAARTFVESGDLGEVSFARSVYSRRRGRPYVD
FT                   GYGTPAFVSKESAGGGPVFDIGTYEIGRNLYLLGNPAVERVNGQTFDYTDDSLGEELTG
FT                   DNAELYRKRLEESGHDVEDAGTGAARLADGSRLEVRAAWHAYQPDERGVVVGSQGGIAF
FT                   DPVELLTTMNDYETTVEIDVDGFETRHGLIRGESGYEVDERPNQYDHFVAAVRGEVDQI
FT                   RTDEIALNSMLVMEGIYLSAERGREVTAEEIAEASVSRSIDL"
FT   gene            584009..584626
FT                   /locus_tag="Hmuk_0625"
FT   CDS_pept        584009..584626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0625"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hma:rrnAC2378 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46757"
FT                   /db_xref="GOA:C7NZ71"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ71"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACV46757.1"
FT                   /translation="MFEQRPNRDSEIVLVGRSNVGKSTLMREITGHSVDTGQKPGVTRK
FT                   PNHFDWAGPDFMVTDLPGFGFMNGVPEDVREQIKTDVVRYVEANADKILVGILVLDGKA
FT                   AVDIIDRHSGPDEIPHDVELFHFLRDVDVEPVVAVNKMDKVDDEEERLNDICDRLGLYP
FT                   PWQQWQETIAPISAKRGTVDALDEAVRHHLHEAGRDDLFQFF"
FT   gene            complement(584671..586680)
FT                   /locus_tag="Hmuk_0626"
FT   CDS_pept        complement(584671..586680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0626"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: hma:rrnAC3361 HTR-like protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold-4 domain protein; SMART: ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46758"
FT                   /db_xref="GOA:C7NZ72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ72"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV46758.1"
FT                   /translation="MDDLLSDPTTVLVVGGRERAVAQVRSGSAGSFDEVVVVVDSVEAA
FT                   LATLSDRRDVGCVLVTAAPTDASVVEACERIHAVDEHRPILLSLDDSAGRTAARATQVG
FT                   ASEIVLDEDDLPDRLAAAVDRYERRRDQAAESSMFRAILDGVEGAVYVKDRAARHLRKS
FT                   TSPGDFSSEEFIGKTDVEVYGESDNTLASYEDDLRVIEEGEPIYDKEASYTTPDGTHWS
FT                   WTTKLPWKHDGEVVGLVGWTRDVTEIVERRERLKCQDERMEEFVRSIRHDVKSPIQIAS
FT                   GRIALARETGDVTTLEQASEAITRIDEILDDLTQTVLENSSLSPEGVGVGQSSPVSLSD
FT                   LLEDVWELVGFDAASLEIEFGADAVVNAPRSSIRPVLENLLKNAVDHGCSGVTVRVGPL
FT                   PSGGLYVADDGPGIPEAERERVLEDGYTTTRTGTGTGLSIVTNIAEQRNWELSLTESWA
FT                   GGARVELRNALVVSDPSVVPTAEETFSLTDGIDVGDVIVAGESTLEGDEWHVSGSGKNI
FT                   YGEWNEFHFRCASVDGPVRIEGQFTDLDGANEWSTAGLMIRDGLDDEASYGHVGLTAGH
FT                   GTKIDWRTSRGEGGTTRHLEESSLDAPWYRLDRVGDTLTIYCSTDGRSWRPLDQRRVEL
FT                   TDPVRVGTTVCSVQPEELARSTVEHLTVTRLDPE"
FT   gene            complement(586966..587259)
FT                   /locus_tag="Hmuk_0627"
FT   CDS_pept        complement(586966..587259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0627"
FT                   /product="translation initiation factor SUI1"
FT                   /note="TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   translation initiation factor SUI1; KEGG: hma:rrnAC2445
FT                   translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46759"
FT                   /db_xref="GOA:C7NZ73"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ73"
FT                   /inference="protein motif:TFAM:TIGR01158"
FT                   /protein_id="ACV46759.1"
FT                   /translation="MSEVCSTCGLPEELCVCEDVAKESQEINIRIDERRYGKEVTIIEG
FT                   FDPSDVDMDSLSSDLKSKFACGGTVEDGQIELQGNHTGRVEDFLRDKGFNVA"
FT   gene            complement(587303..589513)
FT                   /locus_tag="Hmuk_0628"
FT   CDS_pept        complement(587303..589513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0628"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; SMART:
FT                   transglutaminase domain protein; KEGG: hma:rrnAC2444
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46760"
FT                   /db_xref="GOA:C7NZ74"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ74"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACV46760.1"
FT                   /translation="MSTAGRLGLGWPAVDGVPGRTRTAALVAVAAMLLSTLQVLYFFID
FT                   VVGLPSRFLAVVAASLVAATVLARLLPPRSAVALGGVLLLVGLWWYVQQLSGSPRIGEL
FT                   LTDTLSLLTGNTLLRITNIRAWVLGVTPAPTFLTWYFAMRRRYALSVAAAGGTLGFLVL
FT                   TGDADLLTTLSGVVAAVAALGFGDFDRRGEPIVDAETILVTAALMVVVPSLVSVVPATA
FT                   GLSLNVDGTGSDTVEASLLQSGDQLSVQGSISLSPEVRFTVTSSEPRYWRIGSFDRYTG
FT                   DGWVSQTNSRAYGGDRLDEPPGPTRIVEQRFRAETDAGVMPAAWKPIQSRGNPATRVGG
FT                   DGGLATGAPIREGDSYRVTSAVPAATPAQLNDTTRAYPARVNETYTQLPASTPDRVGER
FT                   TERLTRDARTPYETALTIENWLENNREYSLDVRRPDGNVADAFLFEMSAGYCTYYATTM
FT                   ATMLRTQDIPARMAVGYTSGERVAEDRWVVRGQNAHAWVEVYFEEYGWVRFDPTPASDR
FT                   ESARDRNVESARERDRPSVDTNESGGPEWSPTPTATPQPLTPVDNDTDAGGTPLGPQSR
FT                   PGVNPEDSISTATRVGESPTDTVGATTDRPGPTSSLPSRREAALGLLAIVGTVIGVRRS
FT                   DLGRRVYRGVWLYYQPRSTPERDAERAFQRLVYHLGREHDRPRRAEETVRAYLDAVDAD
FT                   ERAREVASIRERARYAGTVDEAAADRAVSLVDEIVRSRGTAK"
FT   gene            complement(589510..590487)
FT                   /locus_tag="Hmuk_0629"
FT   CDS_pept        complement(589510..590487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0629"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   hma:rrnAC2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46761"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ75"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACV46761.1"
FT                   /translation="MRPTRRGAATLAVVGLAVTMAWLSGPRSLNAVAAPLSIALAVGAL
FT                   QVTRAGAPTVERSQPRRGFPGESRTVSLTVEGRGVATITEGLADGLSAAAEFERTLPAT
FT                   VSYDLRYDARGVYELSRTTVAVRDVLGLVEQRHEVTERTEVVVYPAVYSLGGATFERTL
FT                   GLDSGQRSEFDRLREYVPGDSLRDVHWKSSAKHDDLLVTEFSDPVGGEGISIAARSTEG
FT                   HADEMAAGAATVLVGALRAGLTTAMTVPAGSIEAGGGQRHRQRALELLARTSSGDVDET
FT                   AWNRADVRVRADATGVTVSLGDAVHELTELTTTRDNPLVAEGVS"
FT   sig_peptide     complement(590386..590487)
FT                   /locus_tag="Hmuk_0629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.575 at
FT                   residue 34"
FT   gene            complement(590484..591446)
FT                   /locus_tag="Hmuk_0630"
FT   CDS_pept        complement(590484..591446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0630"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: hma:rrnAC2442 methanol
FT                   dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46762"
FT                   /db_xref="GOA:C7NZ76"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ76"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACV46762.1"
FT                   /translation="MTDTDTSRGSHSDSALGEANRVATQVIENVERVIVGHHEEIEHIL
FT                   TAMLGRGHILLEDVPGVGKTMLAKAVAASFDGSFKRVQFTPDLLPSDVTGVNVYNQQTE
FT                   TFTFQEGPIFANVVLGDEINRAPPKTQSALLEAMEEEQVTVDGDTRDVPDPFTVIATQN
FT                   TVEQNRTYALPMAELDRFMKKLHLGYPSADDEAAMLARVVSDHPIERLSPVASVEEFRR
FT                   AQRTVSDVTIEAPLREYATRLARYTREHGQLGVSPRGSIALLRAAQARAVLDGRDYVVP
FT                   DDVRAEARVVLPHRIRTDTAEQTGAGLVRTALDTVPIEE"
FT   gene            complement(591650..591904)
FT                   /locus_tag="Hmuk_0631"
FT   CDS_pept        complement(591650..591904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46763"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ77"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2441"
FT                   /protein_id="ACV46763.1"
FT                   /translation="MSDDASLTDFVGDATDDEPRDESSTSGNEQAGDDGGRVSPDGVEP
FT                   AVTTAAWSPDGEPCCRCGASVSYRWQGEDGLVCPDCKEW"
FT   gene            592007..592363
FT                   /locus_tag="Hmuk_0632"
FT   CDS_pept        592007..592363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0632"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46764"
FT                   /db_xref="GOA:C7NZ78"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46764.1"
FT                   /translation="MPATVRRDALLAALASAGLLALLVAERAVDALTAPAAIASGVAVA
FT                   LLVEVAFLRSTAVARLWTRPAIQLGSAGGLLAVGLAGYALAGPLVVAALSWGLVTYFAL
FT                   LCVLLASGRRPTTE"
FT   sig_peptide     592007..592093
FT                   /locus_tag="Hmuk_0632"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.443 at
FT                   residue 29"
FT   gene            592415..592534
FT                   /locus_tag="Hmuk_0633"
FT   CDS_pept        592415..592534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46765"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ79"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2316"
FT                   /protein_id="ACV46765.1"
FT                   /translation="MIDGSTCPNCGGHVSTTNGTDYECDDCGSEFDTADLFLP"
FT   gene            592568..593062
FT                   /locus_tag="Hmuk_0634"
FT   CDS_pept        592568..593062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0634"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hma:rrnAC1887 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46766"
FT                   /db_xref="GOA:C7NZ80"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ80"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV46766.1"
FT                   /translation="MSDGHVRPAEHDDISAIQRVARETWHAAYDPVLGPEAVDATVEEW
FT                   YAESVVADGIANDATAYLVAVDDGVVGYAFGGQIEADLAGLSAIYVQPDRWGAGIGHRL
FT                   FVALTDRLRERGPERLQIRVLAANDRARTFYERHGATLADRQQITLAEVPVDKVTYERP
FT                   L"
FT   gene            593119..593192
FT                   /locus_tag="Hmuk_R0011"
FT                   /note="tRNA-Phe1"
FT   tRNA            593119..593192
FT                   /locus_tag="Hmuk_R0011"
FT                   /product="tRNA-Phe"
FT   gene            593483..594859
FT                   /locus_tag="Hmuk_0635"
FT   CDS_pept        593483..594859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0635"
FT                   /product="MCM family protein"
FT                   /note="PFAM: MCM family protein; magnesium chelatase ChlI
FT                   subunit; ATPase associated with various cellular activities
FT                   AAA_5; SMART: MCM family protein; KEGG: hma:rrnAC2318 MCM /
FT                   cell division control protein 21"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46767"
FT                   /db_xref="GOA:C7NZ81"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ81"
FT                   /inference="protein motif:PFAM:PF00493"
FT                   /protein_id="ACV46767.1"
FT                   /translation="MDALSKQVSGLREERHDEREQRDELEDELDARDERVDELEAEVAR
FT                   LDARAVVKEESDYDDVDADEHRKEIEAIALQLFGGWAHEYPDGSRDRGDWHMLLLGDPG
FT                   CGKSTFLRYVDQIAPRSTYASGKGATAAGMTAAAVADDFGDTEWGLEAGALVLADGGIA
FT                   CVDEIDKMQSDAVSSMHDALESQQVHVNKAGINATLNARTSLLAAGNPKNGRFERYRPK
FT                   GEQIDMGPTLLSRFDLMFMMSDQPDREDDAEVVEYMLQSRQAAGRHTRGEELSDEEQQR
FT                   VEPAIDRAVMRAYVAYAKQTCRPIIEDEEVAERLKQFFVEFRASAGEQDDDSPIPLTFR
FT                   KVEAIQRLAESSARVRLSDIVEIEDVERAIMLVTKSMKQVGYNPEEGEFDADIIETGQS
FT                   KSQRERRETILAIVEELDGATVEEIAQRVEFDQQLLKHDIEILKEAGRIHLMDGKFRKA
FT                   "
FT   gene            594972..596831
FT                   /locus_tag="Hmuk_0636"
FT   CDS_pept        594972..596831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0636"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46768"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46768.1"
FT                   /translation="MEHNYEPVKLKRIGTGSSFQSRYDLTRNRLSNNNIDSLQDAVEKL
FT                   RKTISKAGSLNIIKELSLHETIRSAILHSLNIDTGIPPAMVEYLFGVCTTIEPTSGNTD
FT                   IGFYDVIDALSLVEDRLRFENLKNLDDAETIEEKQQSFIQIQLMEKEISTGPFVHGRQR
FT                   REYARRVLGKCDNYIVDILDISVTDSILSADLLGEVMGQHIQQTILQALQGLIQKGAQS
FT                   DIISHSEVLSKQKPDKELFRLVLEYDRQRLDPINNSDGFSEEKDVLFGNLSSHVKKVGI
FT                   EKEAVKQALNSSTVPYDTFLEEFGISIGEYKSDPADLSGSINKFDYPFDHNPLHEYPIL
FT                   VDREGKIYHGPSNSLYYSLSTRPYYELLDSEYKDEADELIGEGNEIWVLECLDRISDEN
FT                   VEIIHSAEYDYKDGESDFVLIYDDTLVVLECKTRGPKLETRKGPFGDFNEIQANLSDII
FT                   SGPYEQATKLINAIREGEIDEIKTGYGTRQLSDDDFDSYIPGVILARSLNAVGTTLYPD
FT                   AVEFNNELPFVTDLYSFQTICRHVQGSSGFLDYLERRVAVAEQGRVFSVDELDYVGAYL
FT                   DSNLSFPEAPSECLIDIIDSGSHLDRTYESDIDGLPNEDIPRL"
FT   gene            597064..598437
FT                   /locus_tag="Hmuk_0637"
FT   CDS_pept        597064..598437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0637"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: nph:NP0946A arylsulfatase;
FT                   choline-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46769"
FT                   /db_xref="GOA:C7NZ83"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ83"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACV46769.1"
FT                   /translation="MGSPNVLLVVLDATRKDHLSCYGYDRPTTPELDAVAQAGTRYEQA
FT                   IAPAPWTPPSHASMFTGRYPSGHGSFGTQPLGEYDGATVAELLSAAGYATFGFSNSHHT
FT                   SIEQEFDRGFDYYHDILALPRFMDTMYEPSLDFLRFLPRYFRDGYDISDFQRRKLETQV
FT                   RRADGPFFGFINFNATHAPYRPPEEFRAPFEERFDDWDAVDETAARKVGDDEGYEYILG
FT                   DVTMSPTEWELVECWYDAEIRYVDALLGELFDCLRRQGVYDDTLVVVTADHGEHFGEHG
FT                   LAYHQFSLFEELLNVPLLVKWPEGDRPSPAPGTVSDRLVSLVDLVPTICEWAGVAVPDE
FT                   VDGRALTGDDDRDAVFAEYDRPYPPLRERLQQYDSFEAYDRGLQAVRTETHKLIRPTVG
FT                   EATLYRLTGDGEVEVSDDEREAALAQRLDETLEPLPDTSRTTELDDHVSDHLEKMGYL"
FT   gene            complement(598450..598962)
FT                   /locus_tag="Hmuk_0638"
FT   CDS_pept        complement(598450..598962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46770"
FT                   /db_xref="GOA:C7NZ84"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ84"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2335"
FT                   /protein_id="ACV46770.1"
FT                   /translation="MLRRLRENGPVVLVPLAWTFAIAAHLDVLALRTVLIAHLVMDAVL
FT                   VAFTVLSWSEMRRGVLRAWRLVLLVGLALTLLGTTGLLQTPPASSLLWLTVVGWLLVPA
FT                   AGLAYTGRHVDRSPLAYTGGAVLSVLGAIVYVAGTVVSGDPLVLVAGLAVAGVGQTAGI
FT                   VAAVRDY"
FT   sig_peptide     complement(598891..598962)
FT                   /locus_tag="Hmuk_0638"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.319 at
FT                   residue 24"
FT   gene            599049..600083
FT                   /locus_tag="Hmuk_0639"
FT   CDS_pept        599049..600083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0639"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rba:RB3265 glucose-fructose oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46771"
FT                   /db_xref="GOA:C7NZ85"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ85"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46771.1"
FT                   /translation="MTYRVVGANFDQMHMNTNLGWAHDHPEMEVVAVCDEEPETSTGSV
FT                   ETAVEECGLTGDDVYDDLERCLEATAPDVVFGCPRNSKHAAFVERVAAYDVHLAIEKPM
FT                   AVTLADADRMLDAMADTDRRFVVNWPVMWDPVKHTVEELVASGTVGDVIEVQYYGGNAG
FT                   APPDDSWFYDPEDGGGSMLDYLGYGATFSTWFRGGELPESVTAERYVPEGMDVDVQSST
FT                   ICRYEEGLSTLQTSWRLLTNPWEIQPQPVKGYEIVGTEGTVSTRHPDAAIRVTTADRPK
FT                   GYTVEPDPLPDRFENLATYLVDLIETDREPEGPADPAFCRAAHRIIETARRSAERGERL
FT                   DLVE"
FT   gene            complement(600098..600442)
FT                   /locus_tag="Hmuk_0640"
FT   CDS_pept        complement(600098..600442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46772"
FT                   /db_xref="GOA:C7NZ86"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV46772.1"
FT                   /translation="MTVSRRALPELTSLALVLATVASGFLLAPSLPETMIVGWHFGLDG
FT                   ELSVTRGPRLLGLTLLPALSVTAYLCLRSTRLLLDLEAAVRPRYYEALVHLVLGALAFG
FT                   QAWLLTVNLQ"
FT   gene            600655..600999
FT                   /locus_tag="Hmuk_0641"
FT   CDS_pept        600655..600999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0641"
FT                   /product="transcription regulator"
FT                   /note="KEGG: nph:NP2558A transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46773"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ87"
FT                   /inference="similar to AA sequence:KEGG:NP2558A"
FT                   /protein_id="ACV46773.1"
FT                   /translation="MSEEPDVGTVAGLLEDETARRILTQTSQEPMSASTLEQRCDASGP
FT                   TIYRRLEQLEASDLIVGQTRPDPEGGHHRTVYEPNVRSVTVELVEGELELSIDRRENMA
FT                   DRLTRFVEEI"
FT   gene            601000..601296
FT                   /locus_tag="Hmuk_0642"
FT   CDS_pept        601000..601296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnB0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46774"
FT                   /db_xref="GOA:C7NZ88"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ88"
FT                   /inference="similar to AA sequence:KEGG:rrnB0073"
FT                   /protein_id="ACV46774.1"
FT                   /translation="MTIETLGTVGLLLQGYELVGAALGLFIAYLAFRGYRRNDSRPMLF
FT                   FAIGFGIILGLPLPVVALSLVFPWLSGPGGQAIIQTFELVGLVCIIYALRMDP"
FT   gene            complement(601315..602529)
FT                   /locus_tag="Hmuk_0643"
FT   CDS_pept        complement(601315..602529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0643"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sso:SSO3008 dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46775"
FT                   /db_xref="GOA:C7NZ89"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ89"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV46775.1"
FT                   /translation="MTDSFGIGFVSAGFITRESHAPSVGYLPDVHVAGIQNRTRENAES
FT                   LADTCREEGWGDPSVYGEDAVADLVADPDVDGLWVTSPNFTRVDVVEAAVEALEDGAEL
FT                   QGIALEKPVARNLREANRIVDLVEGADLPHAYLENWPHEPDIDKLRTLLWEQGRGAGRP
FT                   YIARSQAEHGGPHSGWFWDGRKQGGGALTDMLCHALAGNDFLLSDPNGGDDLEPVSVSA
FT                   DTETIKWQQDDYADQLEADFGIDFRSNPVDDYARTTVRYEDEDGRTVVSEATGSWCYVG
FT                   SGVRRTIELLGPEYSGQVLSDDESSSVFFSDELGEGEGWAEKQTATSGRMPIAAADVVT
FT                   AGFVAENRDAVAAFRAGENGTLDLSDGVRILRLCMAAYKAAEDGADVDLRDADLEGYTP
FT                   PPARE"
FT   gene            complement(602579..603376)
FT                   /locus_tag="Hmuk_0644"
FT   CDS_pept        complement(602579..603376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0644"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hma:pNG7293
FT                   aldehyde reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46776"
FT                   /db_xref="GOA:C7NZ90"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ90"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV46776.1"
FT                   /translation="MLPLGLGTYSEDNREQWTDNVRTALDAGFRHIDTAQVYENERYVG
FT                   EGLRSSAVDRDDVWLSTKTVHHDVPPEADQVPDAIDGCLDRLGVDAVDLLYVHWPSGVY
FT                   DHETVLPAYDDAYDAGKTRHVGLSNFTPELLDEAMDVLDAPLFAHQAEMHPLLPQADLV
FT                   AHAQAHDYTFVAYSPLAKGAVFDVPEIREVAEKHDATPAQVSLAWITSHDNVAAIPKAS
FT                   SREHMEQNLAALDLELDDDDLDLIDSIDRRERVIDADHGPWNW"
FT   gene            complement(603442..603819)
FT                   /locus_tag="Hmuk_0645"
FT   CDS_pept        complement(603442..603819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0645"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: nph:NP1422A hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46777"
FT                   /db_xref="GOA:C7NZ91"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ91"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACV46777.1"
FT                   /translation="MPEGTLYERLGEREGIRAVVDDFYDRLIADEQLGPFFADADMELL
FT                   RRTQTDFLCEAAGGPETYDAVPVREAHIDVPFEPTHIERAIELLEASLDAFDVPADDAA
FT                   AVVDAVAAYEAELLASPDEEV"
FT   gene            complement(603877..604626)
FT                   /locus_tag="Hmuk_0646"
FT   CDS_pept        complement(603877..604626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC2340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46778"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ92"
FT                   /inference="similar to AA sequence:KEGG:rrnAC2340"
FT                   /protein_id="ACV46778.1"
FT                   /translation="MADDGVWVGAHVADGTWIAVAFDREGFDHAATFDGIGDLWFRYED
FT                   DAAAILVDVPIGLVEEAEGERECDELARTLVGPRSDEIVAPPAREALRKRRYPVANRTH
FT                   ERATGVSLSERAFELSETIATVDQLLREFSEARDLLAAAHPEVAFLAFAGERMERDRRT
FT                   AGGYAERLRTLASIDRDAPPAVQSAAEAMDDTPVTVADVLDAVALAYTALPHEGRLRSL
FT                   PPRPPLDDNGLPMQIVYRAEAALVEPE"
FT   gene            605145..605354
FT                   /locus_tag="Hmuk_0647"
FT   CDS_pept        605145..605354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0647"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: hal:VNG0101G CspD1"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46779"
FT                   /db_xref="GOA:C7NZ93"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ93"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACV46779.1"
FT                   /translation="MRTVAMATGTVDFFNDTGGYGFIETEDADDDVFFHMEDVGGPDLE
FT                   EGQEIEFDIEQADKGPRATNVTRL"
FT   gene            605525..606214
FT                   /locus_tag="Hmuk_0648"
FT   CDS_pept        605525..606214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hmuk_0648"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: hsl:OE2243R putative
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hmuk_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACV46780"
FT                   /db_xref="GOA:C7NZ94"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C7NZ94"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ACV46780.1"
FT                   /translation="MSEHVRARLLAGNRAHVESRPAGYFDEVQEEQHPAAVSICCADSR
FT                   VSQEGMFDIDGPGWLFTPSNIGNQAWDIVDGQKVVNGNLLYPIEYTGTKTIAVVGHTGC
FT                   GAVTAAYHAGTGSGHSHPSGIAKWIDTLGSVVADGLAAVDTDADEETVVNRLVEYNVDR
FT                   QVAFLQDAEEIPDDVSVYGFVYDLHGAYDGPRGRTYLVNDDGETDPEAVRAALDEGDQE
FT                   YAQRLTS"
FT   gene            complement(606204..607466)
FT                   /locus_tag="Hmuk_0649"
FT   CDS_pept        complement(606204..607466)
FT                   /codon_start=1
FT                   /transl_table=11
FT