(data stored in ACNUC7421 zone)

EMBL: CP001690

ID   CP001690; SV 1; circular; genomic DNA; STD; PRO; 2820544 BP.
XX
AC   CP001690; ABTX01000000-ABTX01000057;
XX
PR   Project:PRJNA20743;
XX
DT   24-NOV-2010 (Rel. 106, Created)
DT   19-NOV-2015 (Rel. 127, Last updated, Version 5)
XX
DE   Halogeometricum borinquense DSM 11551, complete genome.
XX
KW   .
XX
OS   Halogeometricum borinquense DSM 11551
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Haloferacales;
OC   Haloferacaceae; Halogeometricum.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2820544
RX   DOI; 10.4056/sigs.23264.
RX   PUBMED; 21304651.
RA   Malfatti S., Tindall B.J., Schneider S., Fahnrich R., Lapidus A.,
RA   Labuttii K., Copeland A., Glavina Del Rio T., Nolan M., Chen F., Lucas S.,
RA   Tice H., Cheng J.F., Bruce D., Goodwin L., Pitluck S., Anderson I.,
RA   Pati A., Ivanova N., Mavromatis K., Chen A., Palaniappan K.,
RA   D'haeseleer P., Goker M., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Kyrpides N.C., Klenk H.P., Chain P.;
RT   "Complete genome sequence of Halogeometricum borinquense type strain
RT   (PR3)";
RL   Stand Genomic Sci 1(2):150-159(2009).
XX
RN   [2]
RP   1-2820544
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Anderson I., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindal B., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e4d836030a4f6086bfbf903f0d8df87b.
DR   BioSample; SAMN00002580.
DR   EnsemblGenomes-Gn; EBG00001118983.
DR   EnsemblGenomes-Gn; EBG00001118984.
DR   EnsemblGenomes-Gn; EBG00001118985.
DR   EnsemblGenomes-Gn; EBG00001118986.
DR   EnsemblGenomes-Gn; EBG00001118988.
DR   EnsemblGenomes-Gn; EBG00001118989.
DR   EnsemblGenomes-Gn; EBG00001118990.
DR   EnsemblGenomes-Gn; EBG00001118991.
DR   EnsemblGenomes-Gn; EBG00001118992.
DR   EnsemblGenomes-Gn; EBG00001118994.
DR   EnsemblGenomes-Gn; EBG00001118995.
DR   EnsemblGenomes-Gn; EBG00001118996.
DR   EnsemblGenomes-Gn; EBG00001118997.
DR   EnsemblGenomes-Gn; EBG00001118998.
DR   EnsemblGenomes-Gn; EBG00001118999.
DR   EnsemblGenomes-Gn; EBG00001119000.
DR   EnsemblGenomes-Gn; EBG00001119001.
DR   EnsemblGenomes-Gn; EBG00001119002.
DR   EnsemblGenomes-Gn; EBG00001119003.
DR   EnsemblGenomes-Gn; EBG00001119004.
DR   EnsemblGenomes-Gn; EBG00001119005.
DR   EnsemblGenomes-Gn; EBG00001119006.
DR   EnsemblGenomes-Gn; EBG00001119007.
DR   EnsemblGenomes-Gn; EBG00001119008.
DR   EnsemblGenomes-Gn; EBG00001119009.
DR   EnsemblGenomes-Gn; EBG00001119010.
DR   EnsemblGenomes-Gn; EBG00001119011.
DR   EnsemblGenomes-Gn; EBG00001119012.
DR   EnsemblGenomes-Gn; EBG00001119013.
DR   EnsemblGenomes-Gn; EBG00001119014.
DR   EnsemblGenomes-Gn; EBG00001119015.
DR   EnsemblGenomes-Gn; EBG00001119016.
DR   EnsemblGenomes-Gn; EBG00001119017.
DR   EnsemblGenomes-Gn; EBG00001119018.
DR   EnsemblGenomes-Gn; EBG00001119019.
DR   EnsemblGenomes-Gn; EBG00001119020.
DR   EnsemblGenomes-Gn; EBG00001119021.
DR   EnsemblGenomes-Gn; EBG00001119022.
DR   EnsemblGenomes-Gn; EBG00001119023.
DR   EnsemblGenomes-Gn; EBG00001119024.
DR   EnsemblGenomes-Gn; EBG00001119025.
DR   EnsemblGenomes-Gn; EBG00001119026.
DR   EnsemblGenomes-Gn; EBG00001119027.
DR   EnsemblGenomes-Gn; EBG00001119028.
DR   EnsemblGenomes-Gn; EBG00001119029.
DR   EnsemblGenomes-Gn; EBG00001119030.
DR   EnsemblGenomes-Gn; EBG00001119031.
DR   EnsemblGenomes-Gn; EBG00001119032.
DR   EnsemblGenomes-Gn; EBG00001119033.
DR   EnsemblGenomes-Gn; EBG00001119034.
DR   EnsemblGenomes-Gn; EBG00001119035.
DR   EnsemblGenomes-Gn; EBG00001119036.
DR   EnsemblGenomes-Gn; EBG00001119037.
DR   EnsemblGenomes-Gn; EBG00001119038.
DR   EnsemblGenomes-Gn; EBG00001119039.
DR   EnsemblGenomes-Gn; EBG00001119040.
DR   EnsemblGenomes-Gn; EBG00001119041.
DR   EnsemblGenomes-Gn; EBG00001119042.
DR   EnsemblGenomes-Gn; EBG00001119043.
DR   EnsemblGenomes-Gn; EBG00001119044.
DR   EnsemblGenomes-Gn; EBG00001119045.
DR   EnsemblGenomes-Gn; EBG00001119046.
DR   EnsemblGenomes-Gn; EBG00001119047.
DR   EnsemblGenomes-Gn; EBG00001119048.
DR   EnsemblGenomes-Gn; EBG00001119049.
DR   EnsemblGenomes-Gn; EBG00001119050.
DR   EnsemblGenomes-Gn; EBG00001119051.
DR   EnsemblGenomes-Gn; EBG00001119052.
DR   EnsemblGenomes-Gn; Hbor_00930.
DR   EnsemblGenomes-Gn; Hbor_02210.
DR   EnsemblGenomes-Gn; Hbor_03170.
DR   EnsemblGenomes-Gn; Hbor_03180.
DR   EnsemblGenomes-Gn; Hbor_03190.
DR   EnsemblGenomes-Gn; Hbor_03200.
DR   EnsemblGenomes-Gn; Hbor_03210.
DR   EnsemblGenomes-Gn; Hbor_03720.
DR   EnsemblGenomes-Gn; Hbor_04470.
DR   EnsemblGenomes-Gn; Hbor_04850.
DR   EnsemblGenomes-Gn; Hbor_04890.
DR   EnsemblGenomes-Gn; Hbor_05930.
DR   EnsemblGenomes-Gn; Hbor_06550.
DR   EnsemblGenomes-Gn; Hbor_07650.
DR   EnsemblGenomes-Gn; Hbor_08260.
DR   EnsemblGenomes-Gn; Hbor_09250.
DR   EnsemblGenomes-Gn; Hbor_10190.
DR   EnsemblGenomes-Gn; Hbor_10210.
DR   EnsemblGenomes-Gn; Hbor_10800.
DR   EnsemblGenomes-Gn; Hbor_11830.
DR   EnsemblGenomes-Gn; Hbor_12530.
DR   EnsemblGenomes-Gn; Hbor_12580.
DR   EnsemblGenomes-Gn; Hbor_12660.
DR   EnsemblGenomes-Gn; Hbor_12760.
DR   EnsemblGenomes-Gn; Hbor_12850.
DR   EnsemblGenomes-Gn; Hbor_12950.
DR   EnsemblGenomes-Gn; Hbor_13660.
DR   EnsemblGenomes-Gn; Hbor_14520.
DR   EnsemblGenomes-Gn; Hbor_14640.
DR   EnsemblGenomes-Gn; Hbor_14650.
DR   EnsemblGenomes-Gn; Hbor_14660.
DR   EnsemblGenomes-Gn; Hbor_14670.
DR   EnsemblGenomes-Gn; Hbor_14750.
DR   EnsemblGenomes-Gn; Hbor_15220.
DR   EnsemblGenomes-Gn; Hbor_15490.
DR   EnsemblGenomes-Gn; Hbor_18060.
DR   EnsemblGenomes-Gn; Hbor_20800.
DR   EnsemblGenomes-Gn; Hbor_20920.
DR   EnsemblGenomes-Gn; Hbor_22090.
DR   EnsemblGenomes-Gn; Hbor_22110.
DR   EnsemblGenomes-Gn; Hbor_23050.
DR   EnsemblGenomes-Gn; Hbor_23550.
DR   EnsemblGenomes-Gn; Hbor_25100.
DR   EnsemblGenomes-Gn; Hbor_25710.
DR   EnsemblGenomes-Gn; Hbor_26220.
DR   EnsemblGenomes-Gn; Hbor_26780.
DR   EnsemblGenomes-Gn; Hbor_26790.
DR   EnsemblGenomes-Gn; Hbor_26850.
DR   EnsemblGenomes-Gn; Hbor_26860.
DR   EnsemblGenomes-Gn; Hbor_27160.
DR   EnsemblGenomes-Gn; Hbor_27210.
DR   EnsemblGenomes-Gn; Hbor_27370.
DR   EnsemblGenomes-Gn; Hbor_28090.
DR   EnsemblGenomes-Gn; Hbor_28260.
DR   EnsemblGenomes-Gn; Hbor_28270.
DR   EnsemblGenomes-Gn; Hbor_28860.
DR   EnsemblGenomes-Gn; Hbor_28940.
DR   EnsemblGenomes-Tr; EBT00001710224.
DR   EnsemblGenomes-Tr; EBT00001710225.
DR   EnsemblGenomes-Tr; EBT00001710226.
DR   EnsemblGenomes-Tr; EBT00001710227.
DR   EnsemblGenomes-Tr; EBT00001710228.
DR   EnsemblGenomes-Tr; EBT00001710229.
DR   EnsemblGenomes-Tr; EBT00001710230.
DR   EnsemblGenomes-Tr; EBT00001710231.
DR   EnsemblGenomes-Tr; EBT00001710232.
DR   EnsemblGenomes-Tr; EBT00001710233.
DR   EnsemblGenomes-Tr; EBT00001710234.
DR   EnsemblGenomes-Tr; EBT00001710235.
DR   EnsemblGenomes-Tr; EBT00001710236.
DR   EnsemblGenomes-Tr; EBT00001710237.
DR   EnsemblGenomes-Tr; EBT00001710238.
DR   EnsemblGenomes-Tr; EBT00001710239.
DR   EnsemblGenomes-Tr; EBT00001710240.
DR   EnsemblGenomes-Tr; EBT00001710241.
DR   EnsemblGenomes-Tr; EBT00001710242.
DR   EnsemblGenomes-Tr; EBT00001710243.
DR   EnsemblGenomes-Tr; EBT00001710244.
DR   EnsemblGenomes-Tr; EBT00001710245.
DR   EnsemblGenomes-Tr; EBT00001710246.
DR   EnsemblGenomes-Tr; EBT00001710247.
DR   EnsemblGenomes-Tr; EBT00001710249.
DR   EnsemblGenomes-Tr; EBT00001710250.
DR   EnsemblGenomes-Tr; EBT00001710251.
DR   EnsemblGenomes-Tr; EBT00001710252.
DR   EnsemblGenomes-Tr; EBT00001710253.
DR   EnsemblGenomes-Tr; EBT00001710254.
DR   EnsemblGenomes-Tr; EBT00001710255.
DR   EnsemblGenomes-Tr; EBT00001710256.
DR   EnsemblGenomes-Tr; EBT00001710257.
DR   EnsemblGenomes-Tr; EBT00001710258.
DR   EnsemblGenomes-Tr; EBT00001710259.
DR   EnsemblGenomes-Tr; EBT00001710260.
DR   EnsemblGenomes-Tr; EBT00001710261.
DR   EnsemblGenomes-Tr; EBT00001710262.
DR   EnsemblGenomes-Tr; EBT00001710264.
DR   EnsemblGenomes-Tr; EBT00001710265.
DR   EnsemblGenomes-Tr; EBT00001710266.
DR   EnsemblGenomes-Tr; EBT00001710267.
DR   EnsemblGenomes-Tr; EBT00001710268.
DR   EnsemblGenomes-Tr; EBT00001710269.
DR   EnsemblGenomes-Tr; EBT00001710270.
DR   EnsemblGenomes-Tr; EBT00001710271.
DR   EnsemblGenomes-Tr; EBT00001710272.
DR   EnsemblGenomes-Tr; EBT00001710273.
DR   EnsemblGenomes-Tr; EBT00001710274.
DR   EnsemblGenomes-Tr; EBT00001710275.
DR   EnsemblGenomes-Tr; EBT00001710276.
DR   EnsemblGenomes-Tr; EBT00001710277.
DR   EnsemblGenomes-Tr; EBT00001710278.
DR   EnsemblGenomes-Tr; EBT00001710279.
DR   EnsemblGenomes-Tr; EBT00001710280.
DR   EnsemblGenomes-Tr; EBT00001710281.
DR   EnsemblGenomes-Tr; EBT00001710282.
DR   EnsemblGenomes-Tr; EBT00001710283.
DR   EnsemblGenomes-Tr; EBT00001710284.
DR   EnsemblGenomes-Tr; EBT00001710285.
DR   EnsemblGenomes-Tr; EBT00001710286.
DR   EnsemblGenomes-Tr; EBT00001710287.
DR   EnsemblGenomes-Tr; EBT00001710288.
DR   EnsemblGenomes-Tr; EBT00001710289.
DR   EnsemblGenomes-Tr; EBT00001710290.
DR   EnsemblGenomes-Tr; EBT00001710291.
DR   EnsemblGenomes-Tr; EBT00001710292.
DR   EnsemblGenomes-Tr; EBT00001710293.
DR   EnsemblGenomes-Tr; Hbor_00930-1.
DR   EnsemblGenomes-Tr; Hbor_02210-1.
DR   EnsemblGenomes-Tr; Hbor_03170-1.
DR   EnsemblGenomes-Tr; Hbor_03180-1.
DR   EnsemblGenomes-Tr; Hbor_03190-1.
DR   EnsemblGenomes-Tr; Hbor_03200-1.
DR   EnsemblGenomes-Tr; Hbor_03210-1.
DR   EnsemblGenomes-Tr; Hbor_03720-1.
DR   EnsemblGenomes-Tr; Hbor_04470-1.
DR   EnsemblGenomes-Tr; Hbor_04850-1.
DR   EnsemblGenomes-Tr; Hbor_04890-1.
DR   EnsemblGenomes-Tr; Hbor_05930-1.
DR   EnsemblGenomes-Tr; Hbor_06550-1.
DR   EnsemblGenomes-Tr; Hbor_07650-1.
DR   EnsemblGenomes-Tr; Hbor_08260-1.
DR   EnsemblGenomes-Tr; Hbor_09250-1.
DR   EnsemblGenomes-Tr; Hbor_10190-1.
DR   EnsemblGenomes-Tr; Hbor_10210-1.
DR   EnsemblGenomes-Tr; Hbor_10800-1.
DR   EnsemblGenomes-Tr; Hbor_11830-1.
DR   EnsemblGenomes-Tr; Hbor_12530-1.
DR   EnsemblGenomes-Tr; Hbor_12580-1.
DR   EnsemblGenomes-Tr; Hbor_12660-1.
DR   EnsemblGenomes-Tr; Hbor_12760-1.
DR   EnsemblGenomes-Tr; Hbor_12850-1.
DR   EnsemblGenomes-Tr; Hbor_12950-1.
DR   EnsemblGenomes-Tr; Hbor_13660-1.
DR   EnsemblGenomes-Tr; Hbor_14520-1.
DR   EnsemblGenomes-Tr; Hbor_14640-1.
DR   EnsemblGenomes-Tr; Hbor_14650-1.
DR   EnsemblGenomes-Tr; Hbor_14660-1.
DR   EnsemblGenomes-Tr; Hbor_14670-1.
DR   EnsemblGenomes-Tr; Hbor_14750-1.
DR   EnsemblGenomes-Tr; Hbor_15220-1.
DR   EnsemblGenomes-Tr; Hbor_15490-1.
DR   EnsemblGenomes-Tr; Hbor_18060-1.
DR   EnsemblGenomes-Tr; Hbor_20800-1.
DR   EnsemblGenomes-Tr; Hbor_20920-1.
DR   EnsemblGenomes-Tr; Hbor_22090-1.
DR   EnsemblGenomes-Tr; Hbor_22110-1.
DR   EnsemblGenomes-Tr; Hbor_23050-1.
DR   EnsemblGenomes-Tr; Hbor_23550-1.
DR   EnsemblGenomes-Tr; Hbor_25100-1.
DR   EnsemblGenomes-Tr; Hbor_25710-1.
DR   EnsemblGenomes-Tr; Hbor_26220-1.
DR   EnsemblGenomes-Tr; Hbor_26780-1.
DR   EnsemblGenomes-Tr; Hbor_26790-1.
DR   EnsemblGenomes-Tr; Hbor_26850-1.
DR   EnsemblGenomes-Tr; Hbor_26860-1.
DR   EnsemblGenomes-Tr; Hbor_27160-1.
DR   EnsemblGenomes-Tr; Hbor_27210-1.
DR   EnsemblGenomes-Tr; Hbor_27370-1.
DR   EnsemblGenomes-Tr; Hbor_28090-1.
DR   EnsemblGenomes-Tr; Hbor_28260-1.
DR   EnsemblGenomes-Tr; Hbor_28270-1.
DR   EnsemblGenomes-Tr; Hbor_28860-1.
DR   EnsemblGenomes-Tr; Hbor_28940-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01337; CRISPR-DR24.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; CP001690.
DR   SILVA-SSU; CP001690.
DR   StrainInfo; 302620; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082733
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Halogeometricum borinquense PR3, DSM 11551
CC   Culture Collection ID :: DSM 11551, ATCC 700274, JCM 10706
CC   GOLD Stamp ID         :: Gc01108
CC   Funding Program       :: DOE-GEBA 2007
CC   Number of Reads       :: 2826 Sanger
CC   Assembly Method       :: Newbler, PGA
CC   Sequencing Depth      :: 9.7x Sanger; 21.8x 454
CC   Gene Calling Method   :: GeneMark, GenePRIMP
CC   Isolation Site        :: Solar salterns of Cabo Rojo Puerto Rico
CC   Isolation Country     :: Puerto Rico
CC   Latitude              :: 18.088189
CC   Longitude             :: -67.147095
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Pleomorphic-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 40C
CC   Salinity              :: Halophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Solar saltern
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2820544
FT                   /organism="Halogeometricum borinquense DSM 11551"
FT                   /strain="PR 3"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Halogeometricum borinquense"
FT                   /db_xref="taxon:469382"
FT                   /culture_collection="DSM:11551"
FT   gene            24..1067
FT                   /locus_tag="Hbor_00010"
FT   CDS_pept        24..1067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00010"
FT                   /product="transposase"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); Replication factor C"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65614"
FT                   /db_xref="GOA:E4NQY8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQY8"
FT                   /protein_id="ADQ65614.1"
FT                   /translation="MDAPLWTETHAPSLSDLPQSEVRDRLGRTVDEPMNLVLQGPPGVG
FT                   KTAAVRALARKSHEDPENDLVEINVADFFSRTKKQIRTDPRFEQFLTGRSRMAKRDMIS
FT                   RVLKESAGYAPVSGDYKTILLDNAEHIREDFQQALRRVMEQHHRTTQFVITTRQPTKLI
FT                   PPIRSRCFPVPVRAPSTDETEAILSDIAEAEDVAYDEMALNIIASKADGNLREAILAAQ
FT                   SAAVEGDDEITMESAQTALSEVGHDDKLKEILETARNGEIRDARKTITTLLDDEGYDGQ
FT                   ELLRDLLAIADKYPEEFGEADVMRLHRLAGAVDLDLTEGLDDRLHLTHLLSAWAAGQHE
FT                   LDEEQLA"
FT   gene            1022..1672
FT                   /locus_tag="Hbor_00020"
FT   CDS_pept        1022..1672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00020"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /note="PFAM: Phosphatidylserine decarboxylase; TIGRFAM:
FT                   phosphatidylserine decarboxylase precursor-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65615"
FT                   /db_xref="GOA:E4NQY9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQY9"
FT                   /protein_id="ADQ65615.1"
FT                   /translation="MGGRSARTGRGATSLMRYAPGVRRFALPAFLAAALFAVIAPPLSL
FT                   VSLLGGGFVLWFFRDPERRPSAQGIISPADGRVSVVREEGEQIRIGVFMNVTDVHVNRA
FT                   PFDATVERVTHRSGAHRPAFSKESERNERVDVALQTPEGPAELSLIAGAFARRIHPYIA
FT                   ENDELARGERIGHIDFGSRADVLLPPCYDRSDLLVEEGDTLRAGESVVARRAD"
FT   gene            1729..1950
FT                   /locus_tag="Hbor_00030"
FT   CDS_pept        1729..1950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65616"
FT                   /db_xref="GOA:E4NQZ0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ0"
FT                   /protein_id="ADQ65616.1"
FT                   /translation="MSSEETGVLDTFLKGALNLETLVVLLACCGALGYLTYESLLSTTT
FT                   AFLAAVGGGAAGIVATVVLLVLGRRFWF"
FT   gene            2066..2455
FT                   /locus_tag="Hbor_00040"
FT   CDS_pept        2066..2455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65617"
FT                   /db_xref="GOA:E4NQZ1"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ1"
FT                   /protein_id="ADQ65617.1"
FT                   /translation="MSRPSRWWYGVVPFPLVVLTALLSRFAVHRFIKLSTSGSGESDSV
FT                   AAIASFLLSSFADLVGLSVALFVLVCLILDVRALRRDSAWSPSWAWGLAGVVHLVGTMF
FT                   TTLLVVSVPALSVYLYRRRGQVGLR"
FT   gene            complement(2461..3585)
FT                   /locus_tag="Hbor_00050"
FT   CDS_pept        complement(2461..3585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00050"
FT                   /product="N2-methylguanosine tRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: Putative RNA methylase family UPF0020; THUMP
FT                   domain; TIGRFAM: conserved hypothetical protein TIGR01177"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65618"
FT                   /db_xref="GOA:E4NQZ2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ2"
FT                   /protein_id="ADQ65618.1"
FT                   /translation="MRPSDDLYRRSDSRTTRIVDSRTIRADSRTTSIDTLIRADGHAPS
FT                   VYCLELAGEEADESLAALEAERAAATAVERVAPGLATARGVRLGRVPTLAYTHHVSELL
FT                   GRTDADVESAVALLSAASFDREGSVAVRGRDVRSSSGVSASAAERALGGVLVDRGFEVD
FT                   LDDPDHVLRALFADDTCLLGWEAAASVRDFGSRAPTDRPFFQPGSMDPLDARAYVNLAA
FT                   GPDLPDATVVDPMCGTGGILIEAGLVGARGVGNDAQSKMARGARENLTAYLPDAEWDVV
FT                   RGDATSLPLCDDAADAVVFDAPYGRQSKIARHELSDLVGGALAEAARVAPAAVLIADRP
FT                   WDAEAEDAGWTVDARFERRVHRSLDRHVHVLSRT"
FT   gene            3591..3950
FT                   /locus_tag="Hbor_00060"
FT   CDS_pept        3591..3950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65619"
FT                   /db_xref="GOA:E4NQZ3"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ3"
FT                   /protein_id="ADQ65619.1"
FT                   /translation="MMPGLASFISFPSAVPMLDAVLWVIAVIFYGIGDYVTTIAATSRP
FT                   GARERNPFVRRLFDGIPVPPSMTFAAAKVTAFAFFVVGYATIGSSLLRPLIPGVVAAIG
FT                   ILVTIQNIRVLGVKS"
FT   gene            4008..4571
FT                   /locus_tag="Hbor_00070"
FT   CDS_pept        4008..4571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00070"
FT                   /product="TATA binding protein of transcription factor
FT                   TFIID"
FT                   /note="PFAM: Transcription factor TFIID (or TATA-binding
FT                   protein, TBP)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65620"
FT                   /db_xref="GOA:E4NQZ4"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ4"
FT                   /protein_id="ADQ65620.1"
FT                   /translation="MTDPKDTINIENVVASTGIGQELDLQSVAMDLEGADYDPEQFPGL
FT                   VYRTQEPKSAALIFRSGKIVCTGAKSTDDVHESLNLVFDKLRALQIPVDDEPDITVQNI
FT                   VTSADLGRNLNLNAIAIGLGLENIEYEPEQFPGLVYRLDSPDVVALLFGSGKLVITGGK
FT                   HPSDAEGAVDEIVSRLSDLGLYGG"
FT   gene            4636..5019
FT                   /locus_tag="Hbor_00080"
FT   CDS_pept        4636..5019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65621"
FT                   /db_xref="GOA:E4NQZ5"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ5"
FT                   /protein_id="ADQ65621.1"
FT                   /translation="MTLPATPLQSGASGSALAVAGTFASLALFLSLTAHIAARNVLGDV
FT                   PVKYAFVVGPIPAAIAVVVTTFELNSYLGVFVAIILDGVAVKYLYGQSNRLSGYITFIH
FT                   VIVSIIIGTVLYALLALLSTAPV"
FT   sig_peptide     4636..4737
FT                   /locus_tag="Hbor_00080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            5069..6019
FT                   /locus_tag="Hbor_00090"
FT   CDS_pept        5069..6019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00090"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65622"
FT                   /db_xref="GOA:E4NQZ6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ6"
FT                   /protein_id="ADQ65622.1"
FT                   /translation="MLTVNLRALVWNADERRPPAPVRLMLAVVALIVSVLLLGLFLSLF
FT                   FTTTPITSASFGLSFVAILFPGVLAVGLAVVVDRRTIADLGFGFDRDWWIDLGFGLFLG
FT                   AALMTAIFLVALAAGWVRVEGTLTGGSRGFLAGFTLLTIQFLAVGVSEEIVSRGYLLTN
FT                   VAEGLSGYTTRFVAASTAVLFSSVVFGAAHLQNPNATLVSTVGISLAGIFLAIGYVLTD
FT                   ELAIPIGLHITWNLFQGGVYGFAVSGLGVSANVVDTVETGPDLFTGGAFGPEAGLLGVF
FT                   AIILGTFLIIGYVRWRYGEARLAPGLFSPELRWRE"
FT   gene            complement(6052..6897)
FT                   /locus_tag="Hbor_00100"
FT   CDS_pept        complement(6052..6897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00100"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="PFAM: HisG, C-terminal domain; ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase, C-terminal domain; ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65623"
FT                   /db_xref="GOA:E4NQZ7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ7"
FT                   /protein_id="ADQ65623.1"
FT                   /translation="MRIAVPNKGRLHDPSVELLERAGLHIQSGADRKLYADTVDPDVTV
FT                   LFARAADIPEYVRDGAAAVGITGLDQMRESGHDLEELVDLQFGSCRLVLAAPEDGDIES
FT                   VEDVAGKIVATEFPTIARNYFDEQGVEADVVEVSGATELTPHVEMADAIIDITSTGTTL
FT                   RVNRLAIVDEVLSSSVRLFARPDVVDDPKVDQLVTAFQSVIAAEDKRYVMMNVPQERLD
FT                   DVREVLPGLGGPTVMDVAGDDMVAVHAVVDERHVFEVVNDLKSVGASGILVTEIERLVE
FT                   "
FT   gene            complement(6988..7509)
FT                   /locus_tag="Hbor_00110"
FT   CDS_pept        complement(6988..7509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65624"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ8"
FT                   /protein_id="ADQ65624.1"
FT                   /translation="MTDTRIQIRTYVDSHPGIHFNGLVRSLDLAPGQVQHHVRRLIDSD
FT                   RLVREEFYGRTHYYPPGLTEWERATVALYHRETARNILTTLLDAEEARPASLAEDLGVA
FT                   RSTLEWHVGHLEEEGIVRKERDIRNRVTLVLERPAATAALLARLDSETVGTAGRDVEHS
FT                   TGAETPVDAD"
FT   gene            7722..9023
FT                   /locus_tag="Hbor_00120"
FT   CDS_pept        7722..9023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00120"
FT                   /product="cytosine deaminase-like metal-dependent
FT                   hydrolase"
FT                   /note="PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65625"
FT                   /db_xref="GOA:E4NQZ9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4NQZ9"
FT                   /protein_id="ADQ65625.1"
FT                   /translation="MNALCIIGGRVLRPDCSVENADVVIDTDTGRIHDIGEDIAADYDA
FT                   AETLDADGCLVMPGLVNAHTHVAMTLLRGYADDKPLDSWLREDIWPAEAELEPEDVRAG
FT                   TELGLIEMIRSGTTTFADMYFEVPEIAAAVEASGMRARLGHGIVTVAKDDAEAATDIEE
FT                   GLRVAREFDGAADGRIHTAFMPHSLTTVDEKFLRESVATARENEIPLHFHANETTDEVD
FT                   PIVEERDQRPLAYADELGMVSEEDFLAHGVHVDAAEIELLAERGTGVIHCPASNMKLAS
FT                   GIAPVQQMLDAGVTVGIGTDGAASNNDLDMFDELRDAAMLGKLGADDASAVPAEAAITA
FT                   ATAGSADAIGLPGGRIEEGGVADIAVVDLDAPHLAPAHDVVSHLAYAVRGSDVRHTICD
FT                   GQILMRDREVLTLDEEEVVETACERAMALVERAE"
FT   gene            9153..10436
FT                   /locus_tag="Hbor_00130"
FT   CDS_pept        9153..10436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00130"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding domain; S-adenosyl-L-homocysteine hydrolase;
FT                   TIGRFAM: adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65626"
FT                   /db_xref="GOA:E4NR00"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR00"
FT                   /protein_id="ADQ65626.1"
FT                   /translation="MSDYPPISEHLDDVESAREAGRRKMDWALQHMPILNELRDQFEAE
FT                   KPLDGEVIGMAMHVEAKTANLVELLALGGAEVAITGCNPLSTHDDVSAALDANDNITSY
FT                   AVRGVGDDEYYEAIESVISHEPTITVDDGMDMVFAIHEEYPELIDTIVGGAEETTTGVH
FT                   RLRAMDDDGELKYPVFAVNDTPMKRLFDNIHGTGESSLANIAMTTNVSFASKNVVVAGY
FT                   GYCGKGVAKKAAGQNANVIVAEVEPRRALEAHMEGYDVMPMNEAAKVGDIFVTTTGNRD
FT                   IITEEDFEVMKDGAILSNAGHFDIEIDLDALSDLAVDEYEARDGVQAYEMEDGRRLNVL
FT                   AEGRLVNLASPIALGHPIEVMDQSFGVQAVCVRELVENGDDYDAGVHDVPDELDKEVAE
FT                   IKLDAEGVEIDTLTDEQREYMGSWSHGT"
FT   gene            complement(10464..10625)
FT                   /locus_tag="Hbor_00140"
FT   CDS_pept        complement(10464..10625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65627"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR01"
FT                   /protein_id="ADQ65627.1"
FT                   /translation="MYTMSSSDFTVHTSECDAVGSGMPISSLPDEVQSLDDLDCDCWDV
FT                   FDSFEEIE"
FT   gene            10881..11336
FT                   /locus_tag="Hbor_00150"
FT   CDS_pept        10881..11336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00150"
FT                   /product="Holliday junction resolvase"
FT                   /note="PFAM: Archaeal holliday junction resolvase (hjc)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65628"
FT                   /db_xref="GOA:E4NR02"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR02"
FT                   /protein_id="ADQ65628.1"
FT                   /translation="MSSNRKGDRRERELVNKLDDAGFAVMRAPASGSATERELPDVLAG
FT                   NGEMFYAIEAKASSGRPIYLQGEEVEALIYFAQNFGAKSRIAVRFDREDWYFFHPGDLY
FT                   VTDGGNYRVKKETALAEGEPFDSFVGGPAQSRLTDVADETDEAADDA"
FT   gene            11427..11615
FT                   /locus_tag="Hbor_00160"
FT   CDS_pept        11427..11615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65629"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR03"
FT                   /protein_id="ADQ65629.1"
FT                   /translation="MVHCPECQSTLSSSEDIAFEETEARTGFVRASKRFYTANCASCGM
FT                   TIGSGVAGAKANGGGAT"
FT   gene            11618..11785
FT                   /locus_tag="Hbor_00170"
FT   CDS_pept        11618..11785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65630"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR04"
FT                   /protein_id="ADQ65630.1"
FT                   /translation="MVHCPECETELAGQGDVEFVDLGAETGFFKASKRFYIVGCNECGA
FT                   AIGSGVAGAR"
FT   gene            complement(11867..12601)
FT                   /locus_tag="Hbor_00180"
FT   CDS_pept        complement(11867..12601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00180"
FT                   /product="SWIM zinc finger-containing protein"
FT                   /note="PFAM: SWIM zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65631"
FT                   /db_xref="GOA:E4NR05"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR05"
FT                   /protein_id="ADQ65631.1"
FT                   /translation="MTHTRNTPASKDRSVVARSIREKTTFPAAGYAGRTRRAREEPMAV
FT                   RPLRDGRYVVETEGGTYVADVEAGTCTCPDSSIRHVRCKHLRRVAIEITARLVPAPGER
FT                   TSACAVCGRRTFVPMFDHAPSLCERHDHAPGDLVRDRETQSLLVVVRATGERADESVTE
FT                   QGILVSDYETNANYGRHEPVFEAVYVDSVPLSGGVADLANRTRYRFPASRLRPVELDFA
FT                   DSEAVRGATDSTRSELMQSSPV"
FT   gene            12951..13880
FT                   /locus_tag="Hbor_00190"
FT   CDS_pept        12951..13880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65632"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR06"
FT                   /protein_id="ADQ65632.1"
FT                   /translation="MRRNATILMTAMLLVAALATVPMASVAQSEGGTTATETPMAGSDS
FT                   TSNESTQSGELLSGVLAVQDAEIAREVETRTFGIRVAQAATDEAKADVVAERLNSNEAR
FT                   LAELEQRKARLEAARENGSISKGEYNTRMARVAAETETVKELTNRSATASERLPNELLE
FT                   QRGVNTTAIRTLATRAEDLTGPEVSEIARQIAGSATTRGNATAHRGPFEEVPPRGNHTE
FT                   NGNGQANAHGQRETLENATTENASSTIPDNETATDTPLSGSEQGASERDSDDSTNAGKT
FT                   DSSSKSGADARGSDALSVSRSGLLVRIE"
FT   sig_peptide     12951..13037
FT                   /locus_tag="Hbor_00190"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            13880..14590
FT                   /locus_tag="Hbor_00200"
FT   CDS_pept        13880..14590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65633"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="InterPro:IPR032604"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR07"
FT                   /protein_id="ADQ65633.1"
FT                   /translation="MNEVTRFLSLLLVGAVVLAVGTASTAAAAEPTEPGLIVELHEDGS
FT                   ATVTLRTTYDLASDEEARAFTDLREDDDAREKLVEKYKDRMSRVAATAATETGRTMQVT
FT                   NERIELSTSGDVGVVALSVQWEGLAATDTGRLVVTRPFAGDFESDHSLTLVGPHGYDVT
FT                   ATNPSPDSQTENRLTWQSGTELNEFEVTFASSDAAESEASGDSTDTGTNTPGFGIVIAS
FT                   VALLGAALLARLRE"
FT   sig_peptide     13880..13963
FT                   /locus_tag="Hbor_00200"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            14718..14987
FT                   /locus_tag="Hbor_00210"
FT   CDS_pept        14718..14987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65634"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR08"
FT                   /protein_id="ADQ65634.1"
FT                   /translation="MLADMNRSLIAPLLVAFLLATLAVAPAAAVGPDKDVDECQNASNG
FT                   PAGDAGPPAFVSGLVNNAVGSLSDLFASLPVPNFVKGFFGASAC"
FT   sig_peptide     14718..14804
FT                   /locus_tag="Hbor_00210"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            15106..15303
FT                   /locus_tag="Hbor_00220"
FT   CDS_pept        15106..15303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65635"
FT                   /db_xref="GOA:E4NR09"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR09"
FT                   /protein_id="ADQ65635.1"
FT                   /translation="MALEAEMRRKILVSVVAVGFFISLIVGVGVTYNNSGLGGTGGLIL
FT                   VGTIALFILAMGVIGVFLNR"
FT   gene            complement(15357..16484)
FT                   /locus_tag="Hbor_00230"
FT   CDS_pept        complement(15357..16484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00230"
FT                   /product="DNA primase, large subunit"
FT                   /note="PFAM: Eukaryotic and archaeal DNA primase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65636"
FT                   /db_xref="GOA:E4NR10"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR10"
FT                   /protein_id="ADQ65636.1"
FT                   /translation="MDPHYARYPFFDGARAAVGDADISPAALIAEDAPAVERGLERVER
FT                   ALMEGTVAAEEPHRWSDREELLSYPIARILVSLVDTPAAVDKYAAAEATTAHDRFRADF
FT                   ETDDDGLQSTTTRTVSLEDVLREFELAADVRPERSTPDSRRRSGRDPTQYWIDVGAYLT
FT                   LSTADWGERWRLVNRELATGAVRVTTDELHRLLEEAVHRRVADGLPFEVRGSSAGDEIA
FT                   DALEDEVASIRDLLNDHDAAGRTDVEAVVPALFPPCMKALVQRAREGESLPAHSEFSLV
FT                   SFLVALGMDATEVTTLLDVTDETASRIATRVEYLTDAGGSQFAPPSCASMQSYGDCVNK
FT                   DERCETISHPLSYYTSAVRDAGDVRDWRETVTDDE"
FT   gene            16557..17288
FT                   /locus_tag="Hbor_00240"
FT   CDS_pept        16557..17288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65637"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR11"
FT                   /protein_id="ADQ65637.1"
FT                   /translation="MWPDATREPLFATLALVISTPDQLPNSALVISALDTVSPKTAPIL
FT                   PHHVPQFDYPCPDCRATNSLHDADCRFEGTTWPVVEKAYVDLVVQLTTGPVDEDDLQES
FT                   VHGDWDNLHRAALDRLKRDGRVSEANGTLRLLTAEEFREEVSEPTREPMKTIYRHGSVP
FT                   GCHDNAVFAMVAWYEMVGLSWSETREKVISWLEESGAWSRGGFEEATPAQLVDSKRHVY
FT                   EAGYGWKEKAQSAKRVIDRHR"
FT   gene            complement(17390..17983)
FT                   /locus_tag="Hbor_00250"
FT   CDS_pept        complement(17390..17983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65638"
FT                   /db_xref="GOA:E4NR12"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR12"
FT                   /protein_id="ADQ65638.1"
FT                   /translation="MDRFVLAFTLLIGILLVASPLYILPHATMSSYRYTIQSVDEDVET
FT                   SPVVYSTLPQSAQNTFDSARSTDGVVVKQTTDPAFEPGRSVVTDGDEQYVVRTVREPPS
FT                   TVLRWLRQALVTFGVVLCCSVGVTLRDSTDRRIGPPIGFAVVGFGAVITAVTGVGTGAG
FT                   AVLLLTVVIAQFAALWWAVATATGRIVPQPIIGE"
FT   gene            complement(18104..18847)
FT                   /locus_tag="Hbor_00260"
FT   CDS_pept        complement(18104..18847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00260"
FT                   /product="monomeric archaeal DNA polymerase sliding clamp"
FT                   /note="PFAM: Proliferating cell nuclear antigen, N-terminal
FT                   domain; Proliferating cell nuclear antigen, C-terminal
FT                   domain; TIGRFAM: proliferating cell nuclear antigen (pcna)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65639"
FT                   /db_xref="GOA:E4NR13"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR13"
FT                   /protein_id="ADQ65639.1"
FT                   /translation="MFKAIVSASTLRDALDSVSVLVDECKIRLNEDNLSIRAVDPANVG
FT                   MVDLTLDAASFESYEADGGVIGVNLSKLEDFVGMANSDQLVELELDEETRKLNIRIDGL
FT                   SSTLALIDPDSIRQEPDIPDLDLPAEIVLEGAQLDRGIKAADMVSDHVRLRVDDTAEAF
FT                   HIQAQGDTDDVDFQLDTEDLIDLTSGTADSLFSLDYLKDMNKAIPKDAEVTAELGEEFP
FT                   VKLHYQIAEGQGHVTYMLAPRIQSE"
FT   gene            complement(19068..19520)
FT                   /locus_tag="Hbor_00270"
FT   CDS_pept        complement(19068..19520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65640"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR14"
FT                   /protein_id="ADQ65640.1"
FT                   /translation="MGGICGDTGQYIHSPGVTDVHVADDSQSLEVSTAVEGPNAAAEES
FT                   STQSEGESGGAVTVEVGSVQSDEGSSETSAESTNEAHEQNSVTTVDIDVTEMQNGGADV
FT                   DDVANVDGDTGVSDITQNVADDVQAVSVGSTNQVSRVQKTTEIQDS"
FT   gene            complement(19852..20103)
FT                   /locus_tag="Hbor_00280"
FT   CDS_pept        complement(19852..20103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65641"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR15"
FT                   /protein_id="ADQ65641.1"
FT                   /translation="MRVTFRRIGVALFAAMLVLTAFSGGAAALADDASNNANVASNYAT
FT                   VQQNSGNLGWNGGVAAVNLNNAQVTQVSVSTQNNIDVL"
FT   sig_peptide     complement(20014..20103)
FT                   /locus_tag="Hbor_00280"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(20108..20335)
FT                   /locus_tag="Hbor_00290"
FT   CDS_pept        complement(20108..20335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65642"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR16"
FT                   /protein_id="ADQ65642.1"
FT                   /translation="MGVVLLTAMLVLTAFSGGAAAFHGDDASGNTNIASNGAYVAQNSG
FT                   NAGGGFSAFSTNSAGVTQVALASQTNTDNI"
FT   sig_peptide     complement(20273..20335)
FT                   /locus_tag="Hbor_00290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(20362..20583)
FT                   /locus_tag="Hbor_00300"
FT   CDS_pept        complement(20362..20583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65643"
FT                   /db_xref="UniProtKB/TrEMBL:E4NR17"
FT                   /protein_id="ADQ65643.1"
FT                   /translation="MGVVLLTAMLVLTAFSGGAAAYHGDDASDNTNVAYNGAYVAQNSG
FT                   GGLFSAANSNHADVTQVALAGQSNTDLI"
FT   sig_peptide     complement(20521..20583)
FT                   /locus_tag="Hbor_00300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(20609..20836)
FT                   /locus_tag="Hbor_00310"
FT   CDS_pept        complement(20609..20836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65644"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRG8"
FT                   /protein_id="ADQ65644.1"
FT                   /translation="MGVVLLTAMLVLTALSGGAAAYADDASDNTNIAYNGAYVEQNSGN
FT                   AYGGGFSAFNSNHAGVTQVAIGLQQNTDNI"
FT   sig_peptide     complement(20768..20836)
FT                   /locus_tag="Hbor_00310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(20862..21086)
FT                   /locus_tag="Hbor_00320"
FT   CDS_pept        complement(20862..21086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65645"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRG9"
FT                   /protein_id="ADQ65645.1"
FT                   /translation="MTGVLVVAMLVLTAFSGGAAALGDDASNNYNVAHNDAHVVQNSGN
FT                   LGSGASAFNHNDAGVTQVALASQTNTDWI"
FT   sig_peptide     complement(21024..21086)
FT                   /locus_tag="Hbor_00320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(22575..24245)
FT                   /locus_tag="Hbor_00330"
FT   CDS_pept        complement(22575..24245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00330"
FT                   /product="uncharacterized PrgY-like protein, pheromone
FT                   shutdown like protein"
FT                   /note="PFAM: TraB family; TIGRFAM: pheromone
FT                   shutdown-related protein TraB"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65646"
FT                   /db_xref="GOA:E4NRH0"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH0"
FT                   /protein_id="ADQ65646.1"
FT                   /translation="MSERTENGTIRIVGTAHVSADSVREVESVIRDEHPDVVAVELDEG
FT                   RYRRLTGDTDDPDPEALLESTTSVRLILHWVLSYVQAQLGDQFDIEPGSELLKAVETAD
FT                   EIGTDIALVDRDIRVTVQRFWSQMTIREKLRLAGGLLLGFADTRTVGLVLGLFIGITLG
FT                   PIVGLFGGNFGVTDPLLTRVAASGLLALAVGTVLYTVGKAIFDHRTVVTASLTGGVSIG
FT                   LLAGAGLGIADGTVTAYLPPMLLHGIGSLLIGLSAGLVVGVLGGLVAERLGLSGIDIDE
FT                   ADEFVAADLTDTDVVQTMLTEFRELCPNGARALIDERDAYIAYQLVALRDSGLDVVAVL
FT                   GAGHRGGVEQYLSNPATLPPHGTLVGTSRGPSVPVKKIAGALISVAFVASFVLLAMAGV
FT                   DDAYLLEVFVAWFLVNGVFAAGMAYLAGACWTAALTGGAVAWLTSVNPVLAPGWFVGYV
FT                   ELRRTPVDVADFDALNELLSGDDGLSDIRSKVASVPLLRLLAIVALTNVGSIVASVLFV
FT                   AYLLPLFAGDLGGVDAVSRLLFEGLRNGADILWRSLTSA"
FT   gene            complement(24242..24793)
FT                   /locus_tag="Hbor_00340"
FT   CDS_pept        complement(24242..24793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65647"
FT                   /db_xref="GOA:E4NRH1"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH1"
FT                   /protein_id="ADQ65647.1"
FT                   /translation="MELSMSLSYLTHTLPSEDSEQLDEFCRNELFEVLGNRRRRYILYY
FT                   LYAIDESVSCGSLAEQVTAWENDTLVDDISLRQYQSVYNSFYQTHLPTLENAGFIEYDR
FT                   SQGIVHTTDKLSELGSFFQEKHTVRGAWRWLRVSPAQGAVVSGSIAVLLVYLLFQPLVN
FT                   VTSVVILLVFGTILAGVISS"
FT   gene            25451..26221
FT                   /locus_tag="Hbor_00350"
FT   CDS_pept        25451..26221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00350"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: FtsJ-like methyltransferase; TRAM domain;
FT                   TIGRFAM: cell division protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65648"
FT                   /db_xref="GOA:E4NRH2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH2"
FT                   /protein_id="ADQ65648.1"
FT                   /translation="MGRDHYYNKAKQEGYRTRSAYKLKQLDEETGLFGPGNTVVDLGAA
FT                   PGGWLQVAAEEVSDHGTVVGVDLQRIRDIDADNVETIRGDMTDEETKESLRERIGEEGA
FT                   DVVISDMAPNMTGEYSLDHARSIHLARQAFEVALDLLPAGGDFAVKVFDGQDLADFRAD
FT                   VEEEFQYVRSIRPDASRDESSEQYLVGKHRITAPVAAGDELDVVIDDVGSEGDGIAKVD
FT                   GYTLFVSETETGDEVHVRVTDIKPNFGFAEVIDH"
FT   gene            complement(26267..27523)
FT                   /locus_tag="Hbor_00360"
FT   CDS_pept        complement(26267..27523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00360"
FT                   /product="transposase"
FT                   /note="PFAM: Putative transposase DNA-binding domain;
FT                   Probable transposase; TIGRFAM: transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65649"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH3"
FT                   /protein_id="ADQ65649.1"
FT                   /translation="MLETTRTYVARITNHQQVRDDLDQCGFSASKLWNVGRYYIQQRWD
FT                   DDGEIPDEAELKSELKDHKRYSDLHSQSSQRVLEELAEAFTGWYNSDDGNNPPGYRKRG
FT                   DDHPRSTVTWKKRAIKHDDKHGQLRLSKGFNLKESRSDFILAEYETRPDVEVENIQQVR
FT                   AVWNGDEWELHLVCKTEIPVEDAPGNNTAGIDLGISNYLAIDYEDGESELYPGNVLKED
FT                   KHYFTREEYQTEGENGPSKRARKARQKLSRRKDHFLHTLSKHIVERCVEEGVEKIAVGD
FT                   LSDIRENENGDSRNWGASENKKLHGWEFDRFARLLEYKAEEHGILVDRVDEENTSKTCS
FT                   CCGKIRDSNRVERGLYVCSSCETTMNADVNGAVNIRRKITQSPPTGDMSNGWLAQPGVF
FT                   LFDRESGSFNTREQGACKP"
FT   gene            complement(27970..28689)
FT                   /locus_tag="Hbor_00370"
FT   CDS_pept        complement(27970..28689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00370"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="PFAM: Uncharacterized ACR, YhhQ family COG1738;
FT                   TIGRFAM: conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65650"
FT                   /db_xref="GOA:E4NRH4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH4"
FT                   /protein_id="ADQ65650.1"
FT                   /translation="MSETRFGVGQVALLALFIMALTTAQLTASKLLAIPIPDAVGSLPI
FT                   VGTTILMPGAALAYALTFFASDCYSELYGRRPAQLMVNVGFAMNFILLALVWGTIFAPA
FT                   ANPEFAGQFRTVLASGTNIIAGSLLAYLVSQNWDVVAFHSIRELTGSSHLWLRNIASTA
FT                   TSQAIDTFIFVSVAFALAPRFFGIGEALPENIILGLMIGQYLLKLLIALVDTPFVYLVV
FT                   SLVGNSADDGQDPWAAE"
FT   sig_peptide     complement(28618..28689)
FT                   /locus_tag="Hbor_00370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(28682..28855)
FT                   /locus_tag="Hbor_00380"
FT   CDS_pept        complement(28682..28855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65651"
FT                   /db_xref="GOA:E4NRH5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH5"
FT                   /protein_id="ADQ65651.1"
FT                   /translation="MSKISVEIPDELLADIDEHVGDDKKFVNRSDAIRASIRKTLDVLD
FT                   EIDARHDRLDDE"
FT   gene            complement(29121..31310)
FT                   /locus_tag="Hbor_00390"
FT   CDS_pept        complement(29121..31310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00390"
FT                   /product="twin arginine targeting (Tat) protein translocase
FT                   TatC"
FT                   /note="PFAM: Sec-independent protein translocase protein
FT                   (TatC); TIGRFAM: Twin arginine targeting (Tat) protein
FT                   translocase TatC, Archaeal clade; Twin arginine targeting
FT                   (Tat) protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65652"
FT                   /db_xref="GOA:E4NRH6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH6"
FT                   /protein_id="ADQ65652.1"
FT                   /translation="MSSALDEDTRRAIDDGRETAGAMLRAAQKDLQKVFIVFLVGFLGT
FT                   FYALRLYVWGFLESVTRRNMNQVINQDLEIIAQTPFDVVLLQAKIGLVTGLIIAAPVFI
FT                   YFSRDALRERDLWPSAPVPRWQLALIGTGMVVLFSLGVAYGYLFFFPITFEFLAQNTVN
FT                   IGFSPKYSIVKWAQFMFLLTVSFGLASQLPLVMTILSYAEIVPYETFRDQWRYAVLGVF
FT                   AAGALFTPPDPFTQILWAVPVLTLYGISLYISKVVVTARRGSEQLDFRAAIGKRWNLVV
FT                   GSTALGGAVVYLYYTYGGPTAVNGLLDSVGSDYSIPALGTVLGVAPQTALIVWSVVGAT
FT                   VFTVIGLGYVVYKDIEESVGPLERGVGDPSKIDLRELDAMGVRAAPPEAFTDLSEDEAM
FT                   AIAGDALDDGDKDKAQAIVDRFDEAEEGQNADAEAAAGADADDQPGELEDRATRAGGTF
FT                   LSELTDGETDEDDIGGYYKDLAFIFETITSKTFRIVAVFMAALAGTFTWLYTVGFKAVF
FT                   QQFLNRLPAEVRPNEVLNVVTLHPMEALLFEVKFSTLVAIIVTLPLVAYYAWPALRERN
FT                   IVRRRRSTIFLWTGSLVVGLLGGLVLGYFYIAPAVISWLVNDAVQANMIISYRVTDFFW
FT                   LIFFTTAGIGLLADVPILMVLLNGSGITYQVLRSRWREVTVGILTFAALFTPAGIVSMF
FT                   LVTIPLMVAYGVGLAVLFVVTLGGRRNLAPARDSI"
FT   gene            31411..32820
FT                   /locus_tag="Hbor_00400"
FT   CDS_pept        31411..32820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00400"
FT                   /product="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /note="PFAM: Sec-independent protein translocase protein
FT                   (TatC); TIGRFAM: Twin arginine targeting (Tat) protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65653"
FT                   /db_xref="GOA:E4NRH7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH7"
FT                   /protein_id="ADQ65653.1"
FT                   /translation="MADDSESDRPSSDADESVDSSPDDTETPEPSDTPTEEASAPSDDS
FT                   DSGDFDSDGATDDVDDVTLEREDLIPPPDEESDGMETAGGTETDAADAEPDSEADSGTD
FT                   AEDDSGTDAEDDSGTDAEDDSGTDAEDDSGTDAETDNGSEDDTGTDAEDLWPDDHEPPK
FT                   TKTAEEMGLTDDESEEAITNTDGGAPANATIDGTDPEPPAEISDDGVFGDGPESDEEMP
FT                   LADHIEEMVRRLAVVFAIGGIITLILYPGADLANSALHLNLTSSTDVINFLWNKHIPGA
FT                   PEIAERRPRVYGPLELVLTELKVAGLAGLVIGLPVFVYETYLFMRPGLFPKERRYYLAA
FT                   VPTSLILAFIGIAFAHFVVLPTLIKYFTSYTQGTAVIAFGLKETFNLILILMGYNAIIF
FT                   QIPLFIMLAIMMNLVTRQWLVARRLIFWASFLGLAFFVSPDPTGMAPIIIAATMITLFE
FT                   GTLLLLRWTGN"
FT   gene            complement(33145..34053)
FT                   /locus_tag="Hbor_00410"
FT   CDS_pept        complement(33145..34053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00410"
FT                   /product="conserved hypothetical protein TIGR00268"
FT                   /note="PFAM: Asparagine synthase; TIGRFAM: conserved
FT                   hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65654"
FT                   /db_xref="GOA:E4NRH8"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH8"
FT                   /protein_id="ADQ65654.1"
FT                   /translation="MPDADTSDDLEPALAEKAAAARASLEERDGVLIAFSGGVDSSVVA
FT                   ALAHDALGDDAIACTAKSETLPTEELDDARRVADEIGIRHEIVEFSELDNPDFVANDGD
FT                   RCYHCRTMRLGRMYDAARERGIETVCDGTNASDPGEGHRPGLRAVEELEVLSPLLTHDI
FT                   SKEEVRAIADSYGLSVADKPSMACLSSRIPTGIEVTEERLSRVEKAERVVRQWGFSQFR
FT                   VRDHDGLARIEVASEELETALDPDFVTAVRDRLTDLGFDHVTLDLHGYQTGSVSPAADT
FT                   DADAAGEPLVEDVFATDYPTK"
FT   gene            34227..36215
FT                   /locus_tag="Hbor_00420"
FT   CDS_pept        34227..36215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00420"
FT                   /product="DNA mismatch repair protein, MutS family"
FT                   /note="PFAM: MutS domain V"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65655"
FT                   /db_xref="GOA:E4NRH9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR012401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRH9"
FT                   /protein_id="ADQ65655.1"
FT                   /translation="MEFEAIPGVGEKTAEALSELDDAERALADGDVAALARAPGLTEGR
FT                   AAAIARGAIRRRHDDDGRFLATDRAREVYRDVLSLLRERTVTTYAEKRLETFFPTASAS
FT                   RIEEVRAFTESAMERDPDPVVLAALEGVEPLEPASGIRVRERCLATADAERYAAAKEAF
FT                   PELSVEVVEDARGLSELARSYATVVALDEAFAGVDVEGDVRVRPDAAEHPDEIVPERVL
FT                   AFFAQNRERIRAAADVHEAAELDAPCDLDSLRDALSRLDDDGTIVGDEELDRLTNAVDD
FT                   VDAAVSTAESVANDHLRDAIRERDVTIEGTDFLSLVEQGARVDSLLSRELEDQYADAVA
FT                   TAREHLIESLSLRPEEADIATRVFSDDPSFPVDYDEELVSRLRAELKAGRDRRAVRLKR
FT                   ELAADLSALREPVGEMVSNALELDVELAVSRFARDFDCVMPTITDGDTASGTGFSIEGG
FT                   QSPLLDVSFEAAEPVDYGVSGVTLLSGVNSGGKTSTLDLVALVVVLAQMGLPVPAERVE
FT                   LERFSELHYYAKSQGTLDAGAFESTLRDFRELVDGESNRLVLVDELESITEPGASAKII
FT                   AGILEALDDQAATAVFVSHLADEIREAAGFTVAVDGIEAVGLENGELVVNRSPVKDHLA
FT                   RSTPELIVEKLAGEDGSGFYDRLLEKF"
FT   gene            36252..36650
FT                   /locus_tag="Hbor_00430"
FT   CDS_pept        36252..36650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65656"
FT                   /db_xref="GOA:E4NRI0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI0"
FT                   /protein_id="ADQ65656.1"
FT                   /translation="MVPDDTVTSTSSTTIERDTDRSATDSAANTDVRAAVADGGAGPSS
FT                   AANPTPPSDSAYDQVYQATKDAIWYVVGTVTLALFHFVLALIALAVAWDGVATITGSQA
FT                   SQADIAVGIIAASVFLFSSYRVYVLMTE"
FT   gene            36836..37936
FT                   /locus_tag="Hbor_00440"
FT   CDS_pept        36836..37936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00440"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); CDC6, C terminal; TIGRFAM: orc1/cdc6
FT                   family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65657"
FT                   /db_xref="GOA:E4NRI1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI1"
FT                   /protein_id="ADQ65657.1"
FT                   /translation="MLSWDETVFRDEHVFEIDYVPETFNHRETQLQSLKYALRPAVRGS
FT                   RPLNTIVRGPPGTGKTTAVQKLYGELGTQSGVRTVRVNCQVDSTRYAVFSRIFEHIFEY
FT                   EPPSSGISFKKLFGQITDRLVEEDEVLAVALDDVNYLFYENEASDTLYSLLRAHETHSG
FT                   ARIGVIIVSSDLALDVIEELDGRVQSVFRPEEVYFPVYGVDEIFEILRGRAKRGFHDGV
FT                   IGEPELDRVAELTAESGDLRVGIDLLRRAGLNAEMRASRSVTLEDVEAAYDKSKYVHLS
FT                   RCLRGLSDSERALVRVIAEYDGEQAGTVYEAFHDETDLGYTRYSEITNKLDQLGIIDTE
FT                   YAEIEGRGRSRSLSLAYDPEAVLDRL"
FT   gene            38019..38705
FT                   /locus_tag="Hbor_00450"
FT   CDS_pept        38019..38705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00450"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="PFAM: Ribose 5-phosphate isomerase A
FT                   (phosphoriboisomerase A); TIGRFAM: ribose 5-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65658"
FT                   /db_xref="GOA:E4NRI2"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI2"
FT                   /protein_id="ADQ65658.1"
FT                   /translation="MKTTGGTDDQKRRAAERAADLVETGATVGLGTGSTAAFAIRALGR
FT                   AVEDGLDIRGVPTSFASRELAREEGIPLVAVDEVETIDVAIDGADQLDGDLNLIKGGGA
FT                   AHAREKIVDAMADRFVVVADPSKVTETLERAVPLEVLPDARTAAAARVSELDGEATLRR
FT                   AERKDGPVVTDNGNLVLDCEFGQISDPESLAADLSATPGVVEHGLFVGLADEAYIGTDD
FT                   GVDVQS"
FT   gene            complement(38702..39514)
FT                   /locus_tag="Hbor_00460"
FT   CDS_pept        complement(38702..39514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65659"
FT                   /db_xref="GOA:E4NRI3"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI3"
FT                   /protein_id="ADQ65659.1"
FT                   /translation="MSRTRRFALSFALFVAAAVVTPVAVGLIAADVSLVALAGVSTVGF
FT                   VLTAGVGYRFGTDDTAARIGKSRFGPAFVLSPATLDALFVGYYLLTDTLSVSLALVLGA
FT                   GILVGFVTGVIVWNGAATEHAARARAGRTAVTTWEARPPDAWWRKSSVVVASGLTALIV
FT                   STVAAFTVAPWLSSLLPFVGGLFGGMLGSISQLKQSRSYLAYENGVAVEQGGVTAFYGW
FT                   DQITAIDRTDDAVVLRRHRPWTNFSARSEDIDGSGELTATLRELRASA"
FT   sig_peptide     complement(39428..39514)
FT                   /locus_tag="Hbor_00460"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(39598..39765)
FT                   /locus_tag="Hbor_00470"
FT   CDS_pept        complement(39598..39765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65660"
FT                   /db_xref="GOA:E4NRI4"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI4"
FT                   /protein_id="ADQ65660.1"
FT                   /translation="MADLIVKAAVKEALNDKNVASDFYDALDEEVKELLEDAARRAEEN
FT                   DRKTVQPRDL"
FT   gene            39998..40771
FT                   /locus_tag="Hbor_00480"
FT   CDS_pept        39998..40771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00480"
FT                   /product="NCAIR mutase-like protein"
FT                   /note="PFAM: AIR carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65661"
FT                   /db_xref="GOA:E4NRI5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI5"
FT                   /protein_id="ADQ65661.1"
FT                   /translation="MRDILEAVASGDLDPAVAEARLSGYATTGAGRFDAARETRRGVPE
FT                   AILADGKTPDEAATLAAAAVKSTGRAILTRADDTHVDAVVDTLNEEVTFHRDDRARTLV
FT                   AHAPDFDPPTRDATVGIVTGGTSDAEAAGEASVILEEMGATVTRVEDVGVAHLGRVIDH
FT                   LDTLRAADVLVVAAGREGALPTVVAGLVDTPVIGLPVSTGYGHGGSGKAALEGMLQSCT
FT                   VISVVNIDAGFVAGAQAGLIARAISDARTGNDQAD"
FT   gene            40981..41130
FT                   /locus_tag="Hbor_00490"
FT   CDS_pept        40981..41130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65662"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI6"
FT                   /protein_id="ADQ65662.1"
FT                   /translation="MPTCDHCGSHVSERFARVFADVEGRILACPNCSANAGIAEVARQR
FT                   TRTA"
FT   gene            41266..42102
FT                   /locus_tag="Hbor_00500"
FT   CDS_pept        41266..42102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00500"
FT                   /product="5''/3''-nucleotidase SurE"
FT                   /note="PFAM: Survival protein SurE; TIGRFAM:
FT                   5'/3'-nucleotidase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65663"
FT                   /db_xref="GOA:E4NRI7"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI7"
FT                   /protein_id="ADQ65663.1"
FT                   /translation="MSDGYTILLTNDDGIDAPGIATLREELTSLGDVTVIAPDGNRSGV
FT                   GRTRNHTAVVREHPWGYALSGTPADCVAYGLRGLDTDFDVVVSGVNDGPNAGNYVVGRS
FT                   GTVGAGIEAAFLGTPALAVSAFHTTDFFLSPPEEYDFSRPARVAVGLVERALDSGVYDD
FT                   VDLLNVNAPVDSPNPPVMLTEPYHDYGQQVEEVEDEDDELGPDERRVELRDRTWPDAVG
FT                   WENPFPLAETHRERYPVGTDRRAMVDAAVSVSPLTVSHGVADSARLADVIETFEVE"
FT   gene            42125..42373
FT                   /locus_tag="Hbor_00510"
FT   CDS_pept        42125..42373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00510"
FT                   /product="predicted endonuclease containing a URI domain"
FT                   /note="PFAM: GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65664"
FT                   /db_xref="GOA:E4NRI8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI8"
FT                   /protein_id="ADQ65664.1"
FT                   /translation="MGDHYVYVLRCSDDSLYTGYTTDVDRRVAEHDAGEGAKYTRGRTP
FT                   VELVHTEAFDSRSTAMSREYEIKQLSRRQKERLIDAE"
FT   gene            complement(42384..42944)
FT                   /locus_tag="Hbor_00520"
FT   CDS_pept        complement(42384..42944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00520"
FT                   /product="predicted flavoprotein"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65665"
FT                   /db_xref="GOA:E4NRI9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRI9"
FT                   /protein_id="ADQ65665.1"
FT                   /translation="MTRIVAICGSRREGSYTRKSLEIVLDAARDAGAETTMVDLGDVDL
FT                   PLFHPDKDEQGESERLTRLVRKADGVIIGSPVYHGSYSSTFRNFHDYCSKDEYEDTAVG
FT                   LVATAGGGSYGGALEHMRSTIRGVHGHVVPEQVGVRGAYNVYEGDELTDEDVRRRLVSL
FT                   AESVVAEARRLHPEAAQTARADD"
FT   gene            43044..44417
FT                   /locus_tag="Hbor_00530"
FT   CDS_pept        43044..44417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00530"
FT                   /product="phosphomannomutase"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucomutase,
FT                   alpha-D-glucose phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65666"
FT                   /db_xref="GOA:E4NRJ0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ0"
FT                   /protein_id="ADQ65666.1"
FT                   /translation="MDAISFGTDGWRATLDTFTDERVRIVGQAVADYLSDEGYEAPVFV
FT                   GYDARDTSLGFAESLAEVLAGNGFDVLLPDRDRPTPLVAHAIVERNLAGALMVTASHNP
FT                   PEYNGVKFIPADGAPALPYVTEAIVERLAEPDLLPEDERGSIEEVDIVTPHFEHARELV
FT                   DADLSGLTVVHDAMHGSGRGVTSALLESAGAEVVSIRDERDSDFGGTPPEPSAENLEPL
FT                   VEAVEEHDADLGVANDGDADRVAFVTPERGHLDENLFFAAAYDYLLAEESGPAIRTVST
FT                   TFLIDRIAEAHGQEVFETAVGFKWVADAMKEHDALMGGEESGGFSIRGHVREKDGVLMG
FT                   LLGAAATADEPMDERVDRLLDAHGDIVADKISLDCPDSEKERVIDELDDELPDRVAGRD
FT                   IEKVVTLDGFKLLLEDGSWLLARPSGTEPKMRVYAEASSEDDVRELLEAGRKLVAPLI"
FT   gene            complement(44410..44811)
FT                   /locus_tag="Hbor_00540"
FT   CDS_pept        complement(44410..44811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00540"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65667"
FT                   /db_xref="GOA:E4NRJ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ1"
FT                   /protein_id="ADQ65667.1"
FT                   /translation="MRLARSDDRAACVELLDAAMLEVESDRVRRRIEDGDVLVADANGR
FT                   VVGVCVLVRRDDATAITQIAVHRSRRARGIGRRLVETAASRTDGPVTATFRRQVRPFYE
FT                   ALEFEITAIDEGTGDGENADGGRFRGVLR"
FT   gene            complement(44871..45350)
FT                   /locus_tag="Hbor_00550"
FT   CDS_pept        complement(44871..45350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00550"
FT                   /product="Peroxiredoxin"
FT                   /note="PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65668"
FT                   /db_xref="GOA:E4NRJ2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ2"
FT                   /protein_id="ADQ65668.1"
FT                   /translation="MSTTTAPLDFELPNVGAGPDTFSPADADAEYLVLLLQRDYYCKKC
FT                   RRQVQSAKRRYDEFQDANAEVVSVLPEPTDRTKKWQTSYDLPFPLLADEGKEVGDAMDQ
FT                   PERFGVLGSLHDLVGRMPEALVLDVETGEVLFDHAGDSPGDRPDIDELLAAIPSA"
FT   gene            complement(45428..45634)
FT                   /locus_tag="Hbor_00560"
FT   CDS_pept        complement(45428..45634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65669"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ3"
FT                   /protein_id="ADQ65669.1"
FT                   /translation="MHVSVEVVGEETHEIRVEDDDTYADLVRAVDLSPHEVSVLVDGSP
FT                   VPEDQPVAVERVKILRLIKGGAY"
FT   gene            45730..46716
FT                   /locus_tag="Hbor_00570"
FT   CDS_pept        45730..46716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00570"
FT                   /product="replication factor C small subunit"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); Replication factor C"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65670"
FT                   /db_xref="GOA:E4NRJ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR023748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ4"
FT                   /protein_id="ADQ65670.1"
FT                   /translation="MSEAADAEEAATGREIWIEKYRPQTLDDVYGQEDIVERLRSYIEQ
FT                   DDLPHLLFAGPAGVGKTTSATAIARAIYGDDWRGNFLELNASDERGIDVVRDRIKNFAR
FT                   SSFGGFDYRIIFLDEADSLTSDAQSALRRTMEQFSDNTRFILSCNYSSKIIDPIQSRCA
FT                   VFRFSPLGDDAVREQVKDIAETEEIELTEDGLDALVYAAGGDMRRAINSLQAAATTGEI
FT                   VDEEAVYLITSTARPEDIEEMVQSAIDGEFLTARSKLETLLVDTGMAGGDIIDQLHRSV
FT                   WDFDLDERTTVRLMERIGEADYRITEGANEQVQLEALLASLAAATDD"
FT   gene            complement(46748..48979)
FT                   /locus_tag="Hbor_00580"
FT   CDS_pept        complement(46748..48979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00580"
FT                   /product="PAS domain S-box"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65671"
FT                   /db_xref="GOA:E4NRJ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ5"
FT                   /protein_id="ADQ65671.1"
FT                   /translation="MRGLEQLRLAVDDSTACEDLLLSSDIGVSIVAIEDDEPVDAVVVT
FT                   DPTADVEFDAPVICYADCDPESVPRPERFDAFIRRGDGASLETQLRWLVARSTHTADNL
FT                   TRLRRLYEGSSRLIAAETTDELFERTIDIADRILAFDNSSISIDVGDGFRIRSTRGDFD
FT                   EDDRIPYDAGLLGETYRTGESRLINDIRTDETAAPHDPEYRSVISVPVGDIGVFQAIST
FT                   EVGAFDEMDHHLAELLVSYVAETAARIESEKALRESRSRVEALHRGTIDLAAVTDLGEL
FT                   FDRTVAVADEILSFDMSYIGVVKDGLIVPAAMSKRFPEDGAEPLSVEDGSVAADVYQTG
FT                   KTRLVEDMDEADDANPVKDAYRSGLSVAIGDFAVFQAAAYTPRAFDEADAELTELLMAH
FT                   VAVTAERIRAEENLREERDRSTALFEHVSDAAVAYEVDDESGVACIQSVNNAFEEQFGR
FT                   RDIDIIGDDLLAEIVPDSERDPPELCVADGERHRSEVQRLADGQTREFILNVVPLDPNA
FT                   ADGVGYALYTDITERKQRESELERQNQRLEEFANIVSHDLRNPLAVAQGHLELAREVNR
FT                   EESFDAVADALDQMEELIDDLLSLARQGEVVGETTAVDVGAIARRAWDTVETADGTLKI
FT                   SSATMDADTERLAELFGNLFRNSVEHNDGDAGVTVRVGPLDDGFYVEDDGSGIAADRRE
FT                   VVFEPGETTGDDGIGYGLAIVSRIAEAHGWSVAVTESAAGGARFEFRVE"
FT   gene            complement(49075..49563)
FT                   /locus_tag="Hbor_00590"
FT   CDS_pept        complement(49075..49563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00590"
FT                   /product="tryptophan-rich sensory protein"
FT                   /note="PFAM: TspO/MBR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65672"
FT                   /db_xref="GOA:E4NRJ6"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ6"
FT                   /protein_id="ADQ65672.1"
FT                   /translation="MEIRASIRNRPVVEWLAWVLLSELAGLIGGVATASAVETWYTTLA
FT                   QPSFAPPDWVFGPVWTTLYALMGTAAFLVSRSDDSRTRPALYAFVGHLVLNVSWSLAFF
FT                   GLQSPLYGLVVIVPLLVAIVAVTALFGRVDRRAAALMLPYLVWVAFATALNYQFWTLN"
FT   sig_peptide     complement(49456..49563)
FT                   /locus_tag="Hbor_00590"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            49776..52544
FT                   /locus_tag="Hbor_00600"
FT   CDS_pept        49776..52544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00600"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="PFAM: DHHA1 domain; Threonyl and Alanyl tRNA
FT                   synthetase second additional domain; tRNA synthetases class
FT                   II (A); TIGRFAM: alanine--tRNA ligase; alanyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65673"
FT                   /db_xref="GOA:E4NRJ7"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ7"
FT                   /protein_id="ADQ65673.1"
FT                   /translation="MSELESEYRLDYFEEEGFYRKQCPVTDAYFWTRDPDRETCGEPPA
FT                   DDYSFIDNPGFGEEYTIEEMREEFLSFFEEHDHERIEPYPVAANRWRDDVLLTQASIYD
FT                   FQPLVTSGQTPPPANPLTISQPCIRMQDIDNVGKTGRHTMAFEMMAHHAFNAREEVDDQ
FT                   YAYSGEVYWKDRTVELCDEFFEHMGADLEEITYIEDPWVGGGNAGPAFEVLYQGAELAT
FT                   LVFMSMEQDPEGEYEMKDGNRYSPMDTYIVDTGYGLERWAWVSQGTATVYEAVYPDMIQ
FT                   FLKENAGISLTAEEEELVHRAAKLSGYLDIDEVDDVYEARVDIADELGVDADELAELLR
FT                   PLEDIYAIADHCRTLAYMFGDGIVPSNVGTGYLARMVLRRTKRLVDSVGVDAPLDELVD
FT                   MQAERLEYQNRDTIRDIVRTEERKYRETLERGTRKVQSLADDYADREESIPVTELIELY
FT                   DSHGIQPDMVADIAEERGATVDVPDNFYSLVADRHEGEGATEAAEEREERLADLPDTEK
FT                   LYYDDQERTEFEAVVLDVIEREEGYDVVLDQTMFYPEGGGQPADHGTISTDDKTVQVSD
FT                   VQIRDGVVLHRTDEDPGKGEFVRGQLDVERRRRLMRHHTATHVVGHAARQVLGDHIRQA
FT                   GAQKGTDRARFDITHYERITREEVKQIEQVANEIVMQNIAVKQEWPDRHEAEDKYGFDL
FT                   YQGGIPPGRNIRVITVGDDVQACGGTHVKRTGDIGSIKILTTEPVQDGIERIVFAAGDA
FT                   AIEATQETEDALYEAAEVLDVNPEDVPDTAERFFTEWKERGKTIDRLKSELAEARAAAE
FT                   TEEIDVSGTPAVVQRLDGDADELRATANAIVDEGKVAVLGSAAGGSAQFVVGVPDNVGI
FT                   NAGEVVGQLAASVGGGGGGPPDFAQGGGPNVEKLDETLDEAPDVLRQVLDA"
FT   gene            52631..53224
FT                   /locus_tag="Hbor_00610"
FT   CDS_pept        52631..53224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65674"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ8"
FT                   /protein_id="ADQ65674.1"
FT                   /translation="MELTERVTQETRDATSVLVLRPQLQAGSDATCKRLLVGDSRPVHL
FT                   LGICFSTSPTQWYDQWEQVLGGPPADAAVITTPDSFVDDKPDGLVVETVGNPADVTGIG
FT                   MQATKYLNSWEEDDATVVVALDSLTLMLQYVSLETLYRFLHVLTRRLDVLGATGLFFLD
FT                   PSAQDQKTVNTLKTLFHGVLSYEEQAGDWQLRTQ"
FT   gene            53302..54066
FT                   /locus_tag="Hbor_00620"
FT   CDS_pept        53302..54066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00620"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: TAP-like protein; alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65675"
FT                   /db_xref="GOA:E4NRJ9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRJ9"
FT                   /protein_id="ADQ65675.1"
FT                   /translation="MASNDGVSCYYERDGDGDPVVFVGDAGYGAWQWGWQHAAVAGPYE
FT                   SVVTDVRGAGRSDAPPGPYSIADLVTDLTSVLSDAGFRSAAVVGAGLGGIVGLEAARTT
FT                   ARVDRLVCLGSAATGDQLDLESLYAPPNDRDGLKQSLKAAFSDRFVEEQPDAIQQMIAW
FT                   RSEEDASPRAWEAQIAAIRDYALDAAYEVTTPTLVVHGTDDAVWPVERGRELAESLPRG
FT                   EFAAVEDAGHLAHIEQSKRVNDELLAFLADDE"
FT   gene            54147..54851
FT                   /locus_tag="Hbor_00630"
FT   CDS_pept        54147..54851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00630"
FT                   /product="GMP synthase family protein"
FT                   /note="PFAM: Glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65676"
FT                   /db_xref="GOA:E4NRK0"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK0"
FT                   /protein_id="ADQ65676.1"
FT                   /translation="MKQGHGNLRFALLDASHGDSNTRRNFRRELDADLAEFDATEGELP
FT                   SHFDFDGVVVTGSRASVYWDEKWIPPLAEYVADAAEHDMPILGVCYGHQLLATALGGHV
FT                   QDMGEYEIGYREVSQTAEDELFEGIDETFTVFTTHSDAVAELPEGAELIAENEYGVHAF
FT                   RKGHAWGVQFHPEYDPDTAAEVTKGKDLPDERIQSVLDGITAENYDAACEAKRLFDNFT
FT                   AYARRIRSEATA"
FT   gene            55116..55406
FT                   /locus_tag="Hbor_00640"
FT   CDS_pept        55116..55406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65677"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK1"
FT                   /protein_id="ADQ65677.1"
FT                   /translation="MSASAHDCPTELDLTHEEAWALHAALLVSIEDAVEAGEDPDELVS
FT                   FLTRVEENADFECDELASLVEVLRSYVNGQAPSRDRRPARNAINNIQTALA"
FT   gene            55513..55833
FT                   /locus_tag="Hbor_00650"
FT   CDS_pept        55513..55833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00650"
FT                   /product="ferredoxin"
FT                   /note="PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65678"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK2"
FT                   /protein_id="ADQ65678.1"
FT                   /translation="MGIDPNFDQNRERVGEENDVPVWGPVEPPEKLGIHGTHVAVDYDI
FT                   CLADGACLENCPVDVFTWVDTPDHPVSEQKVEPTREDQCIDCMLCVDICPVDAIDVDAS
FT                   RA"
FT   gene            55930..56385
FT                   /locus_tag="Hbor_00660"
FT   CDS_pept        55930..56385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00660"
FT                   /product="ferritin-like protein"
FT                   /note="PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65679"
FT                   /db_xref="GOA:E4NRK3"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK3"
FT                   /protein_id="ADQ65679.1"
FT                   /translation="MTSNEVTDLLKKAYQDELETVMNYLTNSIVLDGVRAEEIKGSLQA
FT                   DIQEELNHAELLGNRLKQLDEKPPGSAEFEANQMNLQPPADSTDVLSVIEGVLTAEEDA
FT                   ISTYRDLIAAAEEANDPVTEDLAVTVLADEEAHRTEFRGFRKEYKKD"
FT   gene            complement(56419..58536)
FT                   /locus_tag="Hbor_00670"
FT   CDS_pept        complement(56419..58536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00670"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65680"
FT                   /db_xref="GOA:E4NRK4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK4"
FT                   /protein_id="ADQ65680.1"
FT                   /translation="MTILQSEPTRETFWTISPVGEVVFYALATTAILVFLYGVYERFSR
FT                   YTQGEEDAFERLDDLPGRIARASKVVFSNEKQFDRDLYGGVMHAFILWGFLTLLIGTTI
FT                   LFIDMDIYRKLTGMSFFKGDFYLSYSFVMDALGFLFVIGVGMAIYRRYVVREKRLWGKH
FT                   TGREDDLFIWTLFVLGAGGYVIEGLRILGTEFPDWETVSFVGYFVAIVFETAGMSPGTA
FT                   EMLYWAGWWSHALIALGFVAFVPYAKPFHMISSFANVVTADEKAGKRLPGVPEDESPDE
FT                   IGYTSIEDLSWKQILDTDACTKCGRCSSVCPAKESGRPLDPRDVILDLKQYREDLDAGR
FT                   TEEIDIVADGGTSVIDSSTMESCMACMACMDACPVDIEHLSHFTEMNRRLTETGQTQEP
FT                   VQEAMMNIFQNGNAFGNPARKRPDWTRDLDFEVPDAREEEVEFLWYVGDYPSYDERNRR
FT                   VARSLARLFELTGVSYGILYEDEQHDGNDVRRVGEEGLYEMLVEDNADAIHDCEFDKIV
FT                   CTDPHSYNTFLNEYPEMDPEFDYPVFHYTQVVESLVESGRVGLDGTEINYTVTYHDPCH
FT                   LGRYNDEYEAPRELVRATGATLAEMPRNRSDSFCCGGGGGGLWMELEEETKPSEERLRE
FT                   ALEDTDAGAAVEKFVVACPMCATMYEDGRKTGDYEDDIEIIDIAELLVEALESKQGASV
FT                   ESDGTASTAAD"
FT   gene            complement(58618..59325)
FT                   /locus_tag="Hbor_00680"
FT   CDS_pept        complement(58618..59325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00680"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ"
FT                   /note="PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65681"
FT                   /db_xref="GOA:E4NRK5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK5"
FT                   /protein_id="ADQ65681.1"
FT                   /translation="MILTYHPGDSLAHRLDPRTKLFVQAAFALAIFAHTTPRGLAVFTV
FT                   VTGGILAAGRVSPADPIRGFAPALPFLLIAPLVRTVSLSPLGIDPAAAVEPALASYRVL
FT                   LVLVVSGVYLRTTSVRDSRAAVERLLPGRIGRFFGVGVALVFRFFPVLLADLRRVREAS
FT                   KARLGNERSLSERMRIIGTAGVRRAFARSDRLSLALRARCFAWNPTLPGLRLERRDYPV
FT                   LVVGVAFVASVFV"
FT   gene            complement(59322..60026)
FT                   /locus_tag="Hbor_00690"
FT   CDS_pept        complement(59322..60026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00690"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65682"
FT                   /db_xref="GOA:E4NRK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK6"
FT                   /protein_id="ADQ65682.1"
FT                   /translation="MTISTDSLTHRYGDTVAIDEVSLEIEAGEFVVLAGANGSGKTTLV
FT                   RHFNGLLEPDTGDIAVNGQPVSENPVAARTAVGMVFQDPRDQFVAATVGADVAFGPENL
FT                   GLPRAEIDDRVADALDAVNLRGRRNERIDELSGGEQERVAIAGALAMHPDHLVLDEPFT
FT                   GLDAPARNAVMDRLTALHGNGTSIVVVTHDLRDVQTLADRVVVLSDGRVVVDETPEQAV
FT                   EQVEQYDVRAPE"
FT   gene            complement(60039..60647)
FT                   /locus_tag="Hbor_00700"
FT   CDS_pept        complement(60039..60647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00700"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65683"
FT                   /db_xref="GOA:E4NRK7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK7"
FT                   /protein_id="ADQ65683.1"
FT                   /translation="MSTNTESVELVGDDVVGNIARAALFAALTGAFAYVSFQNPLSPHP
FT                   VSLQVLGVFLAGIFLGPVWGGASMVLYLTAGAAGAPIFAGGSAGLGSLLGLTAGYLWSY
FT                   PPAAALIGLLVHGVSGLVDPEHVPVARLVGAMVAGTVVIYVFGTVGFAIVQTGGILSAF
FT                   APNVLWDAFVVSALAFVPFEAVKIAAAVGIIRSDAASAE"
FT   gene            60792..61445
FT                   /locus_tag="Hbor_00710"
FT   CDS_pept        60792..61445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65684"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK8"
FT                   /protein_id="ADQ65684.1"
FT                   /translation="MDEKTAELRDIFVETTGSETVTETQEESPGSLTDELSDAERNERV
FT                   ARLVASMRDRYEFETAFSDEDLCRIVRGFYDGDSDAELAAALDAAADESDVFVARMDLH
FT                   LVRDSDRDAPFSLDTLRALLDDGADDETCAAELNTQTDGDATTDDDAGIDAKTVAHYRR
FT                   VVETQREATRANDRFRTEFTELLTDSDLSARLAEDARRDGLQEATEDIETDVSL"
FT   gene            61555..67011
FT                   /locus_tag="Hbor_00720"
FT   CDS_pept        61555..67011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00720"
FT                   /product="predicted ATPase involved in replication control,
FT                   Cdc46/Mcm family"
FT                   /note="PFAM: Helix-turn-helix; MCM2/3/5 family; TIGRFAM:
FT                   intein N-terminal splicing region; intein C-terminal
FT                   splicing region"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65685"
FT                   /db_xref="GOA:E4NRK9"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRK9"
FT                   /protein_id="ADQ65685.1"
FT                   /translation="MAQAPQDPDVDLTERFIQFYRKYYSDDIGRLAQRYPNEQRSLYID
FT                   YDDLFRFDEDLAEDYRKKPDQIREYAEEALRLYDLPVDVKLGRAHVRLRNLPDSVDIRN
FT                   IRVHDDHIGRMVSVQGIVRKATDVRPKITEAAFECQRCGTMTYIPQTDSGFQEPHECQG
FT                   CERQGPFHVDFDQSEFVDSQKLRVQESPEGLRGGETPQSIDIDIEDDVTGEVTAGDHVT
FT                   VTGVLHIEQQTSGQEKTPIFDLYMDGVSIEIEDEEFEDMDISEEDVAEIVELSNDPDIY
FT                   QKMIGSVAPSIYGYEQEKLAMILQLFSGVTKHLPDGSRIRGDLHMLLIGDPGTGKCVAG
FT                   DTRVTVADGSEVPIRKLVEQNLDEPKPVDDGVWDAVDFEVPSMAHDGSITTRRATKVWK
FT                   REAPDRMYEIRTAAGHELTVTPSHPLFVGCDGGTEAVVADNLEAGQFVAVPRSLPTDGD
FT                   NSLDVSIRRSQSNNAVRLDLPDRLTPSLARLLGYVAAEGYVERRDSGSAFVSITNSDRE
FT                   ILDDVADALDELGLRATERSTHDDKTTRELICSSSELVSLLEKIEPALLDGSSEQRVPA
FT                   PILRAKSPVKRGFLRAFVDAEGTVSPSQREVTVSSTSRDVLEGVRSLLLAFGISSQLRT
FT                   KADGSFRLRVSGDDFARYTAQIGLVTERKRRAAEAVVDVDGNTNRDVIPGVGDTLCDLR
FT                   ESLGLEQDDCGLPRSTYQHYERGDRNPSRDSLQTVVQTFSEAAADGLAADGDGGASVER
FT                   CLASLRALADGDIAWDRIESIDPVEPDDEWVYDLEIEGTHNFLTNNVVSHNSQMLQYIR
FT                   NIAPRSVYTSGKGSSSAGLTAAAVRDDFGDGQQWTLEAGALVLADKGIAAVDELDKMRC
FT                   VTGDSLVHLADDGGIKRIRDIAHDAAREGSTEELANGRTIRNFDAEVWSMTDDGKLVSR
FT                   PVTAIHEYDAPDELTRVTLQSGERLTAIHDHPFITFDDGESVEKPAANVSPGDWVFVPR
FT                   RLADRATDGGVRTADSIAGGTVTATENELSPAFGAVLGYLSGDGNVYYDREEGVYGIRF
FT                   TNKEEELLADFERACRDACDAEAIRPPSEQRDDGVETVRLSGKEFADVVLDAGMNLEVY
FT                   DGKAFPTAISAASRATKAAFVRAMADSEGSVDTDSGNVKISSSSYELVLGIKSLLLEFD
FT                   ITTQIQHRERSGKRDLYVLAVTAAESLQRFNRHIGFTLDRKQSALDEVCESVSGDRTIL
FT                   DVIPHCGELLSSLRESLRLYVSECGLVDATDCNFENKDANVSISCARTILDAFESRTQE
FT                   AESDAEQLTEPCDWEILSDIKERYHVSQSELATGTPYSQQQISLLWGADDELRAVTRNR
FT                   LREIVESVVNTDIEPFRHLVRGDVKWRRVKSVETVDESDVDDQIRLLKHELADLLGVKT
FT                   ESAVEYGRSLLDSEPNAEDWDELRVELNRHNVSFADIARDLGVADSTVSRWFNGVVETD
FT                   RFVDVANAARDRFAEIRADVRRYLDTIESRSTPKVYDLTVEGTHNFVANGMVVHNSEDR
FT                   SAMHEGLEQQQISVSKAGINATLKSRCSLLGAANPKYGRFDQYESIGEQIDLEPALISR
FT                   FDLIFTVTDDPDPESDAELAEHIINTNYAGELHTQRSKIANSEFTEAEVNSVTEEVAPE
FT                   IDAELLRKYIAYAKRNCYPTMTDEAKEVIRDFYVNFRAKGADEDSPVPVTARKLEALVR
FT                   LAEASARVRLSDTVTEDDAVRVTNIVESCLRDIGMDPETGEFDADIVETGTSKNQRDRI
FT                   KNLKQLISDIEDEYEEGAPVDEVISRATTELNLDESKAEQEIENLRRKGEVYEPRTDHL
FT                   RTT"
FT   gene            67012..67296
FT                   /locus_tag="Hbor_00730"
FT   CDS_pept        67012..67296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65686"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL0"
FT                   /protein_id="ADQ65686.1"
FT                   /translation="MDRISALRNIEEALRDFESGDSDLAATEQRVVTVLRTYATDFEGE
FT                   EGLAPYQATGEGRAHGLVVVAESSADARDRIYDLLDEERGSLDFEVERL"
FT   gene            67363..67701
FT                   /locus_tag="Hbor_00740"
FT   CDS_pept        67363..67701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65687"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL1"
FT                   /protein_id="ADQ65687.1"
FT                   /translation="MLLVVTYSRGARETLRNVCRTHEETVVRRFGRAALLEETEFGAFL
FT                   ACRLREKHGHDVQVERTEPFNEFADAPDSVREAAEAYESRDVASTPYDKFAVGTDHPPT
FT                   SRMRDRDL"
FT   gene            67698..68573
FT                   /locus_tag="Hbor_00750"
FT   CDS_pept        67698..68573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65688"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL2"
FT                   /protein_id="ADQ65688.1"
FT                   /translation="MRSIRVHLPDGTTHVGSVVDLRDADCDIDADDLSRSVRFGLPVER
FT                   GYPRVISPPPSPVSPFVAHLAREISFDRRGALATLARSRGHVVPEERTLERVESELADV
FT                   TPPEPGDLADARRRAAAAGAETERLQERAAMIRGRVEAVREAGGDIDAAEAELAETMTR
FT                   LSEVATERVAARQRLEMLEARARAARDGREERMRLEDRAANLERAIRRSLAAAVYDDFA
FT                   DAVAALPDSFDADAGDAPGEYEGPPLAAALAVTRVAPLRAPVVADADVLDPFCGLRSFV
FT                   RYLDAPVVLC"
FT   gene            68633..69469
FT                   /locus_tag="Hbor_00760"
FT   CDS_pept        68633..69469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65689"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL3"
FT                   /protein_id="ADQ65689.1"
FT                   /translation="MEYDCTTKTVGGTTLVTVHVRNEAAVPRRVRVRNDLPGPVLPPRQ
FT                   DGVPERGWDDDGYTGVIAADDELTLGYACPGGDETETPVSVESLGRADEERDTEKSSRA
FT                   ELEAEAIRSLGRARPPADAVPTPSVDRQTETDDAPTDAQTRDLESRAESVSTNSRPQSE
FT                   PESTPRQDSGGDSDDATSHNEGDEEYRAEKEITPKPVESWLSAVETRVQHAETVTDATA
FT                   DEAAAVLETAENVSDLPATVAADEDALRAFAARATALAERAADTDAKPVIDALGDR"
FT   gene            69466..70131
FT                   /locus_tag="Hbor_00770"
FT   CDS_pept        69466..70131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00770"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65690"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL4"
FT                   /protein_id="ADQ65690.1"
FT                   /translation="MILAVTGGKGGVGKSTLAFELGAAMDAVVVDADLGMADLPTGPGP
FT                   DLHDVLAGRADAVEAVREDGPVRLLPCGRSLSGARAADVRRLGDSLRAVERAYGDVVVD
FT                   CPAGMKADAGVPLAVADACVIVASPRPYALADAVRTRELARELDAGLVAVAVNRAVEDP
FT                   PEAVFEEVLGAPAVTVPADPRMARTVETGRPVCRIAPSSRAGQAISSLARAVQRCTQV"
FT   gene            complement(70360..71250)
FT                   /locus_tag="Hbor_00780"
FT   CDS_pept        complement(70360..71250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00780"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="PFAM: TFIIB zinc-binding; Transcription factor TFIIB
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65691"
FT                   /db_xref="GOA:E4NRL5"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL5"
FT                   /protein_id="ADQ65691.1"
FT                   /translation="MSEARSPDDATLTTTCPECDGRLHAEGQETVCGDCGLVVSEYTID
FT                   HGPEWRSFADDDRNPKRTGAPLTQSRHDRGLSTEIGRSTRVKGRKRRRLARMRKQHNRA
FT                   RISTKRERNQVYAFTEIRRLTSALSLPERIRDHACSLFKSAQNEDLLRGRSLEGFAAAC
FT                   VYAACRVANVSRTVGEVVAEAKATEAEQSAAYDALNRDLGLPVGPVDPVEYVPRFASRL
FT                   DLSRDVERRAREYAAEAAEQGLSVGRNPSGVAAGCLYTAARDLDVEVTQTEAADVADVT
FT                   PVTLRKTYVALRDDE"
FT   gene            71414..71938
FT                   /locus_tag="Hbor_00790"
FT   CDS_pept        71414..71938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65692"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL6"
FT                   /protein_id="ADQ65692.1"
FT                   /translation="MGLADIADELGVTTTTQEERGVATVDDTDVDLDARLRDHADKLPC
FT                   TPEAAATVLERHAAGDSVGDAAEAAIVAPVTAAKVLHRAGIEGVTPLAPTARQILRDWL
FT                   AGQLSRADALELTGADDAEFALAAYIETHDPVPELADATRRDAAASLGGDALVKKREEL
FT                   ADTMSASTDLF"
FT   gene            complement(71949..72731)
FT                   /locus_tag="Hbor_00800"
FT   CDS_pept        complement(71949..72731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00800"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain-containing protein"
FT                   /note="PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65693"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL7"
FT                   /protein_id="ADQ65693.1"
FT                   /translation="MDDEAVTDERETRPTETTIAAFVGATGGAGTTRCTLEVATALAAD
FT                   GADVGVFDAAFATQGLAAHIPGQIEPDLTALLTEEADAPLSEGLTTLDVETAGRVAVSP
FT                   AFAPFERFARAKTPDAAQRFETRLSAAADRFDYVLVDVPPVASNQAIAAVNVADQSIVV
FT                   APGTTRGADAVQQMRTRLTHVGSEATLVVSTRGTFEGADCDVPETDATEPESVPSCLGD
FT                   DAAFTTAIVELTAAAVGRDVSEAFEGGGLLSGVERYVK"
FT   gene            72867..75140
FT                   /locus_tag="Hbor_00810"
FT   CDS_pept        72867..75140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00810"
FT                   /product="PAS domain S-box"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65694"
FT                   /db_xref="GOA:E4NRL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL8"
FT                   /protein_id="ADQ65694.1"
FT                   /translation="MTRDAETVTVLCVDDEPGSADLTAAYLERHDDRLTVTTATSVQGG
FT                   LNALTETDFDCIVSDYDMPGLDGLAFLEAVRVDRPKLPFILFTGKGSEAVASEAISAGV
FT                   SDYVQKESGTDQYPALARRIHNAVERFRADKHAAKVQEEAKSILENSPDAIVVSVGDEF
FT                   VFANTSAVSLFEADDADDLLGRNLLSLIHKQDTEAVKAVIAHAQDDEKVISQTQRTMKT
FT                   LDGMTFSAEMTVRAITWNGESGHVAILRDVTNQEEQDYERERYAAAFSRAMDAIIVADD
FT                   DDEFIDVNGSAAELFGLPREELLGRNLSEFTPNGSEIDDMWADFQSLGENHGVLSLIRP
FT                   DGERRVVEYAATRDVVPGEHLSVLRDVTGRTRLERQRQADHEALERMYRITADREAAFE
FT                   EKVSALLELGADYLDVPYGFLTRIQDGTQTIIESVGDHELLQPGETGPLSKAYCRKTVI
FT                   EDELVSVQNSEAEGWEDDPAYERYELGCYIGAKVIVNEDLFGTLCFAGTASRKQAFSHG
FT                   EEAFVELLARWVSYEQEHRRNNRELQSQTERLEEFASMVTHDLRNPLSVASGYLELARE
FT                   DGDPEQFDRIEDALSRMERIIGDLLYLARENEQIRETEPVELESAVERAWQTVDETTHE
FT                   ATLSVDGDIGTIEADQNRLCQLLENLFRNAIDHVGTDVRVRVGSLDDGFYVEDDGPGIP
FT                   ESERDNVFEQGYTTRNDGTGFGLSIVTEIVEGHGWSIAVTEGELGGARFEISDVHSDEK
FT                   PDAA"
FT   gene            complement(75137..75625)
FT                   /locus_tag="Hbor_00820"
FT   CDS_pept        complement(75137..75625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65695"
FT                   /db_xref="GOA:E4NRL9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRL9"
FT                   /protein_id="ADQ65695.1"
FT                   /translation="MTLEQSRSEECASRAVEEESNEPVSAPRVDAAECAAAFLIPILVA
FT                   AVWMLAAGAGLKVLLGGGTVGWMIVRVRLRFRAVRTADGIKRQRCPTDEGWGMQFADWE
FT                   YDPKWDRRLAAVLAVIGAGAFVAIPVVDAPDGILLRLVVIGHVSLICALAVFGVAQRD"
FT   gene            complement(75622..75987)
FT                   /locus_tag="Hbor_00830"
FT   CDS_pept        complement(75622..75987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65696"
FT                   /db_xref="GOA:E4NRM0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM0"
FT                   /protein_id="ADQ65696.1"
FT                   /translation="MPSTVADRISLPRLVIFVVLGVIAAAFVVTTDRAITVEYVSLTVL
FT                   VAIFFGASIFDAVREHPLFNLASAVYTALLFGLLTIIWGPNVFILALTGLAVVGVAVEL
FT                   YNYRHGTSYLRVEPDNR"
FT   gene            complement(76074..76493)
FT                   /locus_tag="Hbor_00840"
FT   CDS_pept        complement(76074..76493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00840"
FT                   /product="HIT family hydrolase, diadenosine tetraphosphate
FT                   hydrolase"
FT                   /note="PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65697"
FT                   /db_xref="GOA:E4NRM1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM1"
FT                   /protein_id="ADQ65697.1"
FT                   /translation="MGEPTIFEQIAAGDIPARIVYETDTVLAFLDANPLAPGHTLVVPK
FT                   EAHERLRDLPDDVATDLWAAVDELTPRVEDAVDADALTVGVNDGEAAGQEVPHVHVHLV
FT                   PRFDGDGGGPIHAVAGSRPDLSDEELDDIAERIET"
FT   gene            76633..77628
FT                   /locus_tag="Hbor_00850"
FT   CDS_pept        76633..77628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00850"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="PFAM: tRNA synthetases class I (W and Y); TIGRFAM:
FT                   tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65698"
FT                   /db_xref="GOA:E4NRM2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023684"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM2"
FT                   /protein_id="ADQ65698.1"
FT                   /translation="MDAYDLITRNAAEVVTEDEARSLADDPDGKRAYVGYEPSGVLHIG
FT                   HMLTANKLIELQEAGFEVVVLLADVHAYLNDKGTFDEIQETATRMQEQFVAYGLEEDQT
FT                   EFVLGSEFQLDDDYTLDLHALELETSLSRAERAMAEIKSGDTVTVAQAVYPLMQALDIV
FT                   YLDVDLAIGGMEQRKVHMLARDTLPSIDADAPTCLHTPLISDLSTGVGKMSSSSGVSIS
FT                   MEDSEEELREKVNKAFCPPSRDPDPDDDGNERDNPVLQIFEYHVFPRFGEVVVERPEQY
FT                   GGNLTYDDYESLAEDLDAGELHPADAKGALANYLNELVAPGREKIQQQRS"
FT   gene            complement(77744..77947)
FT                   /locus_tag="Hbor_00860"
FT   CDS_pept        complement(77744..77947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65699"
FT                   /db_xref="GOA:E4NRM3"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM3"
FT                   /protein_id="ADQ65699.1"
FT                   /translation="MTVAVTRGMFDKLGTKGIAGVVLLVAGIGIVAYQEPIVAAGIALV
FT                   VAGLGLVASGLVQSVMGMFGMA"
FT   gene            78016..78306
FT                   /locus_tag="Hbor_00870"
FT   CDS_pept        78016..78306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00870"
FT                   /product="translation initiation factor 1A (aeIF-1A)"
FT                   /note="PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: eukaryotic/archaeal initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65700"
FT                   /db_xref="GOA:E4NRM4"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM4"
FT                   /protein_id="ADQ65700.1"
FT                   /translation="MSDNENAGRRDLRMPDDDEEFAVVQDMLGANRVKVRCADGVERTA
FT                   RIPGRMQKRIWIREGDVVLVEPWDWQDEKADVTWRYEKSEADQLREEGHIA"
FT   gene            78474..79382
FT                   /locus_tag="Hbor_00880"
FT   CDS_pept        78474..79382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00880"
FT                   /product="serine/threonine protein kinase involved in cell
FT                   cycle control"
FT                   /note="PFAM: RIO1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65701"
FT                   /db_xref="GOA:E4NRM5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM5"
FT                   /protein_id="ADQ65701.1"
FT                   /translation="MTESEEFGLVEPAEAGTPGDEWESIDVTDTEADRIARKRDRKFDE
FT                   FRKRLKDADQFKVEQSVFDDATFAAIYKLVQDGHIDAFGGPISTGKEANVYEALGPEDT
FT                   DVATKIYRINASNFRHMRDYLEGDPRFEGIGNDKKRVVLAWTQKEFANLERARQAGVRV
FT                   PEPIAVERNVLVMELVGLVEDRARRLAEVSVENPQTAYEVVREYMRRLYSAGLVHGDLS
FT                   EYNMIIHDGELVIIDLGQAVTVHHPNADEFLRRDCRNVAKFFSRQGTDTSATDLYEFVT
FT                   DVDADPTGDPDVDERDAGTDE"
FT   gene            79481..80023
FT                   /locus_tag="Hbor_00890"
FT   CDS_pept        79481..80023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00890"
FT                   /product="universal archaeal KH domain protein"
FT                   /note="PFAM: KH domain; TIGRFAM: arCOG04150 universal
FT                   archaeal KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65702"
FT                   /db_xref="GOA:E4NRM6"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM6"
FT                   /protein_id="ADQ65702.1"
FT                   /translation="MQHVKVPQDRIGVLIGEGGETMREIERRAEVRLDIDSESGSVAIE
FT                   EVGDPVTGMVAPDVIRAVGRGFTPEAALSLLDDEMRAFELIDLQQHTRNKNDLQRQKGR
FT                   LIGENGRTRELMEELTGAEVVIRGTTLGIIGQPEEVEAVRRATGMILDGAPHGAVYSFL
FT                   ERKHNELTRDFDIQPSD"
FT   gene            80163..80740
FT                   /pseudo
FT                   /locus_tag="Hbor_00900"
FT   gene            80737..80946
FT                   /locus_tag="Hbor_00910"
FT   CDS_pept        80737..80946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65703"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM7"
FT                   /protein_id="ADQ65703.1"
FT                   /translation="MNATTGETSNVAATATQVLTLALPKTGLQGVSELLLADIGIPRGV
FT                   YRRLGLSYDPPFDGADRVHVRAVD"
FT   gene            81066..82745
FT                   /locus_tag="Hbor_00920"
FT   CDS_pept        81066..82745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00920"
FT                   /product="thermosome subunit"
FT                   /note="PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   thermosome, various subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65704"
FT                   /db_xref="GOA:E4NRM8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM8"
FT                   /protein_id="ADQ65704.1"
FT                   /translation="MSQRMQQGQPMIILGEDSQRTQGKDAQSMNITAGKAVAEAVRTTL
FT                   GPKGMDKMLVDNSGEVVVTNDGVTILKEMDIDHPAANMIVEVSETQEDEVGDGTTTAVV
FT                   IAGELLDQAEDLIEQDVHATTIAQGFRQAAEKAKEVLEGDAIDVSEDDRETLVKIASTA
FT                   MTGKGAESAKDLLAELVVDSVLAVADDDGIDTDNVSIEKVVGGSIDNSELVEGVIVDKE
FT                   RVHENMPYMVEDANVALFDGALEVRETEIDAEVNVTDPDQLQQFLDQEEKQLKEMVDQL
FT                   VDVGADVVFVGDGIDDMAQHYLAKEGILAVRRAKSSDLKRLARATGGSVVGSLDDIEAD
FT                   DLGFAGSVGQKDIGGDERIFVEDVEEAKSVTLILRGGTDHVVDEVERAIDDSLGVVRTT
FT                   LEDGKVLPGGGSPETELSLQLREFADSVGGREQLAVEAFAEALDVIPRTLAENAGLDPI
FT                   DSLVDLRARHDGGEFGAGLDAYTGEVIDMEEEGVVEPLRVKTQAIESATEAAVMILRID
FT                   DVIAAGDLTGGQTGDDDDDDMPAGGAGGMGGMGGMGGMGGAM"
FT   gene            complement(82970..83043)
FT                   /locus_tag="Hbor_00930"
FT   tRNA            complement(82970..83043)
FT                   /locus_tag="Hbor_00930"
FT                   /product="tRNA-Arg"
FT   gene            complement(83094..83504)
FT                   /locus_tag="Hbor_00940"
FT   CDS_pept        complement(83094..83504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00940"
FT                   /product="Domain of unknown function (DUF307)"
FT                   /note="PFAM: Domain of unknown function (DUF307)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65705"
FT                   /db_xref="GOA:E4NRM9"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRM9"
FT                   /protein_id="ADQ65705.1"
FT                   /translation="MFFRAAAVSATMSDRSLLVRALWFVFVGWWATPIVINVAWALNAT
FT                   IILLPLGIKLINLVPTVLTLKEPRSLSEPDSGRGQRSLLVRAVYFVFVGWWLSFLWANI
FT                   AALLAVTIIGLPVAYWMFNRLPYVTSLYRFDG"
FT   gene            83586..84173
FT                   /locus_tag="Hbor_00950"
FT   CDS_pept        83586..84173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00950"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65706"
FT                   /db_xref="GOA:E4NRN0"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN0"
FT                   /protein_id="ADQ65706.1"
FT                   /translation="MKVIGTVGLPGSGKGEAASVAREAGVPVVTMGDVIRNECRERGLD
FT                   PAEHHGRIAKALREEEGLDAIAARSLPLIEAELEDSDVVLVDGLRSEYELDRFEDAFGD
FT                   DFVLVSIEAPFDLRAERLLDRGRDDSDVDREALKEREERELGFGMGTVMDRADVVIQNT
FT                   DSLERFRERIQTLLQDGPDAVESDESEVEGNA"
FT   gene            84170..84589
FT                   /locus_tag="Hbor_00960"
FT   CDS_pept        84170..84589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00960"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65707"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN1"
FT                   /protein_id="ADQ65707.1"
FT                   /translation="MIYSAHARIVVPVRDTEVTDRVEDAVRNIFPNVEFEREAGQIVGE
FT                   THSLEEFSEKLHEQAILDTARREFSKRDDESGFSFALKKQAAFKDVVNFSVGNPDELGD
FT                   IEVHVTVENPSVEEFIDHIAPPTEEGRPVPPDERE"
FT   gene            complement(84626..85672)
FT                   /locus_tag="Hbor_00970"
FT   CDS_pept        complement(84626..85672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00970"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65708"
FT                   /db_xref="GOA:E4NRN2"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN2"
FT                   /protein_id="ADQ65708.1"
FT                   /translation="MQSVESLATLWPIFVEVLPRVARIAVLVAVGVFVANLAVGFGLVE
FT                   YVAGLSKYLTRPANLPDEVGTAILTTAASTTAGYGMLAEFRESGRLSDTATLVAVTINT
FT                   FFGFVQHIFTFYAPVLIPILGLRVGLMYVGARAAISLGITLTGVLAGGMLLSRADARLD
FT                   DVPTDADTDAAVEADGRGPAEFDTPETTRAVIREAGAKTWPKLKRLVPRLAIVYFLVTA
FT                   LVETNAAVWLLERTTGVQTVTDVTGSVTGLLGLPSAAVPVIAVFAFDTTVGAATIAPLV
FT                   GEAFTPRTAVATMLVGGIVSFAVSTFKRSIPFQYGIWGARFGSKVVAVNTALKIVFIGL
FT                   ALVVLLVP"
FT   gene            complement(85724..86281)
FT                   /locus_tag="Hbor_00980"
FT   CDS_pept        complement(85724..86281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00980"
FT                   /product="cation transporter"
FT                   /note="PFAM: Divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65709"
FT                   /db_xref="GOA:E4NRN3"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN3"
FT                   /protein_id="ADQ65709.1"
FT                   /translation="MPTEWTVRAITRAMLPVLLALTLVELGSGLVLGSFEAQLLQYPTL
FT                   LALVPVTIGTAGNLGSILAARLSTAFHLGTLSFDPTDEELVGNAIATVALSVTVFPLVG
FT                   VGAWGLTSLLGGTRLSVWTVLSVSLASGVVLAVLAVVVTLAATYAAYQFELDPDDVVIP
FT                   LVTNSCDVLGVVVLFVSVQVFV"
FT   gene            complement(86282..86863)
FT                   /locus_tag="Hbor_00990"
FT   CDS_pept        complement(86282..86863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_00990"
FT                   /product="cation transporter"
FT                   /note="PFAM: Divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65710"
FT                   /db_xref="GOA:E4NRN4"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN4"
FT                   /protein_id="ADQ65710.1"
FT                   /translation="MTIRDAATEAYREALPALVASLVGGLIAGIVLGGMRAELRDVPGL
FT                   IVLVPALLATRGNVYGSLGARIATALHQGLIEPRVTAGDRRLRAAAAAALGNGLLASAF
FT                   AAVAVFLVLSALGNRVAPLPVLVGIAVLAGLLSGAVLIAVVVTVVFAGYRRGRNPDTLV
FT                   GPIVTTTGDVFGILFLLVAVRTVLAIGGVL"
FT   gene            complement(86942..88336)
FT                   /locus_tag="Hbor_01000"
FT   CDS_pept        complement(86942..88336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01000"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="PFAM: SRP54-type protein, GTPase domain; SRP54-type
FT                   protein, helical bundle domain; Signal peptide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65711"
FT                   /db_xref="GOA:E4NRN5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN5"
FT                   /protein_id="ADQ65711.1"
FT                   /translation="MVLDNLGSSLRGSLDKLQGKSRLDEDDVEEIVREIQRSLLSADVD
FT                   VNLVMDLSSSIKERALNEEPPGGTSARDHVLKIVYEELVGLIGESTDIPLEPQTILLAG
FT                   LQGSGKTTTAAKMAWWFSTKGLRAAVIQTDTFRPGAYDQAKQMCERAEVEFYGDPDEED
FT                   PVKIARDGLEATEDADIHIVDTAGRHALEDALIDEIEDIDSAVNPDRSLLVLDAAIGQG
FT                   AKDQARQFDDSIGIDGVAITKLDGTAKGGGALTAVNETDSSIGFLGTGETVQDIERFEP
FT                   NGFISRLLGMGDLKQLSERVERAMAETQEEEDDWDPEDIMKGSFTLKDMQKQMEAMNRM
FT                   GPLDQVLDMIPGLGGGFKDQLPDDAMDVTQDRMRSFDVIMDSMTEAELENPRTIGASRV
FT                   RRIARGSGKDEETVQELLEQHKMMERTIKQFQGMGDGDMQRMMKKLQNQGGGGGGGLGG
FT                   MGPFGD"
FT   gene            88472..89428
FT                   /locus_tag="Hbor_01010"
FT   CDS_pept        88472..89428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01010"
FT                   /product="phosphoglycerate dehydrogenase-like
FT                   oxidoreductase"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65712"
FT                   /db_xref="GOA:E4NRN6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN6"
FT                   /protein_id="ADQ65712.1"
FT                   /translation="MTRILVLDDPAHGIPASEYADELRERLPETTVIHRETTEATVEAA
FT                   ADAAVITGIHLPDDVLEAAAELRLFAAASAGYDHLPLDRLRERGVTVTNASGVHGPNIA
FT                   EHVIGWLLMLARSLDEGIRRQQRREWRQFQAFGELQGSTVTVVGLGAIGQAIGERLDPF
FT                   GVETIGVRYTPEKGGPTDEVIGFDEIESALVQTDYLVLACPLTETTAGLIDADALKSLP
FT                   TDAALVNVGRGGVVDTDALVRTIRRDRLRAAALDVTDPEPLPHDHPLWDFENVLLTPHV
FT                   SGYTPQYWTRRADILARNIEHIFETGEWTGLENQISP"
FT   gene            89467..90084
FT                   /locus_tag="Hbor_01020"
FT   CDS_pept        89467..90084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01020"
FT                   /product="putative threonine efflux protein"
FT                   /note="PFAM: LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65713"
FT                   /db_xref="GOA:E4NRN7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN7"
FT                   /protein_id="ADQ65713.1"
FT                   /translation="MTDVVAGLSLTTFLAFCGAAVALILTPGPDTMYVLARGMQGRSAG
FT                   VRSALGISTGVLVHTAAAALGLAALLRAAPTAYRLVKYAGALYLIYLGLSALRDDEFDP
FT                   TVQTDAEGSFRRGVFVNALNPKVALFFLAFLPGFAGSGSGAELRMFLLGGTYAVLTALY
FT                   LSGVAFASGQMGSMLASSRFSSGLNWLGGGVMVALGVGVAVE"
FT   sig_peptide     89467..89532
FT                   /locus_tag="Hbor_01020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(90153..91493)
FT                   /locus_tag="Hbor_01030"
FT   CDS_pept        complement(90153..91493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01030"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="PFAM: SRP54-type protein, GTPase domain; SRP54-type
FT                   protein, helical bundle domain; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65714"
FT                   /db_xref="GOA:E4NRN8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN8"
FT                   /protein_id="ADQ65714.1"
FT                   /translation="MFDGLKKKLNSFRENVEDTAEEKAEAQAEAAEAAADTTDADTETE
FT                   TPDAETHDADATEAVGGENEPTETTADSATVSDADDTTSETEAETADAQASPAPDSETP
FT                   ETGDESGDTADDSAADEADEAASSRERLASDAANEALESGQKESSGAGRLKRAAAFATG
FT                   KVIIEEEDLEDPLWELEMALLESDVEMHVAEEILDTIREKMVGETRRQVETMGQLVQEA
FT                   LHDALYDVISVGQFDFDQRIAEADKPVTLIFTGVNGVGKTTSIAKMARYFEKQGLSVVL
FT                   ANGDTYRAGANEQIRKHAENLDTKIISHEQGGDPAAVIYDAVEYAEAHDIDVVLGDTAG
FT                   RLHTSNDLMAQLEKIDRVVEPDLTLFVDEAVAGQDAVERAKQFNEAAEIDGAVLTKADA
FT                   DSNGGAAISIAYVTGKPILFLGVGQGYDDIEQFDPERMVERLLGEDE"
FT   gene            complement(91530..91991)
FT                   /locus_tag="Hbor_01040"
FT   CDS_pept        complement(91530..91991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01040"
FT                   /product="prefoldin alpha subunit/subunit 5"
FT                   /note="PFAM: Prefoldin subunit; TIGRFAM: prefoldin,
FT                   archaeal alpha subunit/eukaryotic subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65715"
FT                   /db_xref="GOA:E4NRN9"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRN9"
FT                   /protein_id="ADQ65715.1"
FT                   /translation="MMGGGQQQLQQLSQELQAIEQEIEELEGDVSDLQQEKSEIDEAIE
FT                   AIETLETGSTVQVPLGGGAYLRADVQDIDEVIVGLGGDYAAEQEQDDAIEALRLKQDSI
FT                   DERIAAVQGEISDLEDESSELEQQAQQMQQQMQQQQMQQMQQMQEDDDE"
FT   gene            complement(91988..92164)
FT                   /locus_tag="Hbor_01050"
FT   CDS_pept        complement(91988..92164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01050"
FT                   /product="LSU ribosomal protein LX"
FT                   /note="PFAM: Ribosomal L18ae/LX protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65716"
FT                   /db_xref="GOA:E4NRP0"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRP0"
FT                   /protein_id="ADQ65716.1"
FT                   /translation="MSQFTVSGQFQSRDGYSEFQTVVDAPNENVARDRVFSNIGSQHGL
FT                   KRTQIEITEVSAQ"
FT   gene            complement(92297..92962)
FT                   /locus_tag="Hbor_01060"
FT   CDS_pept        complement(92297..92962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01060"
FT                   /product="translation initiation factor 6 (aeIF-6)"
FT                   /note="PFAM: eIF-6 family; TIGRFAM: translation initiation
FT                   factor eIF-6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65717"
FT                   /db_xref="GOA:E4NRP1"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRP1"
FT                   /protein_id="ADQ65717.1"
FT                   /translation="MLRASFAGSAYVGVFACVTDHVLLVRPDAEDDVVDAMTAELDVPA
FT                   VRTTVGGSGTVGALAMGNDNGILVSARATEREKETIEDVAGVPVTELPGRINAAGNVVL
FT                   ANDSGAYVHPDLSDEALAVVEDALDVPAERGDLADVRTAGTAAVATNDGVLCHPKSREP
FT                   ELEALEELLDVRADIGTVNYGAPLVGSGLVANEFGYVVGEETTGPELGRVEDTLGYLD"
FT   gene            complement(92965..93243)
FT                   /locus_tag="Hbor_01070"
FT   CDS_pept        complement(92965..93243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01070"
FT                   /product="LSU ribosomal protein L31E"
FT                   /note="PFAM: Ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65718"
FT                   /db_xref="GOA:E4NRP2"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:E4NRP2"
FT                   /protein_id="ADQ65718.1"
FT                   /translation="MSASDFEERVITVPLRDVKAVPSYERAGRAMKIIREHLAQHFSVD
FT                   PEDVRLEPEINEQIGGRGRQTPPSKFRVRAARFDEDGEQIVEAEPAE"
FT   gene            complement(93247..93399)
FT                   /locus_tag="Hbor_01080"
FT   CDS_pept        complement(93247..93399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01080"
FT                   /product="LSU ribosomal protein L39E"
FT                   /note="PFAM: Ribosomal L39 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65719"
FT                   /db_xref="GOA:E4NS34"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS34"
FT                   /protein_id="ADQ65719.1"
FT                   /translation="MSKKSKAKKKRLAKLERQNSRVPAWVMMKTDMEVTRNPKRRNWRR
FT                   SDTDE"
FT   gene            93577..94518
FT                   /locus_tag="Hbor_01090"
FT   CDS_pept        93577..94518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01090"
FT                   /product="DMT(drug/metabolite transporter) superfamily
FT                   permease"
FT                   /note="PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65720"
FT                   /db_xref="GOA:E4NS35"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS35"
FT                   /protein_id="ADQ65720.1"
FT                   /translation="MRHRTTAAFVFLSAIWGTAFVATKVGLASLPPTLFAAMRFDIAAA
FT                   VLFGFAFIRSDRLRPTSRTEWYPIITGGMLNIGIHHAFLFSGQAYIDNAAVPAVLLGLI
FT                   PVITPVLTRLTTSSERLSAVGVVGLVLGFTGVVVIADPKPEALLSSDLMGVGLVLASAV
FT                   AFALGAVLTHGSKSELPFFSIQAWTMLIGAVFLHATSVALPWESFAGARWTLDAVISLV
FT                   YLGVVAGAGGFGLYFWLLDHIGPIEASLLEYVIPVFAAIGGWIIRGNAIDTNTVIGFAV
FT                   IFVGFLLVKRADVRRELVRLRERSRTAASDAD"
FT   sig_peptide     93577..93639
FT                   /locus_tag="Hbor_01090"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(94537..95100)
FT                   /locus_tag="Hbor_01100"
FT   CDS_pept        complement(94537..95100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01100"
FT                   /product="2''-5'' RNA ligase"
FT                   /note="PFAM: 2',5' RNA ligase family; TIGRFAM: 2'-5' RNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65721"
FT                   /db_xref="GOA:E4NS36"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS36"
FT                   /protein_id="ADQ65721.1"
FT                   /translation="MRLFVSIDLPDSLTESVEAAQERFADAEGLRFTDPSQAHVTMKFL
FT                   GDTDEDRLEDIDEALEAAIAAADVDPYDATVGGFGVFPSIEYISVVWAGVRDDGGAAKT
FT                   TTLAEAIERETVERGFDPEDHSFTPHVTIARMDDARGKDHVQRVVREEDPDLGTFHVEE
FT                   VRLKQSTLTNDGPRYETVRRYPLD"
FT   gene            complement(95157..95942)
FT                   /locus_tag="Hbor_01110"
FT   CDS_pept        complement(95157..95942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01110"
FT                   /product="arylamine N-acetyltransferase"
FT                   /note="PFAM: N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65722"
FT                   /db_xref="GOA:E4NS37"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS37"
FT                   /protein_id="ADQ65722.1"
FT                   /translation="MDPDRYLERLAVDPDRVADPTFQALERLQRAHVTSVPFETLSITG
FT                   DPHGARDGEGIVLSIPALYEKVVERHRGGFCFELNGLFGWLLTELGFDVTRVAARMVSD
FT                   LELPANHHPLLVTLNGDDHLVDAGMGAPMLRRPVPLGESVDRDEAGVAWRTADSDRPDA
FT                   EYLLQYCESDDWQDRYVFDSTRRELDYFAATCDYLQSAPESGFTGDPVVVKPTPDGHAK
FT                   LKPTVFSRTRGDETDEQSVDEAEYRRLLRETFGIEYGDQ"
FT   gene            96085..96831
FT                   /locus_tag="Hbor_01120"
FT   CDS_pept        96085..96831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01120"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65723"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS38"
FT                   /protein_id="ADQ65723.1"
FT                   /translation="MAEDGERDRPHRFSEGQGFSEDYEEFSLDPPELNVDPAKVDPVDT
FT                   RVITDELDERNIAKDQVDVEQLVDVGLSYMQINRFEEATETFERAAQFADEDSLEAQEA
FT                   WVNKGAAHAQLEEYDEAIGAYKEALRIDDDSEHAASAETNLAYALWQFGETEEALHHAE
FT                   RAVEIDPRFAQAWYNRGFFLQERGLSEDAVNAFDNAIRLGMRNADVLEEKARALEELGR
FT                   EDEAEQVQQQADELRQQQEQELIEDR"
FT   gene            96831..97133
FT                   /locus_tag="Hbor_01130"
FT   CDS_pept        96831..97133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01130"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF424)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65724"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS39"
FT                   /protein_id="ADQ65724.1"
FT                   /translation="MLLRERETPEGLLVSVCDRDCLGETYEDGQVSLEVTEEFYGGEEA
FT                   DKVDADAVVDSLTRATVANIVGERAVGVAIDAGIVDEETVLDVGETRHAQLLWMR"
FT   gene            97313..98590
FT                   /locus_tag="Hbor_01140"
FT   CDS_pept        97313..98590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01140"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: Aminotransferase class-V; TIGRFAM: cysteine
FT                   desulfurases, SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65725"
FT                   /db_xref="GOA:E4NS40"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS40"
FT                   /protein_id="ADQ65725.1"
FT                   /translation="MGVQESYPIDVATIREDFPILDRKVGGDFTVPGEGDGDSLPLVYL
FT                   DNAATTQTPKQVVDAIVEYYYGYNSNVHRGIHHLSQEASVAYENAHDRVAEFIGASGRE
FT                   EIVFTKNTTEAMNLVAYAWGLEELEPGDKVVLTEMEHHASLVTWQQIAKKTGASVEYIR
FT                   VDEDGRLDMDHAADLIDEDTKMVSVVHISNTLGTVNPVSELADMAHEVGSYIFVDGAQS
FT                   VPTRPVDVTDIDADFFAFSGHKMLGPTGIGVLYGKEEILEEMTPYLYGGEMIRRVTYDD
FT                   STWEDLPWKFEAGTPVIEQGIALHAAIDYLDEIGMENVQAHEERLAAYAYDRLAEFDDI
FT                   EIYGPPGDERGGLVAFNLDGVHAHDLSSILNDHAVAVRAGDHCTQPLHDKLDIAASTRA
FT                   SFYVYNTYDEVDKLIEAVDDARTLFA"
FT   gene            98721..99140
FT                   /locus_tag="Hbor_01150"
FT   CDS_pept        98721..99140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01150"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="PFAM: NifU-like N terminal domain; TIGRFAM: SUF
FT                   system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65726"
FT                   /db_xref="GOA:E4NS41"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS41"
FT                   /protein_id="ADQ65726.1"
FT                   /translation="MGSDMYRQQILDHYKNPRNKGEMEDPTFSHTGENPSCGDTITMQV
FT                   KLEDDDETIEFVAFTGDGCAISQASASMLSERLQGTTLSELEEMDTDDVTEMLGVDISP
FT                   MRIKCAVLARQVAQDGAAIYEGDAEKATTTTEADD"
FT   gene            complement(99578..100609)
FT                   /locus_tag="Hbor_01160"
FT   CDS_pept        complement(99578..100609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01160"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /note="PFAM: Rad51; TIGRFAM: DNA repair and recombination
FT                   protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65727"
FT                   /db_xref="GOA:E4NS42"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS42"
FT                   /protein_id="ADQ65727.1"
FT                   /translation="MPEDDLESLPGVGPATADKLTDAGFESYQAIAVASPSELSNTADV
FT                   GESTSSDIINAAREAADIGGFETGSAVLERREQIGKLSWGISEVDDLLGGGLETQSITE
FT                   VYGEFGAGKSQVTHQMAVNVQLPPEHGGLGGSCIFVDSEDTFRPERIDDMVRGLDDEII
FT                   QATMDEREIEGSPDDEAAMEELLNDFLDKIHVAKAFNSNHQILLAEKAKELARDHEEDE
FT                   FPVRLLCVDSLTAHFRAEYVGRGQLAERQQKLNKHLHDLMRIGDLYNTAVLVTNQVASN
FT                   PDSYFGDPTQPIGGNILGHTSTFRIYLRKSKGDKRIVRLVDAPNLADGEGIMRVQDGGL
FT                   KPE"
FT   gene            100807..101472
FT                   /locus_tag="Hbor_01170"
FT   CDS_pept        100807..101472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65728"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS43"
FT                   /protein_id="ADQ65728.1"
FT                   /translation="MPTRRAVLGVIGGALVAGCAGNRGTSDNTETQTSGESTADGATAP
FT                   SNETLANATGSNETTTAVGNETNATGGNETHNETNFDQPAVETPEPAACSPDPRPPATD
FT                   GSAYPTHPGDVTELSALRFAQAYETALAKNRVAAETPTAEVVAVEPVDSSLKAPGTDEW
FT                   YVVSVTIQLTTRTDGEKETSRVGGTYYLTEEVAMRDAGASEVDGDVSGIKGAVVVACP"
FT   sig_peptide     100807..100881
FT                   /locus_tag="Hbor_01170"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(101473..102078)
FT                   /locus_tag="Hbor_01180"
FT   CDS_pept        complement(101473..102078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS44"
FT                   /protein_id="ADQ65729.1"
FT                   /translation="MGFLDSIRSVLGISAEADATREADPEDLFGMSTAYITMEADLDFD
FT                   PVGAAALCFSSVDSTDFAQTVEEVEAILKAGEEETGTDFRLYEDSHGWEWVVLEDDDPE
FT                   DLVTSIHFAADEFIERGYGSRLLAAVFGFERDGDRAYWIYSFRRGAYYPFAPERGRNQN
FT                   DRILMKLESVLDGELELEPDKEYWYPMWPDREGGHPWE"
FT   gene            complement(102079..102948)
FT                   /locus_tag="Hbor_01190"
FT   CDS_pept        complement(102079..102948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01190"
FT                   /product="Heat shock protein"
FT                   /note="PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65730"
FT                   /db_xref="GOA:E4NS45"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS45"
FT                   /protein_id="ADQ65730.1"
FT                   /translation="MDWKPDWGLRGRMVLTMFLLFALYIVFVGALVYTDSFIVLPFVAV
FT                   FLFAQFFFSDKLALYSMGAKKVSEDEYPELHATISRLSQQADLPKPKIAVVDSRVPNAF
FT                   ATGRSQNNAAICVTTGLMRMLDSDELEGVLAHELAHVKNRDVMVMTIASFLSTVAFMIV
FT                   RWGFWFGGGNRDRQGGGIIAAIAVSLVVWIVSFVLIRALSRYREYAADRGAAVITGQPS
FT                   ALASALMKISGGMDKVPQDDLREQSEMNAFFIIPIKSDFIGRVFSTHPSTENRIERLRQ
FT                   LEREMETA"
FT   gene            103060..103689
FT                   /locus_tag="Hbor_01200"
FT   CDS_pept        103060..103689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01200"
FT                   /product="predicted phosphoribosyltransferase"
FT                   /note="PFAM: Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65731"
FT                   /db_xref="GOA:E4NS46"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS46"
FT                   /protein_id="ADQ65731.1"
FT                   /translation="MFTNRTEAGKRLAERLQEAAVNPDLVLAIPRGGLPVGRAVADALG
FT                   VPLDVVVASKVGAPGNPELAIGAVTGEGDLWLNDSLVEQFGIGDRYIESQREREADVAR
FT                   EKVRAYRGGKPVPDVSGKRVVIVDDGVATGATALACLQQVRSGGAARIVFAVPVASAAT
FT                   IPRLREVADDVVVVEVPETFAAVGYHYRDFGQVTDEEALEYLDDEV"
FT   gene            103731..104861
FT                   /locus_tag="Hbor_01210"
FT   CDS_pept        103731..104861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01210"
FT                   /product="NMD protein affecting ribosome stability and mRNA
FT                   decay"
FT                   /note="PFAM: NMD3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65732"
FT                   /db_xref="GOA:E4NS47"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS47"
FT                   /protein_id="ADQ65732.1"
FT                   /translation="MSSGDFCPRCGDPVPEREEPLPGMPRDRDAVLCDACYFEDFDLVD
FT                   APERIEVRVCSQCGAVHKGNRWVDVGARDYTDVAIEEVSEALGVHLKAEDVQWGVEPEQ
FT                   VDQNTIRMHCSFSGFVRDTHIEETVTVPVKISRQTCKRCGRIAGGYYSSIVQIRAEERD
FT                   PTKEEAQRAVEIAESYIEEREETGDRNAFISEISNSGDGPNIKISTNQMGSGVAKHVVR
FT                   ELGGNVEEYPTLVTEDGDGNEVYRVTYAVRLPKFTPGEIIDPDDDDGPVLVRSVRGNLK
FT                   GVRLDSGEQYESQFEEGETPDARRLGTVEDAAETTVVTVEDENAVQVLDPETYESKTIA
FT                   RPDYFDSDAAMVHVLKSRSGLHILPDEAVENGETSD"
FT   gene            complement(104858..105049)
FT                   /locus_tag="Hbor_01220"
FT   CDS_pept        complement(104858..105049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01220"
FT                   /product="Uncharacterized protein family (UPF0175)"
FT                   /note="PFAM: Uncharacterised protein family (UPF0175)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65733"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS48"
FT                   /protein_id="ADQ65733.1"
FT                   /translation="MHTHALTTAMTLYQSGTLTLSQAATRAGRSEEALVSALHQHGVEV
FT                   REQEEVTAATTETPARAD"
FT   sig_peptide     complement(104981..105049)
FT                   /locus_tag="Hbor_01220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(105394..107277)
FT                   /locus_tag="Hbor_01230"
FT   CDS_pept        complement(105394..107277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01230"
FT                   /product="DNA helicase, Rad3"
FT                   /note="PFAM: DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65734"
FT                   /db_xref="GOA:E4NS49"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS49"
FT                   /protein_id="ADQ65734.1"
FT                   /translation="MDPDRILPSFPAPSYRGAQEQALCDIRDAFAAGNDVVLVRAPTGS
FT                   GKSLLARSIAGAARTTEEAKPAQATDAYYTTPQVSQLDDVAEDELLEDLSIIRGKSNYT
FT                   CILNGETDTPVDRAPCARQKGFDCTVRHRCPYFSDRAIASNRKIAAMTLAYFMQTAGSD
FT                   VFRQRDVVVIDEAHGLAEWAEMYATIDLNPNTVPVWDDVGVPNVTTADDPLERTVRFAE
FT                   ALLQVCSNAKDELLTKSELTPEEASRRDRLQELRSELKWFIEDYRDPESPTTWVVDQFG
FT                   GEGEPITAKPLDPARYLKHTVWDRGNKFALLSATILNKDAFCRGVGLDPSNVALVDVEH
FT                   TFPVENRPLYDVTQGKMTYEHRDETIPKIARLLVRLMAKHPDEKGLVHCHSYAIQSELR
FT                   KRLAQLGLGGRIRGHDKANRDAELETWKASSGADVFLSVKMEEALDLKGDLCRWQVICK
FT                   APYLNTNDSRVAQRLEDGQWSWYRRAALRTVIQACGRVVRAPDDYGATYLADSSLLQLF
FT                   DRTRSEMPEWFAEQVRRMSTPDLPEFDQEAAGGRGRSSGSRPSPRSSPSRSSSGSSRSS
FT                   GSSRSSSRQSSGSTSSRGRSGTGGENSRSRSQSDDADDRSNHPLSDVWGDG"
FT   gene            complement(107340..107543)
FT                   /locus_tag="Hbor_01240"
FT   CDS_pept        complement(107340..107543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65735"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS50"
FT                   /protein_id="ADQ65735.1"
FT                   /translation="MTTEPCDGCGKSVRIGGGIGDFWSFSNESTQGITLELEDGGEFFL
FT                   CYDCIDQLPDDRVVTSDDVRSL"
FT   gene            107682..108593
FT                   /locus_tag="Hbor_01250"
FT   CDS_pept        107682..108593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65736"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS51"
FT                   /protein_id="ADQ65736.1"
FT                   /translation="MKVNCEGCAGCCIDWRPVSPAPSNHERRGPREPLDDVYNLVPLTR
FT                   DEIAAFVRDGFGDVLVPRMWEATPDADAAVEIDGVEVAAIGGKPAFFVGLRKPPKPVTP
FT                   FGTEQTWLHACVFLDPETLQCRIHGDEMYPSECRDYPGHNLALGTESECERVEEEFGDD
FT                   RLLDGDAPDVSGLLLGPHAVGSKVFAYPDPEALAGTVEQMRRGDLTDADRAAFVGVAVG
FT                   SRPGSTDVDTARVEAVKTTVLEAESWAGTAAEAWTELSGVVGDDAADAPDGASVEVGRG
FT                   APETAGWDDAEYSGWDDAEYSG"
FT   gene            108690..109745
FT                   /locus_tag="Hbor_01260"
FT   CDS_pept        108690..109745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01260"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65737"
FT                   /db_xref="GOA:E4NS52"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS52"
FT                   /protein_id="ADQ65737.1"
FT                   /translation="MKVLVTGATGFVGSRLVRALLDDGHEVSALVRDASNAELPADVHV
FT                   IEGDLLETGGFHLVDDGDTGNGGNADLRESDDRTFEDCLSALGIEAAYYLVHSMQSGSD
FT                   FEERDRRAARHFERGVSAASVERVVYLGGLGEERDHLSPHLRSRREVEYVLGEGDYDLT
FT                   TLRAAIIIGDGSASFEVIRQLADRLPVMVTPRWVDTECQPIYVDDVVAYLVGVLDAPET
FT                   AGETYEIGGPDVLTYGEVLKRVGEHLDRQTRLVSVPVLTPRLSSYWVSLVTNVPTSVSR
FT                   PLIEGLKNPVVVRDDSIKRHVEVELTPFDEAVTRALGAVSESDTEPAVEPVETVGEDGS
FT                   DLESSAGSADT"
FT   gene            109773..110468
FT                   /locus_tag="Hbor_01270"
FT   CDS_pept        109773..110468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65738"
FT                   /db_xref="GOA:E4NS53"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS53"
FT                   /protein_id="ADQ65738.1"
FT                   /translation="MTRTQFGETWVYESIVGALPGIHLTDGEAIALQLGLFEVFVVFFA
FT                   WAYDLWEAVLPGSIAVGVAAVGSVVMLRMGQTTRETNLPDAYTRLLFGSSIEVVLGVLA
FT                   FVALVTHLFVYDPRQSGTTLFVSLFGREPPVIVVYLTLLVLWDLCYRIGTSWWAAIVSL
FT                   WGSLRFTVDSTTAQTLRVADAWNVIFGIAQLALVPFILNQRMLLLAVAGHVVAVTVVST
FT                   VAAVTMRIE"
FT   gene            complement(110474..110641)
FT                   /locus_tag="Hbor_01280"
FT   CDS_pept        complement(110474..110641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65739"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS54"
FT                   /protein_id="ADQ65739.1"
FT                   /translation="MGAYDEDEHERRERKNGSVDATFDDDRTVYHGEVTYDSGDSTEAL
FT                   LDKFREMKDT"
FT   gene            110749..111738
FT                   /locus_tag="Hbor_01290"
FT   CDS_pept        110749..111738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65740"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS55"
FT                   /protein_id="ADQ65740.1"
FT                   /translation="MARPLRFRYAPGRWDEARVRRDIYDDLDSNLGATKETPWFKPPAD
FT                   FEAVRFEMNNGDIALFCWNDDTAYWMGNTETPEALWRTDKKGFSEVPHSVSRWVTRELT
FT                   AQLHEESPWLEPYPHLSWFFLPVFLSKDGRETTREFFHDHAAGFPDATRDEALSFYEGF
FT                   LATGVLDDHREVMAGKLGTSEYLDLTRMTAAMGEFNAGKLLVDAGYDIVPEIDVTTGHA
FT                   IDYRASRNGDGTLVEVTRPLPTSKRSAGTPVAAVRDTAETKSGGQLEEHGGGVVLFVDC
FT                   SSFPDDDWFSVRDEKPEVHHRPAVVFRVRPSGRFEGYTKGRVPLDIPF"
FT   gene            complement(111735..112019)
FT                   /locus_tag="Hbor_01300"
FT   CDS_pept        complement(111735..112019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65741"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS56"
FT                   /protein_id="ADQ65741.1"
FT                   /translation="MRLNRTDELINAHEFPATTEELIEAYGDQTIEHPNGSEQLGDVFA
FT                   RAGFETYTCADDARNALLCGLGHEAIGRRYYSDRDVSTFGEDGPQQVSF"
FT   gene            112202..112990
FT                   /locus_tag="Hbor_01310"
FT   CDS_pept        112202..112990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01310"
FT                   /product="predicted metal-dependent phosphoesterase, PHP
FT                   family"
FT                   /note="PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65742"
FT                   /db_xref="GOA:E4NS57"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS57"
FT                   /protein_id="ADQ65742.1"
FT                   /translation="MADLHLHTTASDGVLTIAEVPDAAVAGGVEVVAVTDHDRVHPDLD
FT                   APVTERDGVTMIRGVELRVETPEQRLDLLGYAVRDTPAIREVTERIQTDRKERGRKIVE
FT                   NVESHLDVELDIELREGIGRPNIARAIEGSDAPYDYEDAFAHLIGNDGPCYVQRYVPDF
FT                   ETGVAALRESCAVVGLAHPFRYPDPEAALERAAELDAVERFYPYGGGSAAKEDVELVER
FT                   IAAANDLLLTGGSDAHDRTLGVAGPTEDAFAAFAARVPGV"
FT   gene            113056..113220
FT                   /locus_tag="Hbor_01320"
FT   CDS_pept        113056..113220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65743"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS58"
FT                   /protein_id="ADQ65743.1"
FT                   /translation="MKCHYCERDAAYAAEKDGIKVGLCERHFRERVEELADSEELAALR
FT                   EQIDIDRTE"
FT   gene            complement(113294..113461)
FT                   /locus_tag="Hbor_01330"
FT   CDS_pept        complement(113294..113461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65744"
FT                   /db_xref="GOA:E4NS59"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS59"
FT                   /protein_id="ADQ65744.1"
FT                   /translation="MALLPYRLARFEERLDSLGSKRSWSEVEPSDWKVLFNRVGGAALA
FT                   LFGFAWFLLG"
FT   gene            complement(113565..114182)
FT                   /locus_tag="Hbor_01340"
FT   CDS_pept        complement(113565..114182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01340"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65745"
FT                   /db_xref="GOA:E4NS60"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS60"
FT                   /protein_id="ADQ65745.1"
FT                   /translation="MKNRIAPGDGLPDNGMSSILGAKLVLMIRGYSRSMQAPLQVAQMP
FT                   DELQALLHSEWAYLVLFGVFVLEGAMLMYFMPSELIVPGSLVLLGTDAAVAVIGIAVLG
FT                   ATIGQYALFKVAQRGGREYLLQKRWFAVSESKLDRFDGWFERWGPIVVPVSNTLLFTRG
FT                   MLTVPAGFAEMDDRQFVALSAVGTLSFEVILAALYVYFDTLV"
FT   gene            114203..115183
FT                   /locus_tag="Hbor_01350"
FT   CDS_pept        114203..115183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01350"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65746"
FT                   /db_xref="GOA:E4NS61"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS61"
FT                   /protein_id="ADQ65746.1"
FT                   /translation="MNLTDRPRRLRTDGIRSLVSETNLSATDLIAPVFVDATTDERLPI
FT                   ESMPGHERVPVSEAVARVEEVLETGVEAVMLFGIPESKDERGSRAWAEDGVVQKATRRV
FT                   TEETDAYVITDVCMCEYTSHGHCGIVEDHAESDPTLTVKNDETLALLAKTAVSHAEAGA
FT                   DMVAPSSMTDGMVGAIREALDESGHESVPIMSYAAKYESAFYGPFRDAADGAPAFGDRR
FT                   HYQMDPANAREAIREVTLDVEQGADVLMVKPALAYLDIVRAVREEFDHPVAAYNVSGEY
FT                   AMLHAAAEKGWMDLDETAFESLLAMKRAGADLILTYFAEDIADAL"
FT   gene            115477..116850
FT                   /locus_tag="Hbor_01360"
FT   CDS_pept        115477..116850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01360"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: Ammonium Transporter Family; TIGRFAM: ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65747"
FT                   /db_xref="GOA:E4NS62"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS62"
FT                   /protein_id="ADQ65747.1"
FT                   /translation="MSVPLQADASTIAAGVNNVWILVVTFLIFFMQPGFALLEAGQVRA
FT                   KNVGNVLMKNMTDWILGTLIYFVVGAAIATIVGGLTSPGPFSISAAFAYVNDPTAWIGW
FT                   LFGAVFAMTAATIVSGAVAERMEFNAYVLFTVLMTAIIYPVVVGFTWGGGLLSSGGFLG
FT                   NVLGAGYLDFAGATVVHMCGGVAGLVAAKMVGARKGRYDANGESQPIPGHSMLLAVLGT
FT                   FILAFGWYGFNVGTQATILSVADDGSLTFMGAALGRVALVTTLGMGAGGAMAMLMSARY
FT                   QGKPDPLWTANGLLAGLVAVTGAVPHVTWWGGALLGGLGGFLVLPAFRFTVDTLKVDDV
FT                   CGVFAVHGVAGAVGTALIPVFAVGGFSASQFALQILGVLIIAAWTVTASGIVLYVLDLT
FT                   VGLRVGETEEAEGLDLGEHGVSVYPEFVADGESPMADGGSSVRTDGGEFVASDGGERE"
FT   sig_peptide     115477..115584
FT                   /locus_tag="Hbor_01360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            116847..117203
FT                   /locus_tag="Hbor_01370"
FT   CDS_pept        116847..117203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01370"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: Nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65748"
FT                   /db_xref="GOA:E4NS63"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS63"
FT                   /protein_id="ADQ65748.1"
FT                   /translation="MSENDGIKMVMAIIRPDKLADVKRALAEVGAPSLTVTNVSGRGSQ
FT                   PAKKGQWRGEEYTVDLHQKVKIECIVADIPADDVVDAIREAAHTGDPGDGKVFVLPVES
FT                   AVQVRTGKTGRDAV"
FT   gene            117327..118040
FT                   /locus_tag="Hbor_01380"
FT   CDS_pept        117327..118040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01380"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65749"
FT                   /db_xref="GOA:E4NS64"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS64"
FT                   /protein_id="ADQ65749.1"
FT                   /translation="MELTPVTAVGLVVALVGFELLHRLRKRFGWTGGTLSDHAWKWVIP
FT                   VLVVLVVLAEGKSFDSIGWHVESTLLLVWQTAVGLAVMLGSNLLLAPLWARVGDGGESL
FT                   AKGIGSFASLSMPERLFVAATAGVTEEIPYHGYAVERLAALTGSLPFAGIISFLAFTLG
FT                   HLGETWDRQAVLRIAQPALVTTLLYLWFRSLPALIAIHALNDAVGLLVADRYAPAEEEE
FT                   EEETPHVVRWLEGEQ"
FT   gene            118141..119478
FT                   /locus_tag="Hbor_01390"
FT   CDS_pept        118141..119478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01390"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="PFAM: Aminotransferase class-III; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65750"
FT                   /db_xref="GOA:E4NS65"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS65"
FT                   /protein_id="ADQ65750.1"
FT                   /translation="MNHDESRALYDRALSVMPGGVNSSVRATQPYPFFIERGDGAHVVD
FT                   ADGNRYLDYVLGYGPLLYGHDMPEPVRAAVQSHASEGPMYGAPTEVEVKHAEFVSRHVP
FT                   SVEMIRFVNSGTEATVSAVRLARAYTGRDKIVIMQGGYHGAQESTLVEGEPGDVHPSTR
FT                   GIPESFAEHTIPVPFNDFEAVRDVFETHGDDIAAVLTEPILGNKGIVMPVDGYLEHLRN
FT                   LTEDHDALLVFDEVITGFRVGGLQCAQGKFGITPDVTTFGKIIGGGFPVGAIGGKSEII
FT                   EQFTPSGNVFQSGTFSGHPVTIAAGYEYLKYAAENDVYDHVNRLGEKLRRGITDIVEDQ
FT                   APNYTVVGTDSMFKTVFTREGPADLDGCCPAGCKQRESCPRYDYCPKNGADVAKADTER
FT                   WKRIFWQEMKEQGVFLTVNQFESQFVSYAHTDEDIEETLEAYKEAL"
FT   gene            119554..120105
FT                   /locus_tag="Hbor_01400"
FT   CDS_pept        119554..120105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65751"
FT                   /db_xref="GOA:E4NS66"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS66"
FT                   /protein_id="ADQ65751.1"
FT                   /translation="MDSPPHNAGDDIDTGSHDDDSAGYDDGNTGYDDDGTSVGTSPRTT
FT                   DYEDPIGDLLPYASVDSNWWYWIAAPIALFVLSLVGGILFFVAFLFDILLTGGILSVTT
FT                   GILFAGIASLIGLVLSVMFPVAVYVDARALCEAPESSWSPDPVLYGLVALAGVVVTAFT
FT                   VSIPFGIYYLYRRHVAVGTP"
FT   gene            complement(120120..120575)
FT                   /locus_tag="Hbor_01410"
FT   CDS_pept        complement(120120..120575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65752"
FT                   /db_xref="GOA:E4NS67"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS67"
FT                   /protein_id="ADQ65752.1"
FT                   /translation="MSDESGESSAIGSLASGVSDLFYLVGLWLAFGTMFTPLSAIVNAV
FT                   FVAEPFSFGQLVSQIFVLVALVVTNARYPEVSAFWIWATGLVSMLIFAASAGLAGVLEP
FT                   NTSGSLAVIFRLLLFWAGSIMLAVAILNYWWPEDESAGEMRDNGSLE"
FT   gene            complement(120572..121768)
FT                   /locus_tag="Hbor_01420"
FT   CDS_pept        complement(120572..121768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01420"
FT                   /product="WD40-like repeat protein"
FT                   /note="FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65753"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS68"
FT                   /protein_id="ADQ65753.1"
FT                   /translation="MRPPRLTRRRLLAASGLFFAAGAAFDPSVAATPESDAALDLDAWP
FT                   MPGRNPARTGFDPDGIAPRGDFSLAWETSVPDVAYGHRSLTVADGAVYVAADNSLLAVE
FT                   RDTGDVRWRFPGKTQRPWRRRVSFSASPVAFSGGVLIPGRVDTFGFGSNDGQIGWSHDS
FT                   SPGDSLFCRVGNTVYWQGTDGTRVVDIETGLERERSPLSTKVEPFAFRNGLLVGRGDSP
FT                   DKLVAVNAQTGRLQWSVTLGVAHPSHLTPCIGTDAVFYGSGPLYAVSLADGDVSWKGDI
FT                   GTYQASIHPVTDGERVYAVAEDEEAETTFAVALDTETGDRVWRRETPLDPLCTPAVVGE
FT                   TLYAATPAGFVVLDATNGEVLARFDAASGRGRARSPAVVDGTVYVGLDETLYAVEGSE"
FT   sig_peptide     complement(121679..121768)
FT                   /locus_tag="Hbor_01420"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            121918..123045
FT                   /locus_tag="Hbor_01430"
FT   CDS_pept        121918..123045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01430"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="PFAM: Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65754"
FT                   /db_xref="GOA:E4NS69"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS69"
FT                   /protein_id="ADQ65754.1"
FT                   /translation="MKRGTLRLATRGSDLALRQTASVRDTLADRRFDVELVEVETRGDQ
FT                   IRDELLHRLGKTGAFVRALDERVLDEEVDAAVHSMKDMPTEHPRDLVVAGVPERAPAND
FT                   VLLTPDGTAFENLPAGSVVGTSSLRRKAQILSARPDLEVEPLRGNVDTRVEKLLAPTLQ
FT                   REHEARVDDDSDKKANSAEASASGEEYETDFDRTIEEWFDDLSEIERRSLERDVETEYD
FT                   AIVLAEAGLKRSGLLHRVEYDRLPPTEFVPAPGQGAIAVTARRDHENLDRIQDALDDPR
FT                   TRVTTTVERTVLAELGGGCIAPIGVHAKLQGEHVHVTARVLSTDGEEEVSASRNLPVHN
FT                   HANAAAEFAESLASQGAADLISEARDDARDEEDEK"
FT   gene            123042..123845
FT                   /locus_tag="Hbor_01440"
FT   CDS_pept        123042..123845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01440"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65755"
FT                   /db_xref="GOA:E4NS70"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS70"
FT                   /protein_id="ADQ65755.1"
FT                   /translation="MTMSVGTVYLVGSGPGDPDLMTVKAARLLETADVVLHDKLPGPEI
FT                   LERIPEEKREDVGKRAGGEWTPQEYTNRRLVELAREGKTVVRLKGGDPFVFGRGGEEME
FT                   HLAAADIPFEVVPGITSAIAGPGTAGIPVTHRDHASSVSFVTGHEDPTKEESAVDWDAL
FT                   AATGGTLVVLMGVGKLPDYTAALREAGMDPETPVALVERATWPEMRVATGTLDTIVSVR
FT                   DETEIEPPAITVIGEVAGTRENVVEFLRNRTGAFEDESATQEADE"
FT   gene            123842..124585
FT                   /locus_tag="Hbor_01450"
FT   CDS_pept        123842..124585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01450"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen-III synthase HemD"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65756"
FT                   /db_xref="GOA:E4NS71"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS71"
FT                   /protein_id="ADQ65756.1"
FT                   /translation="MSQQVRVAVFRPDDDRMSDAVELLDSLGATPIPDPMLAVEPTGAM
FT                   PDSGDYVILTSKTGVELLAEDGWEPNGSTLACIGPATADAARDSGWSVDIVPEEYTSSG
FT                   LVERLRDDVANATVEVARSDHGSDVLTDGLREAGADLHETVLYRLVRPEGAGQSTVMVA
FT                   GDEVEGVCFSSSLTVENFLDAAAERGVREEVIEGLNSLVVGVIGPPTRETAESYGINVD
FT                   VVPENADFEELACAVVETAAPTYHK"
FT   gene            124672..126108
FT                   /locus_tag="Hbor_01460"
FT   CDS_pept        124672..126108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01460"
FT                   /product="single-stranded DNA-specific exonuclease"
FT                   /note="PFAM: DHH family; DHHA1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65757"
FT                   /db_xref="GOA:E4NS72"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS72"
FT                   /protein_id="ADQ65757.1"
FT                   /translation="MSADGVTESSGPVPEMSDHAADCAARLRDADRVLLASHIDADGLT
FT                   SAAIASSALERAGIPFETVFSKQLDKEEVASIAATEYETVLFTDFGSGQLDIIADHEAA
FT                   GDFTPVIADHHQPADADTEFHLNPLRFGIDGASELSGAGASYVLARALEDEDGANRDLA
FT                   ALAVVGAVGDMQNSQGGLHGANAGIVADGVEAGVLEETTDLVIYGRQTRPLPKFLEYAS
FT                   DVRIPGISNDQNGAIEFLSDLDLDLKADGEWRRWVDLSMTERKTVVSALMRRAIASGVP
FT                   ADRIDDLVGTTYSLLAEKEGTELRDVSEFSTLLNATARYERADVGLAVCLGDRDDALEQ
FT                   ARTLLRNHRRNLSEGLQWVKNEGVTVEENVQWFDAGTRIRETIVGIIAGMAVGASGIRG
FT                   DIPILAFAEKSAEEVKVSARGSHVLVRKGLDLSVVMREASRAVGGDGGGHSVAAGATIP
FT                   AGTREEFVAEADRIVGEQLG"
FT   gene            complement(126125..127834)
FT                   /locus_tag="Hbor_01470"
FT   CDS_pept        complement(126125..127834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65758"
FT                   /db_xref="GOA:E4NS73"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS73"
FT                   /protein_id="ADQ65758.1"
FT                   /translation="MGRTRLRQAYHVARADFLQRARSRQLAVVLAVIASIGYLVNTGGV
FT                   KLAYQVRSDGTLQAFHGEPTAAYIGLKAGITGAIVLLFGGFYLMKNALQRDRNHGVAQL
FT                   VARTPISDRTYLFGKWLSNLAFGGVLILTLGVSSIANHAVHGVGPTTLTALLIPLLAFA
FT                   FPVAALVSGLALFSETVDPLNGMFGNICYFLFMPVVLGSTLTPVGDMLPGQLPLWVKSL
FT                   DLMGYIAIYTLTASSLLAQQPVYAGGLPSVGTLEATRAFYWNGGAWPLWVYPQRLGVVL
FT                   CGLCIVLVSTVPFDRLHETDPAEDSGWLLWASVPSVRNGLSSLLSALLSRLGGKQTNCD
FT                   GEQSERPAIESLSLTPVATRDAGGFHRLLVAELRLALRGRPWWWYGGAILLVGVPVVTL
FT                   VTTGAANISVEPVRTFVFPIAAIWPLIVWSDIGVRPVQHRVLPLVLSSRYPLKQLIAEW
FT                   LSGIIVAIGVGSGVFAVYIATGHTGALLGFVSGVLLAPSLATAAGSWSRSTTLFELSYL
FT                   TLWYVGPLNGAQPVDFIGATDASVEMGIPLAFVGLSAVLVGTALLRRTLELG"
FT   gene            complement(127836..128708)
FT                   /locus_tag="Hbor_01480"
FT   CDS_pept        complement(127836..128708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01480"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65759"
FT                   /db_xref="GOA:E4NS74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS74"
FT                   /protein_id="ADQ65759.1"
FT                   /translation="MLRTDGLSKQYGSDTWGIRDVSLELDEGIHGLLGPNGAGKSTLMG
FT                   ILTTVMKPTAGTAYWNGSDIVDAPDAVRPVLGYLPQDFGTYPDLTLSEFLEYLAALCGL
FT                   DSETASARITELIELVNLADARDRKLKTFSGGMHQRVGIAQALLNDPELLVVDEPTVGL
FT                   DPEERVRLRNALSNTGDDRVIILSTHIVPDVEATANKIALLDNGRILAHESVESLIDRV
FT                   AGNVFTCQIPRAEVAAFRERYQVCRSVQRPDGVDVRLIAETEPPETAEPVSATLEDAYI
FT                   NMIDRSDGD"
FT   gene            128881..129216
FT                   /locus_tag="Hbor_01490"
FT   CDS_pept        128881..129216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01490"
FT                   /product="HTH domain-containing protein"
FT                   /note="PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65760"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS75"
FT                   /protein_id="ADQ65760.1"
FT                   /translation="MDPEISAIAGVIDDQCSRCILVQAHEQYMSVSELADRCNVSESTI
FT                   YRRLDPLREHGLISERKRPEADGHHFTEFRTNLDRLSIQITADGFDIEIQRRKPMAERL
FT                   TDLVEKL"
FT   gene            129213..129524
FT                   /locus_tag="Hbor_01500"
FT   CDS_pept        129213..129524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65761"
FT                   /db_xref="GOA:E4NS76"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS76"
FT                   /protein_id="ADQ65761.1"
FT                   /translation="MIVPLQPFDVAITIETVVYGVLAFIIFSTMVSITVISYQGYRRYQ
FT                   SRAMKFFALGFGSLLLTQVLILPASHLLEFDPFIEQTSIQLTQAIGGLCILYAIRLNN"
FT   gene            complement(129608..130045)
FT                   /locus_tag="Hbor_01510"
FT   CDS_pept        complement(129608..130045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01510"
FT                   /product="predicted ester cyclase"
FT                   /note="PFAM: SnoaL-like polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65762"
FT                   /db_xref="GOA:E4NS77"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS77"
FT                   /protein_id="ADQ65762.1"
FT                   /translation="MTTDSLTPQERENERIARRIPEDVFGDGGLDVLGDLYAPNAVDHN
FT                   PFGSQEGLEAIRESYESFLSAFPDITQTVERSVVHGDVVALHITSRGTHSGVLWGIEPT
FT                   AKEIEVQQMAFVRIEDGLIAERWFLSDNLTLLRQLGVVDFP"
FT   gene            130188..130823
FT                   /locus_tag="Hbor_01520"
FT   CDS_pept        130188..130823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01520"
FT                   /product="predicted DNA binding protein"
FT                   /note="PFAM: HTH DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65763"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS78"
FT                   /protein_id="ADQ65763.1"
FT                   /translation="MPHLKIKLNGEKIGGWLAELSTEFPADVFRLLATQLRDQGALVTL
FT                   EVRTPDGGDVIQEFETTPEVGNVEVLHADSQVVLLQFLTKHSRAYDPLYESGCISIYPT
FT                   TLQNGWFSVHVVAGHDSLSSYVEELTAAEIPYQVLSLSQSHDTATILTNRQRQFIETAL
FT                   EEGFYDDPRACTLTELAATLDIHKSAASRLRHRAESRLITHVATGFAQ"
FT   gene            131180..131425
FT                   /locus_tag="Hbor_01530"
FT   CDS_pept        131180..131425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65764"
FT                   /db_xref="GOA:E4NS79"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS79"
FT                   /protein_id="ADQ65764.1"
FT                   /translation="MGKWFRLYTKIHTYQYAVLGIVGIVATIIFASPGTDFIHVGRQRL
FT                   DVFYISLALFGALFVLSVTDEYSPEDYGLYSSKSEK"
FT   sig_peptide     131180..131272
FT                   /locus_tag="Hbor_01530"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(131972..132175)
FT                   /locus_tag="Hbor_01540"
FT   CDS_pept        complement(131972..132175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65765"
FT                   /db_xref="GOA:E4NS80"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS80"
FT                   /protein_id="ADQ65765.1"
FT                   /translation="MNTIQDGSRARLLRVIGGLALVVQSIVFESTFGIVTDPGVSGILR
FT                   DVLSGGLLLVASVCLLVGVYFR"
FT   gene            132570..132887
FT                   /locus_tag="Hbor_01550"
FT   CDS_pept        132570..132887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65766"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS81"
FT                   /protein_id="ADQ65766.1"
FT                   /translation="MADFDPEKFEDKYVHYFPQLQRAYKNAFNTMNEEYDSTLIHAIDQ
FT                   QILNESEPMYEDGDFHIQLPENPSERLTGVVVEDEKLDAVLDRYLDELVAEHRRIFGLN
FT                   G"
FT   gene            132939..133298
FT                   /locus_tag="Hbor_01560"
FT   CDS_pept        132939..133298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01560"
FT                   /product="thioredoxin-like protein"
FT                   /note="PFAM: NifU-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65767"
FT                   /db_xref="GOA:E4NS82"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS82"
FT                   /protein_id="ADQ65767.1"
FT                   /translation="MSTDASNTDDDLKERVTNFLRRNFPQIQMHGGSAAIQHLDREEGE
FT                   VTIMLGGACSGCGISPMTIQAIKSRMVKEIPEIEKVNAETGMGGDGGHDSMSPSFPGES
FT                   SSDDSDSDEGPQAPF"
FT   gene            133370..134911
FT                   /locus_tag="Hbor_01570"
FT   CDS_pept        133370..134911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01570"
FT                   /product="arylsulfatase A family protein"
FT                   /note="PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65768"
FT                   /db_xref="GOA:E4NS83"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS83"
FT                   /protein_id="ADQ65768.1"
FT                   /translation="MSSESPENVLFVVMDTVRKDRLTPYGYDRPTTPNLESFAEEATVF
FT                   EQAVAPAPWTLPVHASLFTGMYPSRHGADQENPYLEGATTLAQTLSAAGYDTACYSSNA
FT                   WITPYTHLTDGFTDQDNFFEVMPGDFLSGPLAKMWKTLNDNDSLRTLADKLVSIGNVAH
FT                   EYLAGSDGADSKTPAVIDRAMTFIEGSEQSFTFINLMDAHLPYHPPDRFAREFAPGVDS
FT                   TEICQNSKEYNSGARDIDEEEWEAIRGLYDAEIAHIDDQLGRLFDWLKETGRWDDTMVV
FT                   VCADHGELHGEHDLYGHEFGLYDPLVNVPLMVKHPALEEDRHEDQVELIDMYHTVLDAL
FT                   DVEGGTPAEPDDDAVALDRTRSLLSASYREFSKASNDDSGQIRDGEYAFIEYSRPVVEL
FT                   KQLEEKASSAGITLSEDSRFYSRMRAARRPESKYVRIDRIPDEAYRLDEDPDETEDLSE
FT                   AGDDVIEATESALSKFESNIGGAWTDALDDDVSDDSVEQMDEEAQERLRDLGYLE"
FT   gene            complement(134930..135829)
FT                   /locus_tag="Hbor_01580"
FT   CDS_pept        complement(134930..135829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01580"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase PanE/ApbA; Ketopantoate
FT                   reductase PanE/ApbA C terminal; TIGRFAM: 2-dehydropantoate
FT                   2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65769"
FT                   /db_xref="GOA:E4NS84"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS84"
FT                   /protein_id="ADQ65769.1"
FT                   /translation="MDVLVFGAGSLGTLVGALLARVHDVTLVGRDPHVSHVRERGVTVS
FT                   GAIEAQTAPDATTESDGHRADLAVVTVKSFDTPTAAAALSTGAFDAVLSLQNGLTEDEL
FT                   AARLDAPVLAGTATYGARLREPGHVECTGIGRVVLGARDGGTDRRAERVGKAFRDAGIE
FT                   TLVASDMPRRLWEKLAVNAGINAVTALARVENGALADGPGHQLAHRAARETARVARAEG
FT                   VSLSNRRAERALDEVVEATSANRSSMLQDVDDERRTEVEAIHGVVVARADAHRLSVPTN
FT                   RTLADLLRTWEAGRGVRE"
FT   gene            complement(135925..136215)
FT                   /locus_tag="Hbor_01590"
FT   CDS_pept        complement(135925..136215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS85"
FT                   /protein_id="ADQ65770.1"
FT                   /translation="MSGEKSIASIGTTVYTEDGDELGTVRGFDEDGFFVTTREGIASLS
FT                   IEHERAGHEFGEAELMWRCANCGEMDTLDELPDSCPGCNAPKEELYYWTED"
FT   gene            complement(136371..139958)
FT                   /locus_tag="Hbor_01600"
FT   CDS_pept        complement(136371..139958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01600"
FT                   /product="DNA polymerase type II, large subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase II large subunit DP2; TIGRFAM:
FT                   DNA polymerase, archaeal type II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65771"
FT                   /db_xref="GOA:E4NS86"
FT                   /db_xref="InterPro:IPR004475"
FT                   /db_xref="InterPro:IPR016033"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS86"
FT                   /protein_id="ADQ65771.1"
FT                   /translation="MHEDDERYFARIEDRLDEAFDLARAAKGQGRDPQPEVEIPVAKDM
FT                   ADRVENILGIPGVAERVRELEGQMSREEAALELVNDFVEGSVGDYDSRAGKVEGAVRTA
FT                   VALLTEGVVAAPIEGIDRVEILENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADYARS
FT                   LLGIEEYKARDIEVERYAEEIDLYDKETGLQYSPKDKETKFIAEHMPIMLDGEATGDEE
FT                   VSGFRDLERVDTNSARGGMCLVMAEGIALKAPKIQRYTRQLDEVDWPWLQDLIDGTIGK
FT                   DDGDKADADDDGDDEEADAEDDEADDGETPDSPEPAGPARVDPATKYLRDLIAGRPVFG
FT                   HPSEAGGFRLRYGRSRNHGFATAGVHPATMHLVDDFLATGTQIKTERPGKAGGVIPVDS
FT                   IEGPTVRLANGDVRRIDDPEEALEVRNGVEEIIDLGEYLVNFGEFVENNHPLAPASYVY
FT                   EWWVQEFEAAGAPIQALEDDPSVDLEHPTPERAFEWATEYDCHLHPDYTYLWHDVSVAE
FT                   FEALADAVSSGRIADVEADGGVVVRPTDTDPTDGILELDRTEDVTRTLEQLLVEHTQTE
FT                   ETLRIPEWRPLVRSLGLTEELEQTWDDLSAEAREWDGGDNAVKAVNEVAPFDVRERAPT
FT                   RIGNRMGRPEKSESRDLSPAVHTLFPIGEMGGSQRDVGEAARERNERGARGEVNVLVGD
FT                   RQCPDCGTQTYKNVCPECETHTEPHYECEECGTVVEPDESGRVFCERCEREVESPDWYA
FT                   IDIGAELRAALENLGERESSYPILKGVKGLTSSNKTPEPIEKGVLRAKHGVSSFKDGTV
FT                   RYDMTDLPVTSVRPAELDVTADHFRELGYETDINGEPLQFDDQLVELKVQDIVLSDGAA
FT                   EHMLKTADFVDDLLTEFYGLEPFYEVSERDDLVGELVFGMAPHTSAAVVGRVVGFTSAA
FT                   VGYAHPYFHAAKRRNCDGDEDCVMLLMDGLLNFSKEFLPDKRGGQMDAPLVMSSRIDPS
FT                   EIDDEAHNMDIVRQYPTEFYEATLEMADPGEVEDLIQLGEDTLGTDDEYRGFDHTHDTS
FT                   DIALGPDLSAYKTLGSMMDKMDAQLELARKLRAVDETDVAERVIEYHFLPDLIGNLRAF
FT                   SRQETRCLDCGEKYRRMPLTGDCRECGGRVNLTVHQGSVNKYMDTAIQVAEEFDCRPYT
FT                   KQRLEVLEKSLESVFENDKNKASKLGDFM"
FT   gene            complement(139961..140380)
FT                   /locus_tag="Hbor_01610"
FT   CDS_pept        complement(139961..140380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01610"
FT                   /product="predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /note="PFAM: Domain of unknown function (DUF296)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65772"
FT                   /db_xref="GOA:E4NS87"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS87"
FT                   /protein_id="ADQ65772.1"
FT                   /translation="MNYRAVESSREFLVSLDNGADWREEIEEFAHLEDIESAWFNAMGA
FT                   VQDADVWFYDQDDQAYRSVTFDEPLEVAACVGNIALLDDEPFAHTHAVLSRPSGQSLAG
FT                   HLNAATVFAGEVYIRAFDEPLEREHDDVTDLDLWL"
FT   gene            complement(140569..140763)
FT                   /locus_tag="Hbor_01620"
FT   CDS_pept        complement(140569..140763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65773"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS88"
FT                   /protein_id="ADQ65773.1"
FT                   /translation="MYGCYRLSNMTPNVTAASDASRAEVMASVDSTPARSEFIIADISC
FT                   DNAWLSMTVEEAPSLRDWA"
FT   gene            140863..141363
FT                   /locus_tag="Hbor_01630"
FT   CDS_pept        140863..141363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65774"
FT                   /db_xref="GOA:E4NS89"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS89"
FT                   /protein_id="ADQ65774.1"
FT                   /translation="MDLDSDTIDSRPRDDTEPDDGMPPVGQLLRALLDAATWGVVFLLG
FT                   GSVLLGLIGLVIGNGLVGFKRGLFIFGFLAMGGSLLMLRPKRAWKRGRDEDAPGAPTDV
FT                   PDGATENDNVTDGDSGPVTLLPDSLAPNPVHRSSWGLRVFFGGIWALVASYLMETVFGV
FT                   VPV"
FT   gene            141481..142326
FT                   /locus_tag="Hbor_01640"
FT   CDS_pept        141481..142326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01640"
FT                   /product="CBS domain-containing protein"
FT                   /note="PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65775"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS90"
FT                   /protein_id="ADQ65775.1"
FT                   /translation="MNVADAMTPREDVVTVELPGTRDDVLEYLQERGFSSVPVVKRTDD
FT                   GEAYRGIVTRQDLIEHPDENQLAVLMNDVPTTTADTSVEDVAHMMVEKNARRVPVVDGT
FT                   LEGIITVTDVIRAIARGEVELDAGAADVATRDVNTTYEEAPLTVAEREIFYANVPYAVA
FT                   LDETGTMSGILTEVDIIDVARVVEGEDDTGDSVANQDDDWMWEGIKAVGNRYIPTRNVE
FT                   IPAEPVSTFMSTDLVTVSKRTSAVEAAQAMITNDIEQIPLVGGDQLTGIVRDVDLLEAL
FT                   "
FT   gene            142327..144117
FT                   /locus_tag="Hbor_01650"
FT   CDS_pept        142327..144117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01650"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   glycyl-tRNA synthetase, dimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65776"
FT                   /db_xref="GOA:E4NS91"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS91"
FT                   /protein_id="ADQ65776.1"
FT                   /translation="MTADRTEGERLTELAKRRGYYFGSSEAYGGTAGFYTYGPQGAALK
FT                   SNVEDAWRERFTVQEGNLEIDAPTIMPEPVFEASGHLDTFDDMLVECPECAESHRADHL
FT                   IEDNSDLEDAETLSLEEAAEEIAALDLVCPNCGAELAGQSVDNFNLMFETNIGPGSSDP
FT                   GYLRPETAQGIFVEFPRIKEYARNRLPFGVTQVGRAYRNEISPRKSIVRTREFTQAELE
FT                   QFIDPERDEPDLSAVEDVAVLLYPATEQQKDDGDYIETTIGAAVEDGSIGNAWLGYFLG
FT                   IAQEWYERVGVDMDRFRFRQHLAGERAHYSSDCWDAESEVDGDWIEIAGFSYRSDYDLS
FT                   KHAEYSEEDYTVFRQYDEPKTVERAVVDPDMSVLGPKFGGAAGDVKDALERLAERDPDA
FT                   FDGDEVTVEVDGETHTVETDVTNFAVEEQTINGEHITPHVVEPSFGVDRTVYTLLAHAY
FT                   EEDEVDDEERTYLSLSPEVAPRDVGVFPLVSNVPELVDLADEIVDDLRAAGLSVVYDDS
FT                   GSIGRRYRRQDEVGTPFCITVDRDGLESDGETTVTVRERDSGRQIRVPVSALADELGAV
FT                   RGGDRTFDDLAAEYDELTDD"
FT   gene            144124..144750
FT                   /locus_tag="Hbor_01660"
FT   CDS_pept        144124..144750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01660"
FT                   /product="dolichol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65777"
FT                   /db_xref="GOA:E4NS92"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS92"
FT                   /protein_id="ADQ65777.1"
FT                   /translation="MSPRISVSKSEVKRRLVHASGAALPFGYVLDIVSWAQLRYLMVFL
FT                   TVVVAVLEFLRLRVGLDWAIYDELTRSYEQTNLAGYALYIFSMTAVVLVFEPYVAVPGM
FT                   LMLALGDPVSGLLGRTREAGEPKRLGTLAAMFIVCLAVSVPFLLPVAGTIGVIAAVAGS
FT                   VGATIADGMKPVIRGSVIDDNASIPPAACLAIAAVLAATGAAAVT"
FT   gene            144826..145311
FT                   /locus_tag="Hbor_01670"
FT   CDS_pept        144826..145311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01670"
FT                   /product="potassium/proton antiporter regulatory subunit,
FT                   CPA2 family"
FT                   /note="PFAM: TrkA-C domain; TC 2.A.37.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65778"
FT                   /db_xref="GOA:E4NS93"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS93"
FT                   /protein_id="ADQ65778.1"
FT                   /translation="MTVYESDLPGVGKKHEVELGDGGRLIIVTHNSGKREVFRRADADS
FT                   DSEKLFELSDKLARQVGTLLEGAYFQPVETDRIETLLGDNTLLEWVEVGPDSPIAGQTL
FT                   GESNLRQTTGASVIAIERDDGVTVSPGGDTTIEAGDTLVIIGPRQACRDALSTVRGD"
FT   gene            145311..146447
FT                   /locus_tag="Hbor_01680"
FT   CDS_pept        145311..146447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01680"
FT                   /product="potassium/proton antiporter membrane subunit,
FT                   CPA2 family"
FT                   /note="PFAM: Sodium/hydrogen exchanger family; TC
FT                   2.A.37.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65779"
FT                   /db_xref="GOA:E4NS94"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS94"
FT                   /protein_id="ADQ65779.1"
FT                   /translation="MAADLLELGQLFVVVAVTGAIALRVGLSVIPLYVIGGVLAGPFVA
FT                   GRLGLPYVENGEVVTLFAEVGIVLLLFFLGLEFSLDRLLESRTRITRSGVADIAVNLPI
FT                   GIGIGLLLGWSVVESLLLGGIVYISSSAIITKSLIDLGWIADPEAEPLLGTLVFEDLFI
FT                   AVYLAVVTSLVLGGDGIGSIGRSLAVAFGFLGILLVAVQYGNRLFARVLDVSGQEAFVL
FT                   RTLAVVVPIAGAALALGVSEAVAAFFVGMGFATSGHREKIEHLLTPVRDVFGAVFFFWI
FT                   GVGTDPTLIGAAAVPLVLAVVLTTPAKVVSGYLGGRVYDLSKRRSLRVGVGMVPRGEFS
FT                   LVIAALAASGTTPIMREVIPAFAVGYVLVMSAIGTVLM"
FT   gene            complement(146536..148431)
FT                   /locus_tag="Hbor_01690"
FT   CDS_pept        complement(146536..148431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65780"
FT                   /db_xref="GOA:E4NS95"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS95"
FT                   /protein_id="ADQ65780.1"
FT                   /translation="MDATVHGEAGNPREDIRWTMTRKLLTIVLVMLFLGASSLGVVGID
FT                   AAPMMSVEQATQPSTGAGASTEMQSSNETETPNETASSNETGLNETEPSSEAGTSSTEP
FT                   GESSNATGASNETESSNETAPNETESSAVSSDPSNEAGPTETGTSNETEPANGSNDSSN
FT                   ETEPTTETESSNETESANGSNDSSNETEPATETESSNETESSNETEPTTETESSNETEP
FT                   TTETESSNETEPSNETEPSTETGPSNETEPSNESSGSSTETGQSNADAASDTAATNDES
FT                   PGSSPNSNRGENVGVVAQNAATGANNTVIVNVNNAGVTQVAISLQYNRGANGTSGNNTA
FT                   QNLVLVNQNALATGNNSSAINVNNAGVTQVAISLQYNEDANGTQAIPGPDSGANFTAED
FT                   TARLLDQLGIPLGELVTTERNLQSQVFEGKNGTKVRVTVNQNVTIGFPIEREVPDEERL
FT                   TRDEISQAKYGYDFAALSAETTGQVEEIYNRQPFAGQRNVTDVLTREEIARQQYDKRLK
FT                   NVNREQIIEIENTYHEQFACSVEQNSTYTRDEISQAKYGYDFAALSTETTGQVQEIYNR
FT                   QPFSDSFAPEHVLTREEIARQRYGADFDNLGPKERIQVQDLFDIQFQCTADAMAN"
FT   gene            149008..150243
FT                   /locus_tag="Hbor_01700"
FT   CDS_pept        149008..150243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01700"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65781"
FT                   /db_xref="GOA:E4NS96"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS96"
FT                   /protein_id="ADQ65781.1"
FT                   /translation="MTSVALAFSGGLDTTVCVSLLQEEYGYDEVVGVTVDVGQPESEFE
FT                   EAKETADAHGLDIHVVDAKDEFAELCFDSVRANATYQGYPLGTALARPVIAEAILEVAQ
FT                   EEGCDALAHGCTGKGNDQLRFEAVWRASDLDVIAPVREMGLTREWEKQYADEKNLPVQA
FT                   GNDGVWSIDTNLWSRSVEGGDLEKPGHVPSEDIYEWTEQPGSETECIEITFEEGYPVAL
FT                   DGEEMEPVELIETLNELAGQYGVGRTDMMEDRMLGLKVRENYEHPAATTLLNAHESLEG
FT                   LVLTKDERDFKTTVDNEWAQKGYEGLVEAPLMAALDGFIEQTQTKVTGTVTIKFEGGQA
FT                   RPVGRESEYAAYSESAASFNTETVDGITQEDATGVAKYHGFQTRIANAAFESAQKEAPE
FT                   LATDGGVSNDGQ"
FT   gene            150247..151716
FT                   /locus_tag="Hbor_01710"
FT   CDS_pept        150247..151716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01710"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="PFAM: Lyase; TIGRFAM: argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65782"
FT                   /db_xref="GOA:E4NS97"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS97"
FT                   /protein_id="ADQ65782.1"
FT                   /translation="MNEEGGDEGVVRRDRFSGGPARGFMSSLAADERIFAADVAVDRAH
FT                   VVMLEEQEIVESDVAAEILAALDDVESEGHAALPEGEDVHEAIETAVVEQVGPDGGKMH
FT                   TARSRNDEVATCIRYRLREDLLDAIEATLALREALVDAAEAEVETVMPGYTHLQPAQPT
FT                   TVAHYLLSYEAAFARDTARLLDAYDRTNQSPLGAAAFAGTPFDIDRERTAELLGFDGVL
FT                   RNSMDASSARDFLLESVSALATHATTLSGLAEDLVIFSNKGFVELSDDYASTSSIMPQK
FT                   VNPDTLELVRATAGDAASGLSGLLTTLKGLPRAYNRDLQRATPHAWDAVDSVSEATAVV
FT                   AGAVSSASWPEETLESAAGDGFSTATGVADALAMAGLPFRTAHEVVAAAAERAEGTPDL
FT                   ATLDASAEEVLDASLFEYVSRADVQQTLDPTHSVESRDSTGGPAPAAVTAQLDEATVEL
FT                   NDHRTELNTRTDALESATEKLAAEVAVITRD"
FT   gene            151953..152132
FT                   /locus_tag="Hbor_01720"
FT   CDS_pept        151953..152132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01720"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65783"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS98"
FT                   /protein_id="ADQ65783.1"
FT                   /translation="MADTITAEDPLTGEEIELPGDVEVGEIVDSPATGAELEVVSVDPV
FT                   TLEEAPELEEDWGE"
FT   gene            152134..153009
FT                   /locus_tag="Hbor_01730"
FT   CDS_pept        152134..153009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01730"
FT                   /product="L-2-aminoadipate N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: RimK-like ATP-grasp domain; TIGRFAM: Lysine
FT                   biosynthesis enzyme LysX; alpha-L-glutamate ligases, RimK
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65784"
FT                   /db_xref="GOA:E4NS99"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4NS99"
FT                   /protein_id="ADQ65784.1"
FT                   /translation="MKVGLLYSRIRRDEKLLLTELRERGHEVAKIDVRKEQFNISEPPA
FT                   AFEDVDIVLDRCLATSRSLYTTRFLDAYDIPVVNSADTADVCADKVKNSLALEQAGVPT
FT                   PNTEVAFTTDSAMKSIKKFGYPCVVKPVVGSWGRLMAKIDSPAAAEAILEHKATLGHYQ
FT                   HKVFYVQEFVKKPGRDIRVLAVDGEPIAAMTRSSDHWLTNAAKGADAEAFELDDRAKEL
FT                   VQKASDAVGGGLLGVDLMETGDDYTVHEVNHTVEFKALNNAVEKDVPAAVVDWLETKAN
FT                   GDAKVAEATA"
FT   gene            153006..154064
FT                   /locus_tag="Hbor_01740"
FT   CDS_pept        153006..154064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01740"
FT                   /product="N2-acetyl-L-aminoadipate semialdehyde
FT                   dehydrogenase; N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.-"
FT                   /EC_number="1.2.1.38"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD binding
FT                   domain; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65785"
FT                   /db_xref="GOA:E4NSA0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA0"
FT                   /protein_id="ADQ65785.1"
FT                   /translation="MKRETTESEYTAAVVGGTGFTGGELLRLLYQHPNFDVVQATSRSK
FT                   ERKTVGHVHPNLREMDLRFTSPEDLESVDVLFAATPHGVSMEHIDAFQDAADTVVDLSA
FT                   DFRLNTEAQYDEWYDGHVCPEYLEQAEYALPEINRENLAGADLIASGGCNATATILGLK
FT                   PLFDADVLSGDEQVVVDVKVGSSEGGAGGGDASSHPERSGIVRPYAPTGHRHEAEIEQF
FT                   LGVSVSFTVHAVDMVRGASATCHVFPESPVSKGDLWKAYRGTYADEPFVRTVAGGGGVY
FT                   RYPEPKSVAGTNMAEVGFELDPSNRRVVVFSAIDNMMKGSAGQAVHAANVALGVEETAG
FT                   LEFTGLHPVGAP"
FT   gene            154139..155116
FT                   /locus_tag="Hbor_01750"
FT   CDS_pept        154139..155116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01750"
FT                   /product="N2-acetyl-L-aminoadipate kinase;
FT                   N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /EC_number="2.7.2.-"
FT                   /note="PFAM: Amino acid kinase family; TIGRFAM:
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65786"
FT                   /db_xref="GOA:E4NSA1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA1"
FT                   /protein_id="ADQ65786.1"
FT                   /translation="MTHYTRDELAALHDELADNEPTLCADGGTVPADDPPVVVKVGGAR
FT                   AVDPAGAVQDVAHLVANGRDVVVVHGGSTAVDDTLEELGEEPTYVETPSGVVGRFTDER
FT                   TMEVFSMVMPGKLNTDLVTTLREAGVDALGLSGVDGGLLTGPRKSAVRVVEDGKKKIKR
FT                   GDHSGRITNVNADLLETLMADTYVPVVTVPMLADDGVAVNADADRAAAAVAGALGAELV
FT                   VLTDVSGVYEDPDDDSTLIESVTTADEFEALESAAEGFMTKKVMAAKEALTGGAMKVIV
FT                   ADANVNDPIIEALHGGGTHVDAAAVGGADNKTDDSDADAEEVDA"
FT   gene            155113..156249
FT                   /locus_tag="Hbor_01760"
FT   CDS_pept        155113..156249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01760"
FT                   /product="acetylornithine aminotransferase apoenzyme;
FT                   N2-acetyl-L-lysine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: Aminotransferase class-III; TIGRFAM:
FT                   acetylornithine and succinylornithine aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65787"
FT                   /db_xref="GOA:E4NSA2"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA2"
FT                   /protein_id="ADQ65787.1"
FT                   /translation="MSGFVFNEKPINIESGEGAYLYGSDGTEYLDFGASYAVAALGHAH
FT                   PAVTDAVQKQAEKLTYVQASYPVDVRTELYEKLAAVAPDGLENVWLCNSGTEANEAAMK
FT                   FARSATDRSKIIATKRGFHGRTMGALAMTWKDKYKKPFEPLAGDVEFVTYGDEAELAEA
FT                   IDEETAAVFLEPVQGEGGIHPAGTEYLQTARKLTEEAGAALAFDEIQTGIGRTGTLWAC
FT                   EGAGVTPDILTSAKGIANGLPLGATLVADWIAENPGNHGSTFSGGPVVCAAANATLDTI
FT                   VEEDYPSHAAAVGEYLKAELEAAAEEHDLPVRDVRGQGLMLGVQVKRGANRVLKNLAIS
FT                   EQVLALPAGRTVVRLLPPLVVTEGHADEFVESFVEVTK"
FT   gene            156246..157319
FT                   /locus_tag="Hbor_01770"
FT   CDS_pept        156246..157319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01770"
FT                   /product="acetylornithine deacetylase; N2-acetyl-L-lysine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /EC_number="3.5.1.16"
FT                   /note="PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM:
FT                   N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65788"
FT                   /db_xref="GOA:E4NSA3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA3"
FT                   /protein_id="ADQ65788.1"
FT                   /translation="MSAELDDEAFDVQTDLTDGLDEAQALLADLVSIPSVSGDESAAAE
FT                   RLKSFFETHDREVWIDEVGNVRAPADDSVLLTSHIDTVPGEVPVKIEDGVLWGRGSVDA
FT                   TGPLAAMAVAAVETGVSFVGVVEEETSSTGAWHLLEDREEPDAVINGEPSGWDGITLGY
FT                   RGFLSGTYVATSELGHSSRPENNAIQSAVDWWSRVADFFEAEDEDGVFDTVTTKPVNFE
FT                   GGPTEDGLAVEATVDVQFRVPPHLTIEDIQEVAEGELVEGSVHWEKPIPPVMTSPRTEV
FT                   ARAFRVAIRNADGDPRLLRKTGTSDMNIFASEWNCPMATYGPGDSDLDHAPNEHLDLAE
FT                   YDAAIEVLTNVCETLTE"
FT   gene            157325..158224
FT                   /locus_tag="Hbor_01780"
FT   CDS_pept        157325..158224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01780"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="PFAM: Aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn binding domain; TIGRFAM:
FT                   ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65789"
FT                   /db_xref="GOA:E4NSA4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA4"
FT                   /protein_id="ADQ65789.1"
FT                   /translation="MLETTHFLDIDDLTTTELHHVLDRAAAIKAGKEDPRLEDQTLGML
FT                   FEKPSTRTRISFETGMTQLGGHAIFLGPEDIQLGHGEPLSDTSRVLSRYVDVVMARLFD
FT                   HEDLVEIADYADVPVVNGLTDDAHPCQTLADLLTIREAFGGFEDVQAAWVGDGNNVGQS
FT                   FVLGCAMAGLDLTVATPEEYGIDEEVLAHAAEYGGEPTIAETPAQAVADADVVYTDVWI
FT                   SMGQEDERDEKIAAFEGYQVNEGLLAETDAEVMHCLPAHRGEEISHDVLESDRALVWDQ
FT                   AENRLHAQKGLLVELLNK"
FT   gene            complement(158264..158725)
FT                   /locus_tag="Hbor_01790"
FT   CDS_pept        complement(158264..158725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65790"
FT                   /db_xref="GOA:E4NSA5"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA5"
FT                   /protein_id="ADQ65790.1"
FT                   /translation="MATEATMQTVESTSNDDWQAGVLAGIIGGIVMGAMMVVQMRSALE
FT                   VAIPSMYFFSGGLAGFTIHVAHGAILGVVFAAVAATRNLSTGQSLGLGVAYGVALWAVL
FT                   AVFVMPVWLSVVGSPANPPLPNVNVTSLVGHVVYGGVVGVAYSAVRDRF"
FT   gene            complement(158842..159309)
FT                   /locus_tag="Hbor_01800"
FT   CDS_pept        complement(158842..159309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65791"
FT                   /db_xref="GOA:E4NSA6"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA6"
FT                   /protein_id="ADQ65791.1"
FT                   /translation="MEQQQRDEQSELTTGVERWQAGVVAGLLGAVAFSALLAISAPAAL
FT                   TAAIPSMYGLSGGMAGMGIHLSHGALLGVVFVAVLRLWPDPGRTVTRAAIAGTAYGVVL
FT                   WGILAVFVMPLWLSAVGFAGAPSLPAFDLMSLVGHVLYGIVLGATYPRLRR"
FT   gene            159538..161715
FT                   /locus_tag="Hbor_01810"
FT   CDS_pept        159538..161715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01810"
FT                   /product="DNA helicase, Rad3"
FT                   /note="PFAM: DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65792"
FT                   /db_xref="GOA:E4NSA7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA7"
FT                   /protein_id="ADQ65792.1"
FT                   /translation="MAETSGYMRFFPYDRPYPNQGEAMDGIAEALEAERDVLVEGAPGT
FT                   GKTLSALVPAVEYARQEDKTVVITTNVHQQMRQFVEDARAITRTEPIRAVVFKGKSSMC
FT                   HIDVEYQECQTLRDTTRSLVEKEQDKAELSEQADALVDRMRAGEQGAADARTAVTDELD
FT                   TLEDELEDLREGNICEYYYNNLTEDTDEFFSWLFDDVRTPEDIYEYADQRKLCGYELLK
FT                   EGMEEVDLVVCNYHHLLDPNIREQFFRWLNREPEDVITVFDEAHNIESAARDHASRALT
FT                   ENTLEQALNELEDTDDSRADSAENVISAFLDALKETYDEAFGFGEREQVGEDWYDLPIA
FT                   NNDRRDDLTLAFLDRYEGRGISTEVELALQLGKRLDDEYEEAYKDGEATTRQECQTLQA
FT                   ATFIDTWMADGGKLGQHPMCSVRRDGGTDEVYGRAELYTCIPREVTETLFEEVHASILM
FT                   SATLRPFDVTEDVLGLSDPATMAYGLAYPEENRHTIAVQTPALFSSEREEPATQETLTQ
FT                   VLTDASRFTPGNTLVFFPSYAEAERYHERLQARMDVTDRLFLDESGTPTEEIRSKFVES
FT                   QSAILLTSLWGTLAEGVSFDGDDARTVVVVGVPYPHLSERMEAIQDAYDRVYSSRREAG
FT                   WRYAVEIPTIRKTRQALGRVIRSPDDFGVRILADKRYTRASSEMGKYGVRSTFPPEERA
FT                   EIVDVSAEKLKFAMLNFYGDHDAYDGDPPRP"
FT   gene            161785..163143
FT                   /locus_tag="Hbor_01820"
FT   CDS_pept        161785..163143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01820"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65793"
FT                   /db_xref="GOA:E4NSA8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA8"
FT                   /protein_id="ADQ65793.1"
FT                   /translation="MSTRPPGPKGVPLFGNSREYAKDPFTFLRQVSEAYGDVVYFGLGP
FT                   LDTYMLTNPADIERVLVSEDAKFHKPDFQDDAIGTLLGDGLLLSEGETWRKQRELAQPS
FT                   FDPRRIAALGETMTDHATAMVEGWNDGEVRDVQLEMARVTVKIIVDAMFGSSLADERVR
FT                   TVQENLEPLGKRFEPDPLRFLIPDWAPTRENREYKQSISILEGIIDDVVAERLGTENDP
FT                   SAAVAGEDGAPMDLLSVLLRAKQRGEQTDQQIRDEMMTMLLAGHDTTALTLTYAFYLLS
FT                   QHPESEAKVQAEVDKVCGGETPTVADVRQFDYLERVLQEAMRLYPPVYVIFREPQVDVR
FT                   LGGYRIPSGSAIMLPQWVVHRSPRWYDAPTEFDPDRWRPERRASRPRFSYFPFGGGPRH
FT                   CIGKQFSMMEAKLILATVAQAYELDYVRDRPFSLRGSLTMHPEEPMGMRLRAR"
FT   gene            complement(163203..163715)
FT                   /locus_tag="Hbor_01830"
FT   CDS_pept        complement(163203..163715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65794"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSA9"
FT                   /protein_id="ADQ65794.1"
FT                   /translation="MFSLNVPVPGQVERLAGDLHPALTPFDAVRDRHTLVVKRFDTNLD
FT                   PDADSLPRLRERLRETLRSVAPFEARIDGIDYFERPTRGDGPVVYLRVESSGLHELHRR
FT                   LCTEFGTVEGMEGDEYTPHVTLARGGRIDDAAALAEREIEAVRWTVGEVRVWDSRYRED
FT                   AARIPLR"
FT   gene            complement(163763..163960)
FT                   /locus_tag="Hbor_01840"
FT   CDS_pept        complement(163763..163960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65795"
FT                   /db_xref="GOA:E4NSB0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSB0"
FT                   /protein_id="ADQ65795.1"
FT                   /translation="MFPGTRGGIDVEDLLKLILVLVVIWLVLKIVGDVVGFVTHLLGPL
FT                   QPLLGVVILVLIVLWLLDRI"
FT   gene            complement(164069..165031)
FT                   /locus_tag="Hbor_01850"
FT   CDS_pept        complement(164069..165031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65796"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSQ8"
FT                   /protein_id="ADQ65796.1"
FT                   /translation="MESTIEGEDENYVKVYITDNLDSEHELTIDKNSGDIPYHQCDAYA
FT                   DDANRRTSEENEYNNQARRYAKYYVFAQRGYDTVEHIENPAYVDAVRRAIADLSPAEFK
FT                   RYFGALYRQLRSHHDDTERPRELPSGVRKPDAVVYEPEIYLGLEAVGEDVAERAQALAT
FT                   AHGFDLEESAEVQPVSELSDETLSRWKAFGDDLAAIVTREDLTTNLTITGVSGLHIGYP
FT                   NRLGKHEVDEADSPFTHQADARLSLLPYAPESFDEFPAYLDHHLRCQVRDCFLKMGVVP
FT                   PEEFHVVGFGKFRDSRRYDHFEMYPEVHKRDGNHTPLLG"
FT   gene            complement(165031..165564)
FT                   /locus_tag="Hbor_01860"
FT   CDS_pept        complement(165031..165564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65797"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSQ9"
FT                   /protein_id="ADQ65797.1"
FT                   /translation="MQGGKIGVHRMEHSDVHVQRMPAEADDGMLYGAVEDLQQQVSEHD
FT                   ESIETHKTNIKNIEDRQEQMMGTLLEASPGAPEDFDWQGASMKGATGVGVGLGIGAMTG
FT                   SPEATGAAAFIGGVTSIAQTVSREFVGTMMNNRPGGEADKLEQMYYEMAEMYQEFIEAR
FT                   NDHGGSDPYSGGGQ"
FT   gene            complement(165613..166647)
FT                   /locus_tag="Hbor_01870"
FT   CDS_pept        complement(165613..166647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65798"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR0"
FT                   /protein_id="ADQ65798.1"
FT                   /translation="MRAVLGGEDDGGVGLRVIDNNEVSHGISVNFDGEITYHEQDGYPD
FT                   DPSERTRAGNIHVNQARRFAKYWVYRKRGYDTIPPTENPDRIIAAAIALTPLEPETAET
FT                   HLGDFYQHFQSINGTADSPVEMPEGVPEQGGGTVYQKDIYVGLEDETLGTIAADLLADP
FT                   KLMELVGKSVGVGGESLVGAEYVPTFKELIAEASDRDSDSLPSLSEGLLLEATSGIHVH
FT                   WDDPPGEYHTQWGDQPDLGRDPAARIEIFPFEPDSITELQAQVARHLLCQIRDCYLTMG
FT                   IAPPEQFRILGHGRHEATGLYASYDIYDEYFDPNAEIDTWYVENTPEGAYEHEPANKNV
FT                   QTKA"
FT   gene            complement(166644..167744)
FT                   /locus_tag="Hbor_01880"
FT   CDS_pept        complement(166644..167744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65799"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR1"
FT                   /protein_id="ADQ65799.1"
FT                   /translation="MDGLDTKIQRLAKKHGADQVRQWADEGMTVDTMGKPRDMRAFRQR
FT                   QKERPAEVPKDIERRNAKSVQRSRGAHHEASKAGDANVPDSVRDVISSPGQQLDTSIQR
FT                   AMEDRMGDNLGDVRVHTGPSAAKACEDINARAFTVGNHIAFNHGEYDPSSAEGQHILAH
FT                   ELAHVRQQTGGAVSMLPQEGELEIDPDPRLEREAEETAQRVMQGGKIGVHRMEHSDVHV
FT                   QRMPGAETVLGGATALVASQMMIPKMLEEGEQLQEIRENWDDIDGHEVAYEGFKAQMAA
FT                   YANIIPGVKGVRAAKNNAQQQFKESNFQDRLAEANFPDSWKGQLAEMDPPETWLDEARR
FT                   VAQEVSDGTGSGDRPERVPSADEVSK"
FT   gene            168168..169271
FT                   /locus_tag="Hbor_01890"
FT   CDS_pept        168168..169271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01890"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65800"
FT                   /db_xref="GOA:E4NSR2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR2"
FT                   /protein_id="ADQ65800.1"
FT                   /translation="MSAQGPPDWLLTGIGLIVGFAAVLAVFGLDPVVLISVLALILLVA
FT                   TVLSAIEIVNAYEKRALTVFGEYRGLLEPGLNIIPPFVARTYTFDMRTQTLNVPPQEAI
FT                   TEDNSPVTADAVVYLRVKDAKKAFLEVDQYKTAVSYLSQTSLRAVIGDMELDETLSRRE
FT                   EINRRIHRELNEPTDEWGVEVESVEVSEVKPSADVQSAMEEQSSAERHRRAMILEAQGK
FT                   RRSAVERAQGDKQSNIIRAQGEKQSQILEAQGDAISTVLRAKSAESMGERAIVDRGLES
FT                   LQRIGESPSTTYVLPQELTSLLGRYGRRLTDASVQEAPGLESQDFDMETRELLGLDDVD
FT                   DIAEGVESLTNGDTNNTEIRLEETEEN"
FT   gene            169347..169538
FT                   /locus_tag="Hbor_01900"
FT   CDS_pept        169347..169538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65801"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR3"
FT                   /protein_id="ADQ65801.1"
FT                   /translation="MSHERGSTGPQGASVPRPTTAETGVIARLKRHLRTWPDRYVEMRI
FT                   GTVTARYMDSTATKRTAD"
FT   gene            complement(169816..170901)
FT                   /locus_tag="Hbor_01910"
FT   CDS_pept        complement(169816..170901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01910"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65802"
FT                   /db_xref="GOA:E4NSR4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR4"
FT                   /protein_id="ADQ65802.1"
FT                   /translation="MNIDSYSRLQKSFLRHQHLFVLIAPVVFVTAVLLWAPTDGAGGLD
FT                   HWLEYWWLFPVFLTGATIVNTVGISGSALFVPFLIFIFPQFAQPLSPTTIVKVGLISEA
FT                   FGLSSSAVAFVQYGLVDRRLALTLVGGSVPFVIAGALLSFIIPEMVFHSLLGLALLASA
FT                   YLLFRADLGHEGAGSSDDSEAVADGGSLNTDLPNDAGKLGPAGVRTDDNGTVTRVDREG
FT                   DDYTYTRGGYLRRFGNYSIGGLFQGLAGFGVGELGIISMLGTNVPVRVAIGTNHIVVAL
FT                   TAVLASLVHVFGGGLVGGHSLSLATTPWNMVVFTVPATVIGGQIAPYVSNALETDTIKN
FT                   FVGVLFTVISVALFLMAAGIA"
FT   gene            complement(171141..171257)
FT                   /locus_tag="Hbor_01920"
FT   CDS_pept        complement(171141..171257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65803"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR5"
FT                   /protein_id="ADQ65803.1"
FT                   /translation="MASHRRTISETDFDVGRVLEREIVRLAVNKQLSLLAWY"
FT   gene            complement(171229..173343)
FT                   /locus_tag="Hbor_01930"
FT   CDS_pept        complement(171229..173343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01930"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   UvrB/uvrC motif; Type III restriction enzyme, res subunit;
FT                   Ultra-violet resistance protein B; TIGRFAM: excinuclease
FT                   ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65804"
FT                   /db_xref="GOA:E4NSR6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR6"
FT                   /protein_id="ADQ65804.1"
FT                   /translation="MSDTSGSGGALTPDHPEVDRDFRVDAPFDPAGDQPEAIEQLARGF
FT                   EAGMEKQTLLGVTGSGKTNTVAWTVEEIQKPTLVIAHNKTLAAQLYEEFKNLFPDNAVE
FT                   YFVSYYDYYQPEAYIEQTDTYIDKDMSINEEIDRLRHSATRSLLTRDDVIVVASVSAIY
FT                   GLGDPANYTDMSLRLEVGDRMDRDDLLRRLVDLNYERNDVDFQQGTFRVRGDTVEVFPM
FT                   YGRYAVRIEFWGDEIDRMQKLDPLQGAVKSTEPAVLIHPAEHYSIPEDQLEQAISEIEE
FT                   LMEERVRYFERQGDLVAAQRIEERTTFDIEMLQETGYCSGIENYSVHMSNRESGDAPYT
FT                   LLDYFPDDFLTVIDESHQTLPQIRGQFAGDKARKDSLVENGFRLPTAYDNRPLTFEEFE
FT                   EKTDQTLYVSATPGDYEREHSEQIAEQIVRPTHLVDPKVELADATGQVDDLLDRIDTRI
FT                   ERDERTLVTTLTKRMAEDLTEYLEEAGVDVAYMHDETDTLERHELIRDLRLGHIDVLVG
FT                   INLLREGLDIPEVSLVAILDADQEGFLRSTTTLIQTMGRAARNVNGEVILYADETTDSM
FT                   EAAIEETQRRRAIQQAFNEEHGYEPTTIDKAVGETNLPGSETSATRSASEQPTDEDDAR
FT                   EQIEYLEDRMQEAADNLEFELAADIRDRIRDLRREFDLFDEEEGVEPEADPLDDGVPTD
FT                   DDGLAPPDDF"
FT   gene            173478..173747
FT                   /locus_tag="Hbor_01940"
FT   CDS_pept        173478..173747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65805"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR7"
FT                   /protein_id="ADQ65805.1"
FT                   /translation="MTRELLSAASEELSDAADTAEDELRERISDQADALAALAEADRGP
FT                   DHGRLARHMNALSEIAEQASEDIEERVESARDKVSEYREGVEGV"
FT   gene            complement(174142..174759)
FT                   /locus_tag="Hbor_01950"
FT   CDS_pept        complement(174142..174759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65806"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR8"
FT                   /protein_id="ADQ65806.1"
FT                   /translation="MNGDDLVDRIRDDHETAFSRLGSSKALYALTGGEMEADAVRAAAA
FT                   DDQHAAADVLEDWAMVEHGDAAVLLADLADEMRDHAESAEPDGYDRGDDPALYDRLAFE
FT                   DDTPGRIGGLLGRYLVVSEYAGQMVGFFVGDADPTTASEFRTLRSAIEDERDRVVETLA
FT                   EVCESDDDWDAAHEAADAVVEAAYDDYVETLERMGVKPKNVC"
FT   gene            174874..176319
FT                   /locus_tag="Hbor_01960"
FT   CDS_pept        174874..176319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01960"
FT                   /product="uncharacterized membrane protein"
FT                   /note="PFAM: Integral membrane protein DUF95"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65807"
FT                   /db_xref="GOA:E4NSR9"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSR9"
FT                   /protein_id="ADQ65807.1"
FT                   /translation="MLSERSASVLPVYLLTTGLFGIARIPIMLAGLAALALISIDGRLG
FT                   DLLTTLKDIDLSTIDSQSPPPEVTKAMESLISPEIVLLLLGGVLISLILAFVASVLARA
FT                   TVLNAIVGLLRDEDGVRAAIVGTRENWLSFLGVRFLLFGALAVVTVPIGILGLGLIAVA
FT                   GAVGVVGMVLGGLFSLLLVLIVLALFAFTEQAIVVDDVGTAGAIRQSVKFPFRRPGAFV
FT                   GYIAVALGVGVIGTVVLTAASFSEAPRVTALVGLVLLRPVLDGFKTALYAERDLSAHET
FT                   PSLGNRGWQAFGGGLRALGAFVRDHPLANAASAVIFGAGIVGGWATTAPYGPSLPVQGE
FT                   ISNVFGSLPVGTFVNLAVNNWLVAVDTAYSGVAVGVPSVVNLVFNGVLIGALGGVFDPT
FT                   AFTALVAPHGIIEVPALVLGGGLGLWLGGVGYRTARGQTDADGLAAALRRTYRVLLGLV
FT                   TLFVVAAFIEAFLTPAIASVIVG"
FT   gene            complement(176402..177262)
FT                   /locus_tag="Hbor_01970"
FT   CDS_pept        complement(176402..177262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01970"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65808"
FT                   /db_xref="GOA:E4NSS0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS0"
FT                   /protein_id="ADQ65808.1"
FT                   /translation="MSTDGYAKDVLVSPEWVEDHLDEFQSDDPAYRLVEVDVDTEAYDE
FT                   GHAPGAIGFNWETQLQDQTTRDILTKEEFEDLLGSHGISEDSTVVLYGDNSNWFAAYTY
FT                   WQFKYYGHDDVRLLNGGRDYWLENDFPLSEEAPDFDAVEYNAKGPFESIRAYRDDVQHA
FT                   VDEGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGAENISWAATVNADGTFKSAEE
FT                   LEELYADQGIDGNETTVAYCRIGERSSIAWFALHELLGYDEVVNYDGSWTEWGNLVGAP
FT                   IEKGN"
FT   gene            177538..178323
FT                   /locus_tag="Hbor_01980"
FT   CDS_pept        177538..178323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01980"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /note="PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65809"
FT                   /db_xref="GOA:E4NSS1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS1"
FT                   /protein_id="ADQ65809.1"
FT                   /translation="MYETVVVSPDWVESRRDEIRLVDVRDAWEFDGIGHVPGAVNIPFD
FT                   EFRSADGDEGMLPGADVWESLLSAAGIGPDDHLVAYDDTHGVFAARFLVTAELYGHPTE
FT                   RLHLLDGDYSAWNRDRETTSAATDATETTYEIRDPEHSPLVEYEFVLDSLDDEAAVVVD
FT                   TREAWEFEEGHLPGAVNLDWRELVDDETRGLKPADELEAILDEVGITPDRRVVLYCNTA
FT                   RRISHTYVVLRSLGYENIAFYEGSLTEWEERGGPIETAE"
FT   gene            complement(178330..179331)
FT                   /locus_tag="Hbor_01990"
FT   CDS_pept        complement(178330..179331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_01990"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65810"
FT                   /db_xref="GOA:E4NSS2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS2"
FT                   /protein_id="ADQ65810.1"
FT                   /translation="MTLERRYVFGSLFVLAGVAAAFLLRSVLGTVFFSVTVAYLLWPVR
FT                   QAVVRRGWSPRAASGLATAGAFLAVLAGLTPLAIVVYLRFDSLTTLVGLLPSNLSFELF
FT                   GMTYALTLAEVTTFTVAYLRQLATVVAAATPVLLVKVTLFVFLVYSLLYHGEDAQQAAL
FT                   AVVPSSYQSAARALNSRARDTLFAIYVLQAATAAGTFVLAVPVFFFLGYDAVVTLATVA
FT                   AVLQFVPIVGPTLLLLGLAAYQLALGHTVQALLVVTVGGALVAWLPDVLIRPPLAKQTA
FT                   DIPGSLYFVGFFGGTLTLGAVGIVAGPLVVGLFVEAASLLTTELHAVPVEDD"
FT   sig_peptide     complement(179269..179331)
FT                   /locus_tag="Hbor_01990"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            179419..180585
FT                   /locus_tag="Hbor_02000"
FT   CDS_pept        179419..180585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02000"
FT                   /product="ABC transporter periplasmic binding protein, thiB
FT                   subfamily"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: ABC transporter periplasmic binding
FT                   protein, thiB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65811"
FT                   /db_xref="GOA:E4NSS3"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS3"
FT                   /protein_id="ADQ65811.1"
FT                   /translation="MTKWDYSVMRRRSFLTAAGASGVAALAGCVGNGDGTETDSGATET
FT                   ETATETTTGTTTGTAAEEPPELVVGTYSSFVDAPSTSPGPWLKETFESEFDATIRYETP
FT                   DNEVNHYIERASRGVDIAADLYVGLDVNMLIRIDENLDSPMFTSVDDLSNRGDVKESLE
FT                   FDPDGRAVPYDTGYICLVFNKLFGDSEFTAPETFDGLLKEQYADDLLVQNPVSSATGKA
FT                   FLLHSIKAKGRDSYLDFWQKLKENGVRVLKDWGTSYDAYSKGEAPMVVSYSTDQVYAHE
FT                   SGEDLAKHQLRFLNDQGYANPEGMALFEGTDQPELARTFMDFMLRPEIQAEIAVRNVQY
FT                   PATTTAELPESFGKYAQAPPEAVTFNYDTLRDNLSDWTNAWERQFIGN"
FT   sig_peptide     179419..179514
FT                   /locus_tag="Hbor_02000"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            180641..182353
FT                   /locus_tag="Hbor_02010"
FT   CDS_pept        180641..182353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02010"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65812"
FT                   /db_xref="GOA:E4NSS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS4"
FT                   /protein_id="ADQ65812.1"
FT                   /translation="MNVTALARWTERRALGVVAAVTAAILIVLFYYPVATVFVDAVYVS
FT                   EAWTLTPLVDVLTSPFFQGRFRFTAYQALLSTVASVALGLPGAWVLSRFEFPGRETLRS
FT                   LTILPFVMPSIMVAIGFVATFGQNGTLNDVLTALGLPKVTLLYSLPAILVAHAFYNAPL
FT                   ITRVTTAAWESVDASAVETARTLGASPYRAFFDVVVPQLLPAVAVGATLTFIFTFASFP
FT                   IVLALGGTQLATVEVLIYSGVQNLDFAEAASLAVVETVLSLGLTYAYLRYEASRESSGR
FT                   GARPQRRRSILPSSLSVSELATTLALVIYGIVTLIVFVAPIASMLLASVTGPEGGFTLD
FT                   HYRFLIERQQTGATYQVLPLTAIRNSLVFGLGTLALALPMGVVMSVLTTRDFRGRKIID
FT                   ALSMAPLTVSGIVVGLGLLRGLVFGVEVFGTRVQVTGALAIVAAHAVGAYPFVTRNVAP
FT                   LLGGLDPQLVESARTLGASRVRALLDIELPLVAAGVVAGAAFAFAISIGEFDSTVILAE
FT                   GSASYTMPVAVQRYLGRRLGPATAMGCVLLLVTSLSFVVIERFGGRTGGRGGF"
FT   gene            complement(182484..183164)
FT                   /locus_tag="Hbor_02020"
FT   CDS_pept        complement(182484..183164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02020"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65813"
FT                   /db_xref="GOA:E4NSS5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS5"
FT                   /protein_id="ADQ65813.1"
FT                   /translation="MSVRDEFDAWAADGRDKGMEDRHWHTAKHVLARMPVEPDDVVLDL
FT                   GCGSGYAGRALRETKEAGRVYGLDGSPEMARNAQSYTDDEKIGYLVGDFDELPFADDSI
FT                   DHVFSMEAFYYAADPHHTLSEVARVLRPGGTFFCAVNYYEENVHSHEWQENISVEMTRW
FT                   TGEEYREAFREAGLFVAEQDNIPDRETEIPDEDEFPTDNWETREAMVERYRTFGTLLTV
FT                   GVSH"
FT   gene            183260..183718
FT                   /locus_tag="Hbor_02030"
FT   CDS_pept        183260..183718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02030"
FT                   /product="Putative integral membrane protein (DUF2391)"
FT                   /note="PFAM: Putative integral membrane protein (DUF2391)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65814"
FT                   /db_xref="GOA:E4NSS6"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS6"
FT                   /protein_id="ADQ65814.1"
FT                   /translation="MVGVRRRFALSDTAQQIVGGFLLAGPFVVTEEVWSLAASMSAVQG
FT                   VFTVVIVLTVGYGALYKADDRDPDRERDLLGVPVRFVSLILVAYLSVLILALAFDAPGT
FT                   FLSDMTGNGAFTVFGLSLQLDVLEVTLKATSIGAVFSVIGAATADSVF"
FT   gene            183831..184409
FT                   /locus_tag="Hbor_02040"
FT   CDS_pept        183831..184409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65815"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS7"
FT                   /protein_id="ADQ65815.1"
FT                   /translation="MDYTLAIENTPDTIPGGTGILLLHPSIGETDRIDTDFLKTDTDHF
FT                   LVVSTRTTAREVEQKLEHYDVDESRAVILDTLSVDRGYSRRGSNHVHYVSAPDDLDGIV
FT                   EQVRNFLESHDGKLRVSVDSVTELAYYADVDRAYEATKRLLDLLDEHDAVGLFHLSNEV
FT                   HEEPTLERFRELFEGVVELDVGGNVSSEF"
FT   gene            complement(184513..185334)
FT                   /locus_tag="Hbor_02050"
FT   CDS_pept        complement(184513..185334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65816"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS8"
FT                   /protein_id="ADQ65816.1"
FT                   /translation="MFESRDLADDVAAVRDEHAPDSLVLSAAADFETIPPAAAEDLGLL
FT                   VDSLDPATYPSEWLPEDAPALLTRYAGSDFTIGMPGDGTVVWTRQTAPPSVIAKKRAEG
FT                   TPTDFLDFLFAEAFVQLGTDAPEHFLPFFGEQYRELDAAVPLSPNEVYQIAAALYDAWV
FT                   GLQTRDVFASWEDQHPRLYDAWWDAGQRLTGRLDTLPRAVARGQTSFAEATEYACSAVK
FT                   HGLDLPAPFVALDTEAYLEYGSSYGVRWARKTFEQLEDDSSERTDAVEDEG"
FT   gene            complement(185469..185558)
FT                   /locus_tag="Hbor_02060"
FT   CDS_pept        complement(185469..185558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65817"
FT                   /db_xref="GOA:E4NSS9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSS9"
FT                   /protein_id="ADQ65817.1"
FT                   /translation="MSQATKIVIGTVGVAAFLAIALLAVLAFG"
FT   sig_peptide     complement(185496..185558)
FT                   /locus_tag="Hbor_02060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(185718..187187)
FT                   /locus_tag="Hbor_02070"
FT   CDS_pept        complement(185718..187187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02070"
FT                   /product="putative efflux protein, MATE family"
FT                   /note="PFAM: MatE; TIGRFAM: putative efflux protein, MATE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65818"
FT                   /db_xref="GOA:E4NST0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST0"
FT                   /protein_id="ADQ65818.1"
FT                   /translation="MAPSLQRRAHDALMQFPALLARLGLVDREKGSRAFDLAVPVMVTG
FT                   GMRTLLRIADFLMVSIALGNAAVAGLELGFQYYFIPFGLALALTSGTISVVSRFVGAND
FT                   YDAADFAVKQSLWLALLISVPISIAGWMYARPLIALLTNDLQTIKLGSAYLRIVMLSVA
FT                   FRFWSMIAARALAGVGDTRTPMYVRLLTLPTNIILNAVLIFGLFGAPALGVEGAAWGTV
FT                   AANTLAAVIFFVLLASGRWDVRLRFGGKQWDWDVVSEIVRVGLPLAGTRLSRTFGRFPF
FT                   LFVLGLLGTNVVAAYAIGRRVMLLALMPAWGYSTAASTLVGQAIGGGDDGEATEYGWQT
FT                   LRIALVTQLLIAAAIFVAATPIAQVFGASDIPLTARFIRVFGLGVAGFSVSRTMRGALR
FT                   GAGDTRWPLYGGLVGTYLVRLPIAFLAPGAGFTIAVLGITISPGLDWGLWAVYAAILAD
FT                   MYVRGVINVARYYSGKWIHVAHESNVGSAAD"
FT   gene            complement(187531..188643)
FT                   /locus_tag="Hbor_02080"
FT   CDS_pept        complement(187531..188643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02080"
FT                   /product="Zn-ribbon containing protein (DUF2072)"
FT                   /note="PFAM: Zn-ribbon containing protein (DUF2072)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65819"
FT                   /db_xref="InterPro:IPR018645"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST1"
FT                   /protein_id="ADQ65819.1"
FT                   /translation="MPHQCTNCGKVFADGSKEMLSGCPNCGGNKFQFSPSGSDSDDAAE
FT                   TTTRQQTSSSGTTPSSGSAADATTDREPNTNRESASDDTAGSTTWQRAASRAADVEERR
FT                   SANQTPSGSADDGGRSDTRSHKTQNRSADQTNDNIDSARRSEKTLREWANSRGFASEVE
FT                   DANDETTLRENRRRTGDAQRRPSERRSSSSARQSSPSDRQSSDDAQSDSSVPTDSSSAS
FT                   PETTASKETKTPTGTPAPSDEPAPSSKQAKSSAADPSVFGDDVEDDAQASARSDVVSPD
FT                   EIAAAQPDDRPSDADGRVIEPESDDRPDLDELREELNDQFESIKIVAPGEYELNLMELY
FT                   DRPEYIISLREDGRYVIEVPDTWDSHDDDR"
FT   sig_peptide     complement(188605..188643)
FT                   /locus_tag="Hbor_02080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(188773..189162)
FT                   /locus_tag="Hbor_02090"
FT   CDS_pept        complement(188773..189162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02090"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein conserved in archaea
FT                   (DUF2073)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65820"
FT                   /db_xref="InterPro:IPR012017"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST2"
FT                   /protein_id="ADQ65820.1"
FT                   /translation="MSTVPEVTTGDNGVQIDLISAARMDGLASMEKIRLILDGVRDGNI
FT                   VILEEGLSPDEESKLIEVTMTEISPDEFNGIEIESYPQSKGGQGFLGRLMGKEETKKLT
FT                   VIGPANQIQTLHKDENLISALVSRK"
FT   gene            complement(189159..189800)
FT                   /locus_tag="Hbor_02100"
FT   CDS_pept        complement(189159..189800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02100"
FT                   /product="small GTP-binding protein domain"
FT                   /note="PFAM: GTPase of unknown function; TIGRFAM: small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65821"
FT                   /db_xref="GOA:E4NST3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST3"
FT                   /protein_id="ADQ65821.1"
FT                   /translation="MGLLTELRDSISRVVDRMFSDAEPRRIGIYGPPNAGKTTLANRIA
FT                   RDWTGDAVGPESHIPHETRRARRKENVEIERNGKKVTIDIVDTPGVTTKVDYKEFLDHD
FT                   MEKDDAVRRSREATEGVAEAMHWLREDVDGVVYVLDSTEDPFTQVNTMLIGIIESQDLP
FT                   VLIFANKTDLEESNVQRISNAFPQHETVPLSALEGNNMDEVYDKIAEYFG"
FT   gene            191038..192768
FT                   /locus_tag="Hbor_02110"
FT   CDS_pept        191038..192768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02110"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); CDC6, C terminal; TIGRFAM: orc1/cdc6
FT                   family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65822"
FT                   /db_xref="GOA:E4NST4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST4"
FT                   /protein_id="ADQ65822.1"
FT                   /translation="MDDDTPKRDDGTRQINHSDTDDVASTEDDSSSAASGGNTTSGEPV
FT                   SGDAKSEEALDGEGSPTDENPATDDDEPVTAEDIDIRESIGPSGSTDGETDDDSSTDVS
FT                   LDEVVLDDGGSDSRGLFDDLLSGEPIFENKEVLRPSYTPHELPHRTEQINQMATILVSA
FT                   LRGETPSNILIYGKTGTGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLA
FT                   QLANKFIEKNFDVIENELDRLEDLRTRARDTPDLLADTSFDSLDGVEERIEQLETDCEE
FT                   METVPMTGWPTDRVYSTFFDAVDYNERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELS
FT                   NSRISIMGISNDLKFTDFLDPRVKSSLGEEEIVFPPYDANQLRDILQHRADVAFKSGAL
FT                   TEDVIPLCAAFAAQEHGDARRALDLLRTAGELAERGQADTVEEAHVRQAQDKIELDRVV
FT                   EVVRTLPTQSKIVLFAIILLEKNGVRNINTGEVFNIYKRLCEEIDADILTQRRVTDLIS
FT                   ELDMLGIVNAVVVSKGRYGRTKEISLSVPIDETEAVLLSDSRLGDIENAQPFVQARFDN
FT                   "
FT   gene            complement(192901..193689)
FT                   /locus_tag="Hbor_02120"
FT   CDS_pept        complement(192901..193689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02120"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: signal peptidase I, archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65823"
FT                   /db_xref="GOA:E4NST5"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST5"
FT                   /protein_id="ADQ65823.1"
FT                   /translation="MNDDQGERDTTDDAPRPEPNAVSVKSSDTFLHRFLNAEDGILLFV
FT                   RETLVSVSAVVAIGLLLFAISGVWPPMVAVESGSMEPHMYRGDLIFITAPDRFTPDYAY
FT                   GDTGIVTVDIGSEKGFSSFNGPGSVIVYDPPSRAGSPIIHRARFYVEAEENWYDKANPN
FT                   YINADSCAELRNCPAPHAGFITKGDANGRYDQASGIAEPVKTEWIDGVAHVRIPYLGYV
FT                   RLELAGMFAPMPVSAHVDSVNAQTDTAPGFESTNQTVSVV"
FT   gene            193787..195418
FT                   /locus_tag="Hbor_02130"
FT   CDS_pept        193787..195418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02130"
FT                   /product="DNA polymerase II small subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase alpha/epsilon subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65824"
FT                   /db_xref="GOA:E4NST6"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST6"
FT                   /protein_id="ADQ65824.1"
FT                   /translation="MPLETPTRIVRELARHGYNAEREAVTLIAGAADPETTLARAIEHA
FT                   GADAFRVTAADVRAVLDSGPNATDAPISASSTAATPSDTTTTDADALSESESASTDRSL
FT                   DPSSSTGETKAETTTSGQSSPPETGGSNSSSGRQSDPSLRSLSITNDMTGQSTGTGEYG
FT                   DFVKVFKDRYEKLSRQLRGRVNHRPAEAIQSMPGGSDAAMVGLVNDIRSTASGHWLIEL
FT                   EDTTGTFPCLVMKDRKFASAVDELLMDECIAVEGTLADDSGIMFVDSMHWPDVPRTHKP
FT                   NTADRHVQAALISDVHVGSQEFMAGAWHRFADWLHTDAAEHVEYILIAGDMVEGVGVYP
FT                   NQDEELDIVDIYDQYEQFSEYLKEVPGDIEIVMIPGNHDAVRLAEPQPGFDEELRDIMS
FT                   VHDARITSNPSTVTVEGVNVLMYHGVSLDEVIAELPSESASYDEPHKAMYQLLKKRHVA
FT                   PQYGGHTRLAPEEQDYLVMKEVPDIFHTGHVHKLGWGKYHNVLAVNSGCWQAQTDFQKS
FT                   VNIDPDAGYAPIVDLDTLDMTVRKFS"
FT   gene            complement(195468..195899)
FT                   /locus_tag="Hbor_02140"
FT   CDS_pept        complement(195468..195899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65825"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST7"
FT                   /protein_id="ADQ65825.1"
FT                   /translation="MDAEVRDALETDAESLAAIADVPTDVMRNVVHDRTVRVAERHRDA
FT                   TDPNADADAAEAELLGFVAFDVRDATVHVTQVGGSVEAVEHLLSEPVRFASNEQLDVEF
FT                   LALSSDTDLHEAAERAGFERVGPGPAFMNEETVRFQIDP"
FT   gene            196119..197297
FT                   /locus_tag="Hbor_02150"
FT   CDS_pept        196119..197297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02150"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="PFAM: ACT domain; Amino acid kinase family; TIGRFAM:
FT                   aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65826"
FT                   /db_xref="GOA:E4NST8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST8"
FT                   /protein_id="ADQ65826.1"
FT                   /translation="MRVVAKFGGTSLGSGDRINRAADSIAAAVEKGHEIAVVASAMGNT
FT                   TDDLLDEIRFDADDRDRAEIVSMGERTSVRMLKAALAARGVNALFVEPGADQWPVIAND
FT                   LGEVDVEETKHRAADLAADLDNVVPVITGFLAENHDGEITTLGRGGSDTTAVMLGRYMD
FT                   ADEVVIVTDVEGVMTGDPHVVEGARNVGRITVDELRNLSFRGAEVVAPSALSYKDDNLA
FT                   VRVVHYQHGNLLTGGTLIEGEFQNLIDMQEDPLACVTVAGRSIRNRPGILADLSQALRE
FT                   KGVNVDAVASGMDSITFYVGEDRAEEAENLLHSKVVDDQSLSSVTVDDDVAVIRVTGGE
FT                   LPNRPGVILDIVQPISEAGINIHDVITSATSVAIFVAWDDREETLKIVQNEF"
FT   gene            complement(197330..197833)
FT                   /locus_tag="Hbor_02160"
FT   CDS_pept        complement(197330..197833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02160"
FT                   /product="acyl-CoA hydrolase"
FT                   /note="PFAM: Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65827"
FT                   /db_xref="GOA:E4NST9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E4NST9"
FT                   /protein_id="ADQ65827.1"
FT                   /translation="MATQRTDGETVSLQQSFTEMSEILMPNDTNNLGRALGGTVLHWMD
FT                   ICGAISARRFSKRQVVTASMDHVDFKAPIELGDVVTVTGYVFDTGRTSMDVHVDVCAER
FT                   PSEGEKRETASSFFSFVALDENETPAPVPSLRCPSESQTKLRDRALERRNQRRMELAVE
FT                   IEES"
FT   gene            198022..199395
FT                   /locus_tag="Hbor_02170"
FT   CDS_pept        198022..199395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02170"
FT                   /product="tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="PFAM: Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65828"
FT                   /db_xref="GOA:E4NSU0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU0"
FT                   /protein_id="ADQ65828.1"
FT                   /translation="MFCRMRSYKAKMVEPITLPSREEREAALDAAGYNAFNLDAEDVFI
FT                   DLLTDSGTGTMSADQWAALMRGDEAYAGSRSFSELRDAVRDVMGFEYVVPTHQGRGAEN
FT                   VVYGVLVEEGDVVPNNAHFDTTRAHVANQGADPVDCPHELAHDADADHPFKGNFDIDAG
FT                   WELVEEVGEDSIPVVVQTITNNSVAGQPVSVENTREVAAFADEIDATFVIDACRFAENA
FT                   YFVQQREAEFSDASVAEIAREQLSYADAVTMSGKKDAIVNIGGFAAMNDPELFELAKQR
FT                   GILYEGFPTYGGLAGRDVAAMAVGLREAVEPPYVGERVEQVAELGRLLTDAGIPVYEPT
FT                   GGHAVYIDAEAVLPHVPKDQFPGQELVCALYLEGGVRGVELGGFAFPGTDRPDLVRLAL
FT                   PRRTYSREHLEHVAETAAAVKESAASYGGLEIVEEPPMRELRHFSARLEPTEAPSSAD"
FT   gene            complement(199416..200495)
FT                   /locus_tag="Hbor_02180"
FT   CDS_pept        complement(199416..200495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02180"
FT                   /product="Protein of unknown function (DUF2891)"
FT                   /note="PFAM: Protein of unknown function (DUF2891)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65829"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU1"
FT                   /protein_id="ADQ65829.1"
FT                   /translation="MDFETVDTDTLLSGRSEWLDPELAETFSQHPLDAIETEYPHYVRS
FT                   VDSPDGVERPKNNHPVFYGCYDWHSAVHSHWALLRQLRVFESHPAESEIKQRIDARFTP
FT                   ENIEREIEYFEANRTFERPYGWAWLLHLASELTLWDDDHADEWKSIIEPLEREIIALIE
FT                   SEFLSQEQPLRVGTHENSAFALHCILDYARTTSNESLESAVVETAIEFFAQDRNYPVEY
FT                   EPLGWDFLSPTLTEADLMRRVYDEDEFRTWIDGFLPDITTKPYDTLLEPVHAETDPDEE
FT                   VAIHLVGLNLSKAWSLAGLATTLDGHRYAEAFERSAKKHAERGLSQAFTDNYAGSHWLS
FT                   SFALYLLTRNEGGIAPNAS"
FT   gene            complement(200577..201236)
FT                   /locus_tag="Hbor_02190"
FT   CDS_pept        complement(200577..201236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02190"
FT                   /product="predicted phosphoesterase"
FT                   /note="PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65830"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU2"
FT                   /protein_id="ADQ65830.1"
FT                   /translation="MRVAVISDVHANRVALDAVLDDMPDVDSILCAGDVVGYNPWPAEC
FT                   VAELRARDVPTVMGNHDRAVASDTTFRFNAMAAAGVKHAREKLDDDAMTWLSDLPDERT
FT                   EFDGRVRLTHDHPRIQDKYTYPDEFEADFLDGEDVLVLGHTHVQGHRVFDEGIVMNPGS
FT                   VGQPRDGDPRAAYAILDLDDLTVDERRVDYDIEAVVDAVTEAGLPERIGRRLYDGK"
FT   gene            complement(201290..201868)
FT                   /locus_tag="Hbor_02200"
FT   CDS_pept        complement(201290..201868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02200"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="PFAM: IMP cyclohydrolase-like protein; TIGRFAM: IMP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65831"
FT                   /db_xref="GOA:E4NSU3"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU3"
FT                   /protein_id="ADQ65831.1"
FT                   /translation="MYVGRFIVIGPDFGAYRVSSRSFPNRQVVERDGTLTVAPTPDAPE
FT                   TDNPYISYNCVREGGDSVVVGNGSHVDPIAEKLDLGYPARDALAESLLAMDYEKDDYDT
FT                   PRIAGVVGEESYIGIVRRDALLVRPVTENPMLVATYEEDDPAVVVFDGDGSPAELAERA
FT                   YEMDYEHAVCAAGVTYDDGDVDVGFYNDE"
FT   gene            202002..202074
FT                   /locus_tag="Hbor_02210"
FT   tRNA            202002..202074
FT                   /locus_tag="Hbor_02210"
FT                   /product="tRNA-Gln"
FT   gene            complement(202371..202859)
FT                   /locus_tag="Hbor_02220"
FT   CDS_pept        complement(202371..202859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02220"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Kinase binding protein CGI-121"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65832"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR016799"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU4"
FT                   /protein_id="ADQ65832.1"
FT                   /translation="MKFIEGVATVEDVNAFVTDVGAIADETGATVQVFDARYVVSEKHL
FT                   RRAVELADRAIERGENVARDRAVEMLLYAAGRRQIDDALAMGVSEGETPVVALVDGGDE
FT                   AKAAAQLRDLFTERQTLGRYDDERVRDFFDVTDAELAAVDGDLESLVCERVALLNVEK"
FT   gene            complement(202856..205381)
FT                   /locus_tag="Hbor_02230"
FT   CDS_pept        complement(202856..205381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02230"
FT                   /product="superfamily II helicase"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65833"
FT                   /db_xref="GOA:E4NSU5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU5"
FT                   /protein_id="ADQ65833.1"
FT                   /translation="MKPEDVPGLPEGVPEQLQSEGIEELYPPQADAVEAGVTEGESVLA
FT                   SIPTASGKTFIAELAMLSSVQRGGKALYIVPLRALASEKKAEFERWEEFGIDVGVSTGN
FT                   YDSSGEWLASRDIIVATSEKVDSLIRNNAPWVEDLSCVVSDEVHLVNDGHRGPTLEVTL
FT                   GKLRKINPGLQVVALSATVGNADDVAAWLDATLVESEWRPIDLKMGVHYGNAISFDDGT
FT                   QREVPVGKGDRKTAALVADTLEEDGSSLVFVNSRRNAEAAAKRLKDVTSRALTDEERSK
FT                   LAELAQEIRDVSDAETSDTLANCVAKGAAFHHAGLAAEHRSLVEDAFRDRLVKTVSATP
FT                   TLAAGVNTPSRRVIVRDWRRYDGEFGGMKPLDVLEVHQMMGRAGRPGLDPYGEAVLLAK
FT                   DSDTRDELFERYIWADAEPVRSKLAAEPALRTHLLATIASGFAHTREGLLDFLDQTLYA
FT                   TQTDEPGRLEQVTDNVLQYLEANGFIEREDEQLTATGIGHTVSRLYLDPMSAAEIIDGL
FT                   RWGADHREEKLRALEGIAPEPETANTSRETEEAAEASGFQRASEMVDADGGVGDKDGED
FT                   MEPIETDRTYPTALGLFHLVSRTPDMYQLYLKSGDRETYTEECYEREPELLGKTPSEYE
FT                   DVRFEEWLSALKTARLLEDWASEVDEDRITERYGVGPGDIRGKVETAQWLLGAAERLAG
FT                   ELDLSATVAVREAKKRVEYGVRDELLNLAGVRGVGRKRARRLFEAGIETRNDLREADKS
FT                   VVLAALRGRRKTAENVLEAAGRRDPSMDDVQEASADAMPEATFERASRRSGGESDRGGG
FT                   GGSGDGNDGEKNGDGADDPQEQASLGDFG"
FT   gene            205506..205748
FT                   /locus_tag="Hbor_02240"
FT   CDS_pept        205506..205748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02240"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65834"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU6"
FT                   /protein_id="ADQ65834.1"
FT                   /translation="MKIRYDRDTCIGMFQCVDEWDTFEKNLDAGKADLAGAEEVEEDIF
FT                   ELEVPEDEEFEAEFAARVCPVDAIELYDDDGEQVV"
FT   gene            205884..206054
FT                   /locus_tag="Hbor_02250"
FT   CDS_pept        205884..206054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65835"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU7"
FT                   /protein_id="ADQ65835.1"
FT                   /translation="MYSREYFSPETMTRKTHGHRLMEWADLVGASVPDSVADDGDEPTL
FT                   PAWDDADVERR"
FT   gene            206141..208672
FT                   /locus_tag="Hbor_02260"
FT   CDS_pept        206141..208672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02260"
FT                   /product="ERCC4-like helicase"
FT                   /note="PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65836"
FT                   /db_xref="GOA:E4NSU8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU8"
FT                   /protein_id="ADQ65836.1"
FT                   /translation="MAAADDPAHVDHPLLSPSFIERRLYQIRLASAARDAHTLVCLPTG
FT                   LGKTTVSLLVTAERLHEVGGKALFLAPTKPLVQQHADFYREALEIPDDEIVVFTGDVRP
FT                   DDRAALWDDARIVIATPQVVENDLIGNRISLREVTHLTFDECHRGTGDYAYVYIAERYH
FT                   ADAERPLVTGMSASPGGDKESILEVCENLGLVEVEVMTEEDADVDEYTYDTDVEWERIQ
FT                   LPDEILAIRDAVNEVIKDRLEKLKSLGVTNTTSPDVSQKQLNGMRAELQKLMNNDQSEG
FT                   YKGMSTHAEVMKLRRAVELVETQSVESVRRYFERQRNAARSSGASKASQRLVAEPKVRE
FT                   AMRKAESFDGLHPKFSQTRILLAQTLGIQDGERVIVFTESRDTAEALTDFLSESFDARR
FT                   FVGQGDKEGSDGMTQKEQQETLDEFRNGEFEVLVSTSVAEEGLDVPEVDLVLFFEPVPT
FT                   AIRSIQRKGRTGRQAEGRVIVLMAENTRDEAYFWISRRREKEMKSELRDLKGVADEVEE
FT                   ELDDSQKGLDAFSGGDSAGTDDGESSGAIANGGTAAATTETPDASTAEADSGTDGGTAS
FT                   GTDATDTNSNDDQAGLDSFSASDEEIARADEESEAAVEDGDGTVATAGRDDEVVEIVVD
FT                   QRELDSNIAKDLSTRDGIETRLETLAVGDYVLSDRVAVERKSVSDFLDTLTGGDRSLFE
FT                   QIGDLSRAYARPILILEGEGLFEERNIHPGAIRGALASLAVDFDVSVLQTRDEDDTAEL
FT                   LLTIATREQTERERSVSVHGGKSTKTLSEQQEYVVSAIADIGPVTARSLLEEFGTVEAV
FT                   MTAREEDLLEVSGIGSVTAERIRDVIGSEYE"
FT   gene            208776..208991
FT                   /locus_tag="Hbor_02270"
FT   CDS_pept        208776..208991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65837"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSU9"
FT                   /protein_id="ADQ65837.1"
FT                   /translation="MSTDSPNDGAARTFYGDPQHETGSYSDPERLGLAAPSRQSESERA
FT                   LYGYAHRASADRRRSAGVRSADVQAT"
FT   gene            complement(209054..209443)
FT                   /locus_tag="Hbor_02280"
FT   CDS_pept        complement(209054..209443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02280"
FT                   /product="universal stress protein UspA-like protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65838"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV0"
FT                   /protein_id="ADQ65838.1"
FT                   /translation="MKILAPIDGSECSIRAAEFAVEFAVRFEADLHVVHFSDAETDATD
FT                   IVLGRARDIIEGTDLSTEPELSIIELDVVPGKQVGEEILNLVDERDFDHVVMGHHGDGA
FT                   IERAILGSAAETVVRHESVAATIIP"
FT   gene            complement(209485..210156)
FT                   /locus_tag="Hbor_02290"
FT   CDS_pept        complement(209485..210156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02290"
FT                   /product="uncharacterized Zn-finger containing protein"
FT                   /note="PFAM: Sjogren's syndrome/scleroderma autoantigen 1
FT                   (Autoantigen p27)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65839"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV1"
FT                   /protein_id="ADQ65839.1"
FT                   /translation="MSDFDKEAERQRLREKYEKDTERRQETQRMSELLLQGATMSNKHC
FT                   NECGTPIFRYQGAEFCPTCQDKQAKADAEQGEAANVANGQGVDGTTQAAETGEQADSES
FT                   PAPEHAADASQSGNETAEAVTTPDATGVSKPASPQRTPQSDSEMQTDSTETRRAATTSS
FT                   SGVSDASSASGASAQTARESLLEAITQHSRRATEIDEPRRAKQHLEAAREAAEALDALD
FT                   R"
FT   gene            210323..211237
FT                   /locus_tag="Hbor_02300"
FT   CDS_pept        210323..211237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02300"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: lactate/malate dehydrogenase, alpha/beta
FT                   C-terminal domain; lactate/malate dehydrogenase, NAD
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65840"
FT                   /db_xref="GOA:E4NSV2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV2"
FT                   /protein_id="ADQ65840.1"
FT                   /translation="MTKVSVVGAAGTVGAAAGYNLALRDIVDELVFVDIPDMEDKTVGQ
FT                   AADTNHGVAYDSNTEVYQGGYEDTAGSDVVVITAGIPRKEGQTRIDLAGDNAPIMEDIG
FT                   SSLAEHNDDFISVTTSNPVDLLNRHLYEAGDRDRHKVIGFGGRLDSARFRYVLSQRFDV
FT                   PVKNVEATILGEHGDAQVPVFSKVRVDGTDPEFTADEREEILSDLQESAMDVISRKGAT
FT                   QWGPATGVAHMVEAIVRDTGEVLPGSLVLDGEYGYEDTAFGVPVKLGSDGIEEVVEWDL
FT                   DDYEQDLMDDAAEKLRDQYDKIA"
FT   sig_peptide     210323..210376
FT                   /locus_tag="Hbor_02300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            211318..212265
FT                   /locus_tag="Hbor_02310"
FT   CDS_pept        211318..212265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02310"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65841"
FT                   /db_xref="GOA:E4NSV3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV3"
FT                   /protein_id="ADQ65841.1"
FT                   /translation="MATESATPTHLDTGSQTVETRRVGVFLVVAFGVAWATAAAIYATG
FT                   GLTDSPILVPQLGLTLSAILLPTAYMFAPTVGNLVARLATGEGLSNLRLRPRVSGSLRV
FT                   YAAAWFVPAVLTLLGAALYFAVFPEQFDPSLSAYAAALQAAGGTVPMDPWTLVAIQAAL
FT                   ALTVAPLFNAIFAFGEEFGWRAYLLPKLHPLGARKAALLVGVVWGVWHWPILAMGYNYG
FT                   FGYTGAPWTGFLAMCVFTVATGVFLAWVTLRTDSVWPAAIGHGAINAIAGLGTLFVVGQ
FT                   PNTLFGPTPVGVIAALPWVVLAAWLLLRSDSFAA"
FT   gene            complement(212273..213547)
FT                   /locus_tag="Hbor_02320"
FT   CDS_pept        complement(212273..213547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02320"
FT                   /product="protein exported by TAT pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65842"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV4"
FT                   /protein_id="ADQ65842.1"
FT                   /translation="MNGPSLSRRSLLRGGVAAAGITALAGCTASGASALPFPGTAVYHD
FT                   VAHVREEHRDDAVEHLRALLQRATPVVQSAQEANVFDSERIVSGPDYLEDAREFLDGRT
FT                   PPTFDTLQQVRYYVRFVAETFGAAVAGLDDVHLDDSRANVGPAPEIDEVREAVQYTGDD
FT                   PVETIAWIELAERWLHTSMIAGKNAKLDREELAELDASVRKNAIMHAVRNHERSVRFLS
FT                   DARQFYRTFRAEQDDPTPIGLQSARATYRKQTAEFSHDYEWYDSHRIDVESESPPPRST
FT                   GLNRLMTLRPGEDSLDDADWARSDSLPGLETIRLAEAVASFHGFETGKAAVEQLSGKSS
FT                   VSGGLLFDTKRRAVQSAYELSTTGNLFEKCLLNRAALYVSKGDSFVNREAGVADHSPKA
FT                   HALACYGVAVGIVEVIPSVASVLTG"
FT   sig_peptide     complement(213446..213547)
FT                   /locus_tag="Hbor_02320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            213805..214167
FT                   /locus_tag="Hbor_02330"
FT   CDS_pept        213805..214167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65843"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV5"
FT                   /protein_id="ADQ65843.1"
FT                   /translation="MSADVYRYGIVDGVAVFDLTEFEISGDTLLEEFFGTVQNVFVRPD
FT                   VTASVFVLGDEGGISKRFFQRFDFLVSRIEGYEIGRVALVGPSAKQVALRGRFRGSDVI
FT                   VETPETPQEAMDWARA"
FT   gene            complement(214221..215528)
FT                   /locus_tag="Hbor_02340"
FT   CDS_pept        complement(214221..215528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65844"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV6"
FT                   /protein_id="ADQ65844.1"
FT                   /translation="MKRRHNLLLVALVVLSAIPAAAAVPAVDSGNTAAAAAENTSAAAA
FT                   QEKTKANYTRLFIDAEDSYRDAKPGETLEYTVTVKNGEEESVEVNPHLVTTPMSEYPME
FT                   KKWVSIDGPSSIDAGETAKYTVSVEIPEDVETADYRGRVAFTDETVTYPGRPARPIHST
FT                   HISADVWREPTVKILSDTYVNGQVKAGDSFTREVVIENTGDSAVPLSPEVKTERRHCRG
FT                   HCPNKLNPSWIDIDSPSQVAAGEKATVSVTVSPPENADRGRYDTEINLGLKDPNREEGN
FT                   DYWQRIDANFVVWTQPSEPFETSFQVSDETDNLSLTLMPERYNADNSDEVSFDVEFVSP
FT                   DGEVVNAERVRVTDSGHVDLGDRRSPRASQQDGEYAVRSGGQEFVYRVDEPAAGEWTLR
FT                   VMPENTMSFQYDLTREEASEEATNEPADETANETSD"
FT   sig_peptide     complement(215463..215528)
FT                   /locus_tag="Hbor_02340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(215691..217436)
FT                   /locus_tag="Hbor_02350"
FT   CDS_pept        complement(215691..217436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02350"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="PFAM: UvrB/uvrC motif; UvrC Helix-hairpin-helix
FT                   N-terminal; Helix-hairpin-helix motif; GIY-YIG catalytic
FT                   domain; TIGRFAM: excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65845"
FT                   /db_xref="GOA:E4NSV7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV7"
FT                   /protein_id="ADQ65845.1"
FT                   /translation="MDASDVRERATDLPTDPGVYQFLDGDTVLYVGKAVDIRARVRSYA
FT                   DPRGERIRQMVERAGAIDFAVTDTETQALLLEANLVKRHQPRYNVRLKDDKSYPLVQLT
FT                   DHPVPRIEVTRDPEEGATVFGPYTDKGRVETVVKALRETYGVRGCSDHKYANRDRPCLD
FT                   YEMGLCTAPCTGEIAESDYREDVESIVRFFEGETGVLADPLRRTMEEAAQAENFERAAN
FT                   ARDKLEAVESFHGAGEEAVTSQSDERAVDVLGVAIEGDAATVARLHSERGQLVDRSRHR
FT                   LDAPEGGERSAAVLSAFLTQYYAERELPDAILLSERPDDDDVVEWLNVEGVSVRVPGAG
FT                   REAKLIDLALKNARRGPTRDDGLAVLAERLDIPRPSRIEGFDVSHAQGKAVVGSDVCFV
FT                   DGSAEKADYRRKKLPERNDDYENMRALIRWRAERAVEGRDDRPDPDLLLIDGGDGQLGA
FT                   ARDALTEVGWDVPAIALAKDEELVITPDGVYDWPSDAPHLHVLQRVRDEAHRFAVQYHQ
FT                   TLRDDVRTVLDDVPGVGEKTRRALLRRFGSVENVRAATTADLTDVPGVGEKTATELKQR
FT                   LSGGE"
FT   gene            complement(217549..218019)
FT                   /locus_tag="Hbor_02360"
FT   CDS_pept        complement(217549..218019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65846"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV8"
FT                   /protein_id="ADQ65846.1"
FT                   /translation="MGREAMDTLYELLSSERRRDVLITLTSAERPLARDELARRIVVRR
FT                   QRLLRADVPNHPKTKKVEISLGHVHLPKLENGGLIDQTKDGRYDVTLLGQDVERAARAF
FT                   KKALNGDDTNRLDGSGTNQFIDNKTWQSGKSSQLSINRRSGVPANDVDGDNC"
FT   gene            218134..218424
FT                   /locus_tag="Hbor_02370"
FT   CDS_pept        218134..218424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65847"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSV9"
FT                   /protein_id="ADQ65847.1"
FT                   /translation="MGDADTDAEETVRCWLVERTYTDRDLIDLVYATPDGSRVRRKQIS
FT                   ATIMRQRGAEATAATDVSTANLDPVADDQTRERYRAEVERVRAEYDPDDEL"
FT   gene            218640..219044
FT                   /locus_tag="Hbor_02380"
FT   CDS_pept        218640..219044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02380"
FT                   /product="transposase"
FT                   /note="PFAM: Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65848"
FT                   /db_xref="GOA:E4NSW0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW0"
FT                   /protein_id="ADQ65848.1"
FT                   /translation="MEYDLDSGAHSTYSLHYHLILTTKYRRGVLTEERTQFIHEVISGF
FT                   TDNYGVELTNFDGEDDHVHILFRAKPTTDLVKFINTAKGATARRIRNEYADELKTELWG
FT                   DSFWNDSYCLISTGQVSLDVLKQYVEDQRE"
FT   gene            219046..220287
FT                   /locus_tag="Hbor_02390"
FT   CDS_pept        219046..220287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02390"
FT                   /product="transposase, IS605 OrfB family, central region"
FT                   /note="PFAM: Helix-turn-helix domain; Putative transposase
FT                   DNA-binding domain; Probable transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65849"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW1"
FT                   /protein_id="ADQ65849.1"
FT                   /translation="MYYAYKYRLKPSDANREELDRHRDICRQLYNHTLYRLNEYQDEHR
FT                   ELPSMTSLRSELPDLKEWWDDLSDVYSKVLQTVVERLFDNLKGLSKLKENGYSVGQLKW
FT                   KPPREFRSFTYSQSGFKLDKKGGQTVLSLSKLADIPIRLHRAIPDDAKLKQVTVKKEQT
FT                   DEWFATFGVQMDREPPEPPENPEKCVGIDVGILKYAHDTDGAAVGSLDLSDERDRLERE
FT                   QRKLSRKQHGSNNYEKQRRRVAECHADLRRKRRDFLHKLSAYYAREYDLVAVEDLNVKG
FT                   MMESPSNSRNTASAAWRTFLSLLEYKCEREGTHFVAVNPRGTTKECASCGVSTDKPLWV
FT                   REHSCPACGFEADRDANAAWNILSRGLQDVGVGHSESTPVETALPVDTPVSAKRVVEAG
FT                   SPTLKERTASAVSE"
FT   gene            220407..221504
FT                   /locus_tag="Hbor_02400"
FT   CDS_pept        220407..221504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02400"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65850"
FT                   /db_xref="GOA:E4NSW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW2"
FT                   /protein_id="ADQ65850.1"
FT                   /translation="MAAIELDRVTKRFEEGGRVSHLLDSIRGADGSKGVTAVRDLSLTV
FT                   EEGEVFGFLGPNGAGKSTTINMLLDFVRPTEGTISVLGFDANDQSVDVRARTGVLPEGF
FT                   DVYERLTGREHVEFAASSKGVEMAAAATTESEGETMESEESVGEEKVDAVLDRVGLAAA
FT                   ADRKAGGYSKGMRQRLALAMALIGDPDLLILDEPSSGLDPAGAKEMRDIVVEEAERGTT
FT                   VFFSSHILEQVEAVCDRVGILRDGELVAVDTIDSLREKSNADSTLNVRVAGDVTTVDTD
FT                   AVTALDGVHSVTVEDGDDKLIVSCAGDAKTAVIAELESQGLGVADFETREASLEDLFLS
FT                   YTGHETGGDEDSTVDETNTEQEVSA"
FT   gene            221501..222421
FT                   /locus_tag="Hbor_02410"
FT   CDS_pept        221501..222421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02410"
FT                   /product="ABC-type transport system involved in
FT                   multi-copper enzyme maturation, permease component"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65851"
FT                   /db_xref="GOA:E4NSW3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW3"
FT                   /protein_id="ADQ65851.1"
FT                   /translation="MTWQAVARKEFDDSIRSRWLHGATVFFVLFVGGAALLAFGLIYPD
FT                   RFKDASNLFGFFLDLGIFSLSFPGLLALILGFIALSTSYGSITEERETGTMKLSLSLPN
FT                   SRRDLIVGKLLGRGAVVIVALLAGFLAAFVAMVATGTGISYGSFVPMIALTVLLAFAFV
FT                   SIGLGISAVADTNREATLATLGLYLIFGILWKPIAEGIPKLLNYVAEQAGMGALENVTR
FT                   VKIGLFLKYLNPLRTYETLSAQVYYGAARGRLLGATTGETLVIEPVLKQGIPPYLSGAA
FT                   MMAILLAWIVVPVVVGYYVFQKQDL"
FT   gene            complement(222451..224535)
FT                   /locus_tag="Hbor_02420"
FT   CDS_pept        complement(222451..224535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02420"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="PFAM: NAD-dependent DNA ligase OB-fold domain;
FT                   NAD-dependent DNA ligase adenylation domain;
FT                   Helix-hairpin-helix motif; BRCA1 C Terminus (BRCT) domain;
FT                   TIGRFAM: DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65852"
FT                   /db_xref="GOA:E4NSW4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW4"
FT                   /protein_id="ADQ65852.1"
FT                   /translation="MRDGGKLAYADPDNPYLTDPDTDFEPVESLSAEAAEREARLLREA
FT                   VREHDHRYYVAADPLVADRTYDALFNRLQELEDAFDLDDESSPTRRVGGEPLDELDTVE
FT                   HVAPMLSIDQSVEAADVRDFDRRVREAVGEVRYVCEPKFDGLSVEVVYEDGEYVRAATR
FT                   GDGERGDDVTAQVRTIRSIPLRLRGDYPDFLTVRGEVYMPRDAFQELNRERIEADEEPF
FT                   ANPRNAAVGTLRQLDPSVTADRPLDCFFYDVLDASDVPETQTATLSRLDSWGLRTNDRV
FT                   ESVADIDGAIAYRDELMAAREDLNYEIDGTVIKVDRRDQREQLGETSRSVRWAFAYKFP
FT                   ARSEVTTMTDVVVQVGRTGRLTPVALLDPVDVGGVTVSRASLHNPEEIERLGVNIGDEV
FT                   RIKRAGDVIPDVEEVVEKHSEGTFDFPEECPVCGSPVNREGPLAYCTGGLTCEAQLVRA
FT                   VDHYAMRGALDIEGLGGERVEQLVDEGLIEGLPDLYRLERDELSELEGWGKTSADNLVT
FT                   EIEATKSPELSSFLVGLGIPEVGGSTARNLARAFGSLDAVMDASVEELEEVEDVGPTVA
FT                   EKIREFFDTESNRKAIAEMRSLGVEPETAETAGGDELDGLTFVFTGSLAVTRGDAQELV
FT                   QAHGANATSSVSGNTDYLVIGDNPGQSKRDDAAANDVPVLDEDEFAELLAEKGIEYPPE
FT                   "
FT   gene            complement(224740..227043)
FT                   /locus_tag="Hbor_02430"
FT   CDS_pept        complement(224740..227043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02430"
FT                   /product="HEAT repeat-containing protein"
FT                   /note="PFAM: PBS lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65853"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW5"
FT                   /protein_id="ADQ65853.1"
FT                   /translation="MSSQAGAADARIEVGYDAAVYERLREGDANPDAVLRVVCGGREVA
FT                   CGRDGLHWHCTQLVRALEPLLEGEPATVEFYEDDKRYHLLPDGDAVRFRYGQKDGSDDE
FT                   FAVDIAIDRTTFVTELLRTVETFCDVVVGANPELADEVAEIREQAGNARVVAAGFDEWG
FT                   LPVRLLDTVPETAHDGTVYTQTVVLATGNARFGAFDGDTLTEDGSRDALAAARVWLSGP
FT                   EVVARGESVGFHVDPNPDALVWYDHTFSGEVIDIVDLPSSVRTPSDCNPDQYALLHLGV
FT                   GTVAFDPAEVGDVVERDDNGGDVENDTDSDSREGSNESGVAVGDKLRLRATRVHLSDVV
FT                   VTDAPSMADRSESHLKDALSDPSLRAAAATELARRDADGATETITDCLRTDPPVSDRRA
FT                   LVHALDVLADDVAVPALVERLDDTNPDVRRAAAVALATVGDPDSLDPLLSAVRTEPDAA
FT                   TRRAIARAARDIDPTSALDHFASLVRTDTEPEVRESVVRVLSGTGGVHAEGLVVEAVDD
FT                   PNPDVACEAISAVRWFTDERPVGGLLRRLTDDDPGVRVAAADAFIELGARAAHYHDGDE
FT                   LSAETRTRVVRALLDRLDDENVPVRETAMEALGSQAHPESVMPLCAAYDEDEACRSSAI
FT                   DALGRIDDPRAIPTVVAALDDTEASVRRRACRACARLGTSAGVRRLCHLAENDPQLAVR
FT                   VEAVDALGHVGDGRETVFDTLETALDADDADLRWEAVTALGRLDHPRARFLLRRAAEDD
FT                   PDESVRDRARSRLE"
FT   gene            227151..228473
FT                   /locus_tag="Hbor_02440"
FT   CDS_pept        227151..228473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02440"
FT                   /product="OAH/OAS sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PFAM: Cys/Met metabolism PLP-dependent enzyme;
FT                   TIGRFAM: OAH/OAS sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65854"
FT                   /db_xref="GOA:E4NSW6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW6"
FT                   /protein_id="ADQ65854.1"
FT                   /translation="MNHGFHTRSLHAGQEPDAATGSRAPPLYQTTSYVFEDADYAADLY
FT                   ALDAEGDVYSRISNPTTRVLEDRLAALEAGVGAVATASGMAALDAATSLLASAGDNVVA
FT                   SADMYGGTSTYLTKMATRRGVDIRVVETLDYDAYADAIDADTAFVHVETIANPSLKTPD
FT                   FERLAHVAHEGGAPLVVDNTFATPYLCRPIEHGADIVWESTTKWLHGSGTTVGGVLIDG
FT                   GTFPWEHADYDELSGENPAFGVDFVERFGERAFAMAARQRSLRTLGNQQSPFDAWQTLQ
FT                   GIETLPLRMEQHCENAHEVATFLRDHDDVAWVSYPGFEDHESHDNATEYLDGGFGGMVT
FT                   FGLADGYAAAKRTCENTALASFLANVGDAKTLIIHPASTTHAQLSADEQRAAGVGPDML
FT                   RLSVGIEDAADIVADLDESIRSAAAEASGAGATETTRTEER"
FT   sig_peptide     227151..227186
FT                   /locus_tag="Hbor_02440"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            228470..229678
FT                   /locus_tag="Hbor_02450"
FT   CDS_pept        228470..229678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02450"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="PFAM: alpha/beta hydrolase fold; TIGRFAM: homoserine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65855"
FT                   /db_xref="GOA:E4NSW7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW7"
FT                   /protein_id="ADQ65855.1"
FT                   /translation="MKTESDTVELGAFDFECGAEIPSLEVAYEAYGEFDGDNAVLVCHA
FT                   LTGSQNVAGYGTETAGQARAWWNDIVGPGKAIDTNEYYVVCANVPGSCYGTTGPASESP
FT                   DGEPYGTDFPPVTIGDWTRAQRRLLDELGVGRLHAVVGGSVGGMNALDWVRRYPDDVRY
FT                   LLAVATAGRLDPQCLALDAIARRSITTDPNWNGGDYYDSEPPDDGLALARQLGHVMYLS
FT                   KSSMERKFGRRAAGRDARRDSFPADPAASFFAYRDVESYLDYQAEKFVDRFDANSYLYL
FT                   TRAMDDYDLAEGYEDDADAVAAFEGEALLLSFTGDWHFTTEQAESLAESFRDTSVPVAH
FT                   HVIESDHGHDAFLVEPEKVGPPVRDFLDAGVAGRSVHDTVEEVEEPSVERDFAPVHTSL
FT                   FSR"
FT   gene            229679..230113
FT                   /locus_tag="Hbor_02460"
FT   CDS_pept        229679..230113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65856"
FT                   /db_xref="GOA:E4NSW8"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW8"
FT                   /protein_id="ADQ65856.1"
FT                   /translation="MTGPEAIFPPPDDRLGMSLARAFGRVGALAVALSGLAVTYYGLYV
FT                   VGPGLGSETAIRTLFTPSPTNTSLAIGSIGLVAALAALPVLVGRGRWAAISVGTFLVVL
FT                   STLAIVSGVITVTAWLSGGLIGLLLFFAGASLNGHHGDPA"
FT   gene            230187..231497
FT                   /locus_tag="Hbor_02470"
FT   CDS_pept        230187..231497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02470"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PFAM: Cys/Met metabolism PLP-dependent enzyme;
FT                   TIGRFAM: OAH/OAS sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65857"
FT                   /db_xref="GOA:E4NSW9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSW9"
FT                   /protein_id="ADQ65857.1"
FT                   /translation="MSEDADDDHGTPGFSTRSLHAGQDPDAATGARAPPIYQTTSYVFD
FT                   DAEDAAGQFALEKEGYIYSRLMNPTVATLQERLASLEGGVGAAATASGMAAFDLATFLL
FT                   ASAGDNIVSASSLYGGTYTYLTHTVERRGITTKFVDTLDYDAYDEAIDEDTAFVHVETI
FT                   GNPALVTPDFERLADIAHDHGVPLFVDNTFATPYLCQPLEHGADLVWESTTKWIHGAGT
FT                   TIGGILVDGGSFPWTDYADKYPEIAKPNSAYHGVNFAERFGDAAFTYAAIARGLRDLGN
FT                   QQSPFDAWNTLEKVESLPMRMERHCENAQVVAEFLESHDEVSWVNYPGLESHETHEEAS
FT                   KYLDGGYGGMITFGLEAGYDAARETVNHVELASLLANVGDAKTLVIHPASTTHQQLTEE
FT                   EQVAAGVTPDMVRLSVGVEDADDIVADLQQAIETATN"
FT   gene            231575..232741
FT                   /locus_tag="Hbor_02480"
FT   CDS_pept        231575..232741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02480"
FT                   /product="phosphate/sulfate permease"
FT                   /note="PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65858"
FT                   /db_xref="GOA:E4NSX0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX0"
FT                   /protein_id="ADQ65858.1"
FT                   /translation="MTETLVLVGLVVAVFVGFNIGGSNTGVAFGPAVGSRTVSKFGAGV
FT                   LMGIFALFGGWTVGRRVVTTLGSDLIIGDPFTVAASVVILLFIGLALFVSNLFGIPAST
FT                   SMTAVGAVAGYGLATDRLAVQLIMEIVSWWLVAPILGFWLSAVVGRYVYDDIASVVAID
FT                   RSDGPLVILRRDGVVPVPALGAGTTPRELTGSLLVVAIGCFMAFSAGASNVANAVAPLV
FT                   GNGSLSMNAGILLAGGAIAIGALTIARRTLETMGNELTELPLTAALVVATVSATLVTVL
FT                   SLLGIPASFVVIATMSTVGLGWGRETTRERSYPVADPATLAGPTRSGIETVAAGRDSAD
FT                   TSLDVDEPATLYRPVTTARVIFMQNIVPAVATVGAYSVFSYVELAAVM"
FT   gene            232814..233971
FT                   /locus_tag="Hbor_02490"
FT   CDS_pept        232814..233971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02490"
FT                   /product="phosphate/sulfate permease"
FT                   /note="PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65859"
FT                   /db_xref="GOA:E4NSX1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX1"
FT                   /protein_id="ADQ65859.1"
FT                   /translation="MVEILLVVGLLVAAFVGFNIGGSSTGVAFGPAVGSGLVSKLLAAG
FT                   LMTAFALLGGWTAGREVIKTMGGQIVPQSEFTLAASVAVLFFVGFALLISNTFGVPAST
FT                   SMTAVGAIAGLGVATGTLNEAVMLEIISWWIVAPVIAFWVCAVIGRYVYPYLDAKLELD
FT                   SSPGPLVEFDNAGILPKLRLGPNTTPREAWSTVLVIAIACYMAYSAGASNAANAVAPLV
FT                   GNGALKLNEGILLGAGAIGLGAFTIARRTLDTVGNDLTELPILAALIVETVSASLIAFL
FT                   SYIGIPASLAVSATMCIVGLGWGRATRTVTLGEALGGKSPEMSVNALAAETQEEVPAMG
FT                   QETETDLAGSDLFDPGTTGRVIFFWLLTPSLSALASYALFAMSPF"
FT   sig_peptide     232814..232897
FT                   /locus_tag="Hbor_02490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            234085..234474
FT                   /locus_tag="Hbor_02500"
FT   CDS_pept        234085..234474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02500"
FT                   /product="ferredoxin"
FT                   /note="PFAM: 2Fe-2S iron-sulfur cluster binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65860"
FT                   /db_xref="GOA:E4NSX2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX2"
FT                   /protein_id="ADQ65860.1"
FT                   /translation="MPTVEYLNYEVLDDNGWDLDDDDLFENAADAGLDGEDYGTLEVNQ
FT                   GEYILEAAEAQGYDWPFSCRAGACANCAAIVKEGEIQMDMQQILSDEEVSEKNVRLTCI
FT                   GSPETDEVKIVYNAKHLDYLQNRVI"
FT   gene            234728..235687
FT                   /locus_tag="Hbor_02510"
FT   CDS_pept        234728..235687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02510"
FT                   /product="leader peptidase family protein"
FT                   /note="PFAM: Archaeal Peptidase A24 C-terminus Type II;
FT                   Type IV leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65861"
FT                   /db_xref="GOA:E4NSX3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR009655"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX3"
FT                   /protein_id="ADQ65861.1"
FT                   /translation="MNATLPDILRLVIVPVLGWAAWQDIETRRVPSVIWYPLVALGVVL
FT                   LAWDTLPHLAFAPEDILYFVRVGISLLFVAPLSYIFWRLGGFGGADAKALITISILVPT
FT                   FPQYLLPGLSLPTVRTTLGVFSMTILTNTVVLAVGYPLALAARNLVDGNAELPLMFLGR
FT                   RIPVGSLATAHGRLFETTTGYTRNGLDIDALRMYLRWRGTTLSELREHPDKLRDPTSIT
FT                   ETHEPTDGAVGDGMAVDGGTVETEDPWGAAAFLDDIDSTAYGTTPEKLRDGLQVVASQD
FT                   EVWISPGIPFIVPMFVGTVIAFTYGDIVFGIVGALGLV"
FT   gene            235737..236087
FT                   /locus_tag="Hbor_02520"
FT   CDS_pept        235737..236087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65862"
FT                   /db_xref="GOA:E4NSX4"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX4"
FT                   /protein_id="ADQ65862.1"
FT                   /translation="MSRGTRAAGILGTGLGGVVTYTLYADLLLSATAGLCWGVGSALTV
FT                   RYRTEWTGDPDRTSAADGLPSAFVLFVGLFGVHAGLPIPDGLRWALVVLVVGALVAAIG
FT                   LGILLARRATTA"
FT   gene            236142..236507
FT                   /locus_tag="Hbor_02530"
FT   CDS_pept        236142..236507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02530"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65863"
FT                   /db_xref="GOA:E4NSX5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX5"
FT                   /protein_id="ADQ65863.1"
FT                   /translation="MTEDVEVDFGDDGLVPAVAQDADSGEVLMLAYVSPEALERTRETG
FT                   RAHYYSRSRDELWEKGATSGHTQSVEEVRVDCDADTLLYLVEQTGGACHTGRRSCFYRT
FT                   IDGDEVGKTVFDPDDVY"
FT   gene            236513..237652
FT                   /locus_tag="Hbor_02540"
FT   CDS_pept        236513..237652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65864"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX6"
FT                   /protein_id="ADQ65864.1"
FT                   /translation="MPDETLTAADADTLRERLLAARDAHAAAEADIESIGEESVVAAAD
FT                   AYRKAIRLLDNYEESAVGTGDFQAYVEFQDKFLGLVEELPEELPDREAFEAAADRMDRR
FT                   RLRERDFEGARADLEAAESYVEYLDHRTETKEELTEARRDAKLLLKDTDSRISELERLV
FT                   ELGEADVDAPVEHIRDPIDRYNEAVSEEFQSFKQSESAQEVLSVVEAAEWHSLVEFRSP
FT                   PRDLREFVRESPDADEPIPTLLEYADYTGSKLDHYAEDPAMLQTSVAVHRTYLERLDAD
FT                   PLCVSFPPPSAETLRRKANELVSVLDRFASETTIAALRTVRELTRRDDYDRLRTAARAR
FT                   TELTDAELERLRSGAVETELHELREAHDKLADALSEADG"
FT   gene            237656..237937
FT                   /locus_tag="Hbor_02550"
FT   CDS_pept        237656..237937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65865"
FT                   /db_xref="GOA:E4NSX7"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX7"
FT                   /protein_id="ADQ65865.1"
FT                   /translation="MSVVGALALLTGLACFYFGARELRFRRAIVRVNRRDDPAEDVTGI
FT                   DDAPTAWLLPPEDRDEMPDDPSSGVSLERGVILLVFGAIACLFGLFSF"
FT   gene            complement(237923..238504)
FT                   /locus_tag="Hbor_02560"
FT   CDS_pept        complement(237923..238504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02560"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65866"
FT                   /db_xref="GOA:E4NSX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX8"
FT                   /protein_id="ADQ65866.1"
FT                   /translation="MTPSVTVRPVASFAEFRAGSRVVRLAWRAAFDHIISEAALPPTEL
FT                   DEDRASELKAAYETASAANESHIVAVADEESADTGGAVTGGESIVGYARGVWDPVRTES
FT                   FAADDDAELRALYVRPDHWGEGIGSALLSSLESNAPAGVDRLALQTFADNEDGCAFYRT
FT                   RGFEVVGENTYEVGDESYPTVVFAKPLEAE"
FT   gene            complement(238558..239922)
FT                   /locus_tag="Hbor_02570"
FT   CDS_pept        complement(238558..239922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02570"
FT                   /product="phosphomannomutase"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65867"
FT                   /db_xref="GOA:E4NSX9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSX9"
FT                   /protein_id="ADQ65867.1"
FT                   /translation="MKLFGSSGTRGVVGDGLTPEFVLRVSKAAGTVWGSDRAVVARDTR
FT                   TTGEMFSNAATSGLASVGVDVDVLGAVPTPGVVRYCEVEEVPAVVITASHNPPEYNGIK
FT                   LVGDDGVELSVADLERIEDHVLAEEFDTAAWDEVGEIRRVDSSNRDYVDDLLASVDREA
FT                   IADANLTVALDPGHGAGCLTSPDFFRELGCEVVTVNANPDGHFPGRESEPVGSKLGDLC
FT                   RLVKASDADVGIAHDGDADRAVFVDENGEFVAGEASLAALAAAQLEEDDTAVAAVNVSQ
FT                   RLVDVCNEVGANLELTPIGATNLITRIRDLWAQGETVPIAGEGNGGIFFPNYRLVRDGA
FT                   YTAAKFLELITDREVSDVVAPYTDYVNVRVNLGYDDEAELEAMLDAAREYAESADATPN
FT                   TTDGYRLDYGDAWVLVRPSGTEPKVRVYAEARDEARAEDLAAGAKDALLAALEDV"
FT   gene            240193..240930
FT                   /locus_tag="Hbor_02580"
FT   CDS_pept        240193..240930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02580"
FT                   /product="1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="PFAM: Histidine biosynthesis protein; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65868"
FT                   /db_xref="GOA:E4NSY0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSY0"
FT                   /protein_id="ADQ65868.1"
FT                   /translation="MAEAFPTFEVVPAVDMQDGEVVQLVQGERGTEKRYGDPVAAAERW
FT                   INEGADTLHLVDLDGAFEGERQNADAVEAVVDAVDVPVQLGGGIRTAADAIDLLERGVE
FT                   RVILGTAAVENPDIVREISDAHPGSVMVSLDAKDGEVVVSGWTEGTGLDPAAAAARYEE
FT                   LGAGAILFTDVDVEGQLEGIQTAVTQRVVDAVTIPVVASGGVASLSDVRALKEAGAAAV
FT                   VVGTALYEDAFTLQAAQDAVSED"
FT   gene            241340..241951
FT                   /locus_tag="Hbor_02590"
FT   CDS_pept        241340..241951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02590"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65869"
FT                   /db_xref="GOA:E4NSY1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSY1"
FT                   /protein_id="ADQ65869.1"
FT                   /translation="MSDDADSDATSRTAAVSRETAETTIEVTLTIDGDGDATVDTGVGF
FT                   FDHMLEAFAKHGLFDLTVNCDGDLEIDDHHTVEDVAIVIGDAFSEALGDKRGIVRYADR
FT                   QVPLDEAVAGVVVDVSGRPYFDFDGEFSQEQIGDFTSDMARHFGYSLAMHAGLTLHTEI
FT                   RGENAHHEAEALFKALARALDDATRVDPRRSDTPSTKGEL"
FT   gene            complement(242216..243016)
FT                   /locus_tag="Hbor_02600"
FT   CDS_pept        complement(242216..243016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65870"
FT                   /db_xref="UniProtKB/TrEMBL:E4NSY2"
FT                   /protein_id="ADQ65870.1"
FT                   /translation="MRQLRSCDFCGGDAAGIYEVLPAELSPTESEQRRVVLCDGCLETL
FT                   ETVIDPLLNRLRAGESGQSVEKDTQRERSSSPNPTPASTESGEHGGVEGSGQSPDTSAT
FT                   AQTPAETLVGEDSSTTTDHSAAEAEPVSDKQPVDEEADDATEDTPSAAVETSDASASGD
FT                   DTAGAADEGEQRESRADDETTNETDETPTETKETDAEPAESEPPNFRKVMRLLNNREFP
FT                   VERTEFADLASGAYDLDPSQVDDIIEYAIHRDVLADDGGQLRRA"
FT   gene            243136..243639
FT                   /locus_tag="Hbor_02610"
FT   CDS_pept        243136..243639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02610"
FT                   /product="predicted regulator of amino acid metabolism,
FT                   contains ACT domain"
FT                   /note="PFAM: ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65871"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR014424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTC6"
FT                   /protein_id="ADQ65871.1"
FT                   /translation="MFDEIMRKFEGSPSQQEVIRLLLERGFSVNDEGRVVSGGIEIPNT
FT                   GIAREIDVDRRVVDSTTSAILEDEELRRIFQNISSIPSLMDLAPVLDLSVLTVEVADAD
FT                   APGIVAEITGRLAERDISIRQTISEDPEFTDDPKLYLVTDQPVPGDLLNELSSISFVRQ
FT                   ISIA"
FT   gene            243722..244342
FT                   /locus_tag="Hbor_02620"
FT   CDS_pept        243722..244342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02620"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Uncharacterized protein family UPF0029; Domain
FT                   of unknown function (DUF1949); TIGRFAM: uncharacterized
FT                   protein, YigZ family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65872"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTC7"
FT                   /protein_id="ADQ65872.1"
FT                   /translation="MTDAYRTVAGPAEASFEVRGSEFIGYVDRANTVEKAEAFIDRIEE
FT                   RHPDATHNVPAYRVPAGGDSGGANTMLREYSSDDGEPSGSSGKPALNVLVQQEIRNVVA
FT                   VVTRYYGGTNLGVGGLARAYSRGVKEAVEAAGTVEEVPHETFSVTVAYDDSGSVRGLLE
FT                   SADVSFDAAYEADVSFDVRVPVEEGAELRDRLRSATSGRADIE"
FT   gene            244423..245559
FT                   /locus_tag="Hbor_02630"
FT   CDS_pept        244423..245559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02630"
FT                   /product="glycine/D-amino acid oxidase, deaminating"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65873"
FT                   /db_xref="GOA:E4NTC8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTC8"
FT                   /protein_id="ADQ65873.1"
FT                   /translation="MTDRHEAVVVGGGIVGSSVAYHLAREGVETLLVDRTDDGRATDAG
FT                   AGILSPGTTSRDNEPWVKFAVEAVAYYDELVPVLEREQDGPHGYAKRGVLSVAMDDEEA
FT                   NVCDETLERVRKRQERFGTPEPGTVEELDADEAQAKFPPLAETERAFFSADAARVNGRT
FT                   FEGALRRAGRTHGLSEREASVETLLVDDGGVEGVELAGGDQIEAESVIIAGGAWSQSFG
FT                   SQLGVEIPVEPQRGQIVHLDVDADTDGWPIVSPFRGHYMVPWDDGRVAAGATRETGSGY
FT                   APHTTIEGLTEVFEQVLRVAPGLADATLRTARVGLRPLSPDGLPVLGSVPDVSDVYLCT
FT                   GHGPTGLQLGPYSGKLVADAVRGEIPETDLEPFAVSRF"
FT   gene            245628..247787
FT                   /locus_tag="Hbor_02640"
FT   CDS_pept        245628..247787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02640"
FT                   /product="dipeptidyl aminopeptidase/acylaminoacyl
FT                   peptidase"
FT                   /note="PFAM: Prolyl oligopeptidase family; WD40-like Beta
FT                   Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65874"
FT                   /db_xref="GOA:E4NTC9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTC9"
FT                   /protein_id="ADQ65874.1"
FT                   /translation="MSQISATDYHDIVQVEDPQVSPDGTRVAFVRKEPKDDESYEQTIY
FT                   VVPAAGDSDPRRLTIAEGVDSQPRWSPSGDRLAFVSTRGADDDRPQLWVLPMDGGEAEQ
FT                   VTDVPGGVSGIEWSPDGTRIAFQQATTETEREDGIDLGIGDEEYEREASDPRVIDRLIY
FT                   RQQTQYRDGTVAHVYLAHVDRDDDRVERVTDGELDHVAPAWRDDDTLYFGVKFPQGEVE
FT                   PDDSPVIDIQSVELPSGDVTDVTQTTCWGLVMDVASDGRVAYVRTPEERMSMRSSDIEV
FT                   YDPETERAVVPTETLDRTVDLAAGLSWGPDEEDVYFLTPDGGHYVTRRVSADVEERSSA
FT                   DRETQSDDAEPELLISDGHTTGFSIGARSDSPVLAVAKSEWDHPGDVFVFESDEERRLT
FT                   EVNADYLTEVDVQEPEEIWFESDGVEVQGWVLTPPGCSEDETYPLAVEIHGGPHAMWST
FT                   SGTMWHEYQLLAARGYVVFWSNPRGSTGYGEEFATAIESDWGDVTMTDVMNGVERVCDR
FT                   DYVDAENAFVTGGSFGGYMTGWIVGHTDFFAGAVGQRGVYDLSSFYGSTDAFKLIEGDF
FT                   DTTPWDDPEFLWEKSPVAYADNVTTPTLVMHADNDFRVPVNNGEMFYLFMKKNGVETRF
FT                   VRYPREGHELSRSGEPGHVVDRLERTVRWFDGYSDYHDVPKALERGDDGLSANESDSES
FT                   DDEADASDDAETGNTDGDTSADTDE"
FT   gene            247898..248167
FT                   /locus_tag="Hbor_02650"
FT   CDS_pept        247898..248167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65875"
FT                   /db_xref="GOA:E4NTD0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD0"
FT                   /protein_id="ADQ65875.1"
FT                   /translation="MSLQLIAPAVLGLACLVVGYVLVFRVETALAVQEKYAEAASSTPP
FT                   SENPEYYEETHEHRRWTFYLGGMVLLAVGTLLIAAAVYGTFSVE"
FT   sig_peptide     247898..247954
FT                   /locus_tag="Hbor_02650"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(248493..249011)
FT                   /locus_tag="Hbor_02660"
FT   CDS_pept        complement(248493..249011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65876"
FT                   /db_xref="GOA:E4NTD1"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD1"
FT                   /protein_id="ADQ65876.1"
FT                   /translation="MGRNLCKRFGPGRLPYASRRDIGGGIAMAATGLLATVVWFAGAWA
FT                   IAAKTGNGTLGFTFGMGLFFLPLVLPTSFVIGTLLWRKLYPKENRELYGAVFGAMTALA
FT                   SLAVGSLGPALFLAISNVNSGAMPVSEAAGFALLLIPSFVFALVAAGWFVIPLGAFGGW
FT                   YHERAKATA"
FT   gene            complement(249194..250291)
FT                   /locus_tag="Hbor_02670"
FT   CDS_pept        complement(249194..250291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02670"
FT                   /product="beta-mannanase"
FT                   /note="PFAM: Glycosyl hydrolase family 26"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65877"
FT                   /db_xref="GOA:E4NTD2"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD2"
FT                   /protein_id="ADQ65877.1"
FT                   /translation="MERRRFLGLVAASAGTTVGGAGIVRSVAGTGETRTGDFLAGVSIQ
FT                   RSPVRSLDRFEQWTGKPHAVVVQYATLGQSEEEIAQTVSSLESIWQHGHVPMLVLEPTF
FT                   GTKTETSTTISRDIADGKHDDSVDAWRDALTKWMRRGWGRPDRRLFLEFAPEMNGDWVP
FT                   WGAPAGDSTPDDYVAMFRHVHRRVMSNGLDSSNIQWIWGPNAGGRGGIPIPDYYPGDDV
FT                   VDWAGVNGYNWWNWVSWFAPPKIYGKALKQIRSVTDAPIAITEVGCSTEVDSGNDPERK
FT                   GAWITELYDYVRTEDVKMVCWFNHTKETDWRVFDSVRGTDEITQDGETVHVYNAYRQEM
FT                   TKSTTLGAHPVDRRRLTDREFRGEF"
FT   sig_peptide     complement(250208..250291)
FT                   /locus_tag="Hbor_02670"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            250434..250739
FT                   /locus_tag="Hbor_02680"
FT   CDS_pept        250434..250739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65878"
FT                   /db_xref="InterPro:IPR040572"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD3"
FT                   /protein_id="ADQ65878.1"
FT                   /translation="MGGEQISTGLDASADTACPDCDGGRVQRVGMFEHTTCGFVDVAAG
FT                   FDAADRYLSCPKCDETLTTADDGLTCVAFVLHCPECDRRFDDVAIPSLAPQSAEAD"
FT   gene            250745..252448
FT                   /locus_tag="Hbor_02690"
FT   CDS_pept        250745..252448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02690"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2; Cellulose
FT                   synthase; TIGRFAM: phage shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65879"
FT                   /db_xref="GOA:E4NTD4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD4"
FT                   /protein_id="ADQ65879.1"
FT                   /translation="MNEPTDDAFGWSTRAPVQLLLLFFVVLAGVVLFPPVMIFGPLGFA
FT                   FVFAALVFGAVRWQRWSERLFGTGLPIPGWFVAAILSSLGLFALLAYTERYTTEATPFV
FT                   FLVAFCLPWVVSLTVGGRLRRLANTRVRLSIWLAIVLSALVLTGGFVFGWSVPTPYEMA
FT                   VFAGFVVIAFIVVVVFPLTIVQMRGREESDHTLDDDDAPLVSVLVPAYNESNYVGDCLD
FT                   SILASDYPTDRLEVIVIDDGSTDGTYAEASAYRNDRVSVFHRSNGGKHAALNLGLSCSR
FT                   GDVVVAVDADSILAPSALRTAVEQLQSDPRLGAVAGTVVVNNADGIVGSVQALEYVLGI
FT                   NTLRRAFSYLGTVMVIPGCLGVFRREALSEVGGYDPDTVTEDFDLTVRLLKAGWRVELS
FT                   EALVYTEAPFSLTDLLNQRLRWTRGNIQTLLKHRDVFSEPAYGFLHRFAFPLSALSILF
FT                   VPFASIVVTTMIFVAILNGAFLGVALVAAYFLFVLLFVAAMALDLSDGDWRLLAYAPLH
FT                   LVGYRQFLDVIVIRTALMLLRGTNKRWESVTRERQQSSEALAGSQRPSDD"
FT   sig_peptide     250745..250828
FT                   /locus_tag="Hbor_02690"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(252445..252648)
FT                   /locus_tag="Hbor_02700"
FT   CDS_pept        complement(252445..252648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65880"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD5"
FT                   /protein_id="ADQ65880.1"
FT                   /translation="MSDTDPCDACGEQVTDALARTVRITVDRSEVDSQRLCPNCFAGWI
FT                   ERYRTEMASERTGDEGSGIIVD"
FT   gene            complement(252729..253409)
FT                   /locus_tag="Hbor_02710"
FT   CDS_pept        complement(252729..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02710"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65881"
FT                   /db_xref="GOA:E4NTD6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD6"
FT                   /protein_id="ADQ65881.1"
FT                   /translation="MPIEDRDDAYLITHALAKDTLLRLRDVETEQVAFRKGLVKLGRIC
FT                   GYEIIDGVMETEYVTVETPLTETTGEHVKGLDNVVIINVLRAATPFVEGLLKAFPRAKQ
FT                   GVISAGRDEEAGMDDDGEFPITIDYVKLPEITEKDTVIVADPMLATGSTMCAVLDHVLS
FT                   NAAAEPTDLFVLSAVSAPDGLLRVGGQFPDADLLTVSIDDHLDDDGYIIPGLGDAGDRA
FT                   FRTK"
FT   gene            complement(253538..253726)
FT                   /locus_tag="Hbor_02720"
FT   CDS_pept        complement(253538..253726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65882"
FT                   /db_xref="GOA:E4NTD7"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD7"
FT                   /protein_id="ADQ65882.1"
FT                   /translation="MGTNPTSSGDPRVLFVMNLVLSSVFAAVVVWGLDFIGMVELTFVN
FT                   VASLALVLMAVTYLVTR"
FT   sig_peptide     complement(253649..253726)
FT                   /locus_tag="Hbor_02720"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            254147..254443
FT                   /locus_tag="Hbor_02730"
FT   CDS_pept        254147..254443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65883"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD8"
FT                   /protein_id="ADQ65883.1"
FT                   /translation="MSIAERIAEYREIVEEWLRGFYHGLISHPAYEKIEKEAEDQEDAF
FT                   MLACFPEAFGIPSPVSYYTAELLPYLEDEFEAWERRMWDRGSLLERKGQQYHF"
FT   gene            254446..255414
FT                   /locus_tag="Hbor_02740"
FT   CDS_pept        254446..255414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02740"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="PFAM: Anion-transporting ATPase; TIGRFAM:
FT                   arsenite-activated ATPase (arsA); TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65884"
FT                   /db_xref="GOA:E4NTD9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTD9"
FT                   /protein_id="ADQ65884.1"
FT                   /translation="MRKFVFFGGKGGVGKTTLASAYALKCAREGLDTLVVSTDPAHSTS
FT                   DVFDQQFGDDPQAVEGETNLAAMEVDPDTEVERHLMETKRAMGDQVSPAMVNEIDRQIE
FT                   MAHQTPGAYEAALMDRFIEVMRSADEFDRVVFDTSPTGGTLRLLSLPDLLESWIDRLVY
FT                   KREKSIDLYEKAAIGNNEPRRMMDGDPILDRLRTRKERFEFAGETLRENAAFFLVVNPD
FT                   ELSIRETRRAIDDLESYDLTICGLAANRLTPEPEPHEEGRGARFLRDRVETERERLREL
FT                   REDFRYPVVAEVATRVSEVKGDLLDAVAHELDLDVTIESHA"
FT   gene            255453..255929
FT                   /locus_tag="Hbor_02750"
FT   CDS_pept        255453..255929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02750"
FT                   /product="uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65885"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE0"
FT                   /protein_id="ADQ65885.1"
FT                   /translation="MEHIDVDDIDTFPHPMGSTSGGQALSDELDATNVALNRYTLEPGE
FT                   GSSGGLHTHLDQEEVFYVLSGTVTFQTVEGSVEVSEDEAVRFAPGDYHHGTNQSDDPAT
FT                   VLAIGAPGPQHDWEQIRVPIPCPDCEDVDALGIRFTDDGETALSCPECGRDVEI"
FT   gene            256074..257909
FT                   /locus_tag="Hbor_02760"
FT   CDS_pept        256074..257909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02760"
FT                   /product="carbon starvation protein, predicted membrane
FT                   protein"
FT                   /note="PFAM: Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65886"
FT                   /db_xref="GOA:E4NTE1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE1"
FT                   /protein_id="ADQ65886.1"
FT                   /translation="MVQVIWLVIAVLALFSAGYLGYSRYLAQFVELDDSRETPAHKYED
FT                   GQEYVPAKKPVLLGHHYSSIAGGAPIVGPITAGVVWGWVPALAWIAIGNPLMGSVHDFV
FT                   SLSASLRHEGRSIGYIIGEYVGERGKNMLLWFAFLTIILVVGVFALVVAIVFNAYPEAA
FT                   TASLIYIGLAVLLGAYLYQLDLPFIPGTIAFVVAMFVGVWVGIQYPLALFEPASRAPAQ
FT                   TTVLLSGIGTWWLPASDSLGANTAAWVPIILVYGAFASALPVWVLLQPRDYLSSFLLYT
FT                   GVGGALLAVIVGTVGGALGISAVTPSQPLVTNLDPFYGFIGRSGAPLFPLLFITIACGT
FT                   ISGFHSLVSSGTTAKQLNRESDARIIGYGGMLGEGLLATVALITVALVAPNVGGGIGLA
FT                   LPTFATGGGVILTSFGIPASFGAPFMALVLVSFLLTSTDTAVRLGRYMMEEIVGTPGSP
FT                   LGSFAVDRYGNAVAQALPAYLLVTSGSWLTLWQLFGGANQLLAALALLTATVWLANWSE
FT                   SKQLISTGGPMVVMVFITVMGLLWLALHDNVYAKFLNDAWMESATTLSMVSAAVQVVVA
FT                   FVLMYLALSLVLMGYRNIRRVRENPSEGGFSSGDD"
FT   sig_peptide     256074..256154
FT                   /locus_tag="Hbor_02760"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(257972..258610)
FT                   /locus_tag="Hbor_02770"
FT   CDS_pept        complement(257972..258610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65887"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE2"
FT                   /protein_id="ADQ65887.1"
FT                   /translation="MSEAEADSFDPKAAAEEAGIDLSHVPDWEDSYLDKVSDRLMFNYD
FT                   LEKDRSVSGERFDLFGEMRIESEKHFIHPALNYANHESHEFLFARRVTHPTVAELERLV
FT                   GLGHELADGDDWFVADEEHFGTDFTFVLVANEVPADVREFVAEFSDRTLIKFGYYGHYE
FT                   VNLAVVAPDEEDAVASQNADVAQAFTLWDDVRQTEQRGVVARVLDRLRR"
FT   gene            complement(258607..259029)
FT                   /locus_tag="Hbor_02780"
FT   CDS_pept        complement(258607..259029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02780"
FT                   /product="cupin domain-containing protein"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE3"
FT                   /protein_id="ADQ65888.1"
FT                   /translation="MGYRVVDCDEVETVEDRPCEMQRLSGAAGLENVAINRFRAAPGEQ
FT                   IPLAYHYHETQEEAFYVLSGTMAVETPAETYEVDEGSLFAVEPNSPQRAYNPANATEAV
FT                   EVLAIGAPAVTGDTRMYDSEEENKSERGNEPGGETE"
FT   gene            259129..259341
FT                   /locus_tag="Hbor_02790"
FT   CDS_pept        259129..259341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65889"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE4"
FT                   /protein_id="ADQ65889.1"
FT                   /translation="MSETKTESCGRCAMSTVVDAADDGEGSNPFDGGRIELSDREVRAI
FT                   SPAAWVARLASRIDDAATRFVYGSR"
FT   gene            259442..260128
FT                   /locus_tag="Hbor_02800"
FT   CDS_pept        259442..260128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65890"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE5"
FT                   /protein_id="ADQ65890.1"
FT                   /translation="MEESVSGFKIRGTWGDVVEHGERITRALRDAGVESDAFKQWDEWR
FT                   PKAHERLSEDVNEKTAAQASVSEGQGEKAGKEPNEDLQTAGEKLSESYQKVDEGDNDGA
FT                   VERWSESIGYVARAADSAGRKALRKVEDTVYRKVMTQLAPYYFDNELVSANIQKSARGE
FT                   DEVTFIFEVNINDDDLKSKVSRRLGEYDDEVDRWHVDTEKETTTAEAAEGVEAPPSDPD
FT                   SNFTTN"
FT   gene            complement(260474..261556)
FT                   /locus_tag="Hbor_02810"
FT   CDS_pept        complement(260474..261556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02810"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /note="PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65891"
FT                   /db_xref="GOA:E4NTE6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE6"
FT                   /protein_id="ADQ65891.1"
FT                   /translation="MSPSTSDGHTSAVTGPTADKSLVREMAAALALVVTIDVVAVAAFG
FT                   YLVAPWVEPYLPSGTPSVLVGGVAIVAVTGVFLLAHLRYARRGVLAAVGAKTVSESTHP
FT                   NLHARITRLAAQFDLRPPELAVVDTDVPNSLAVGGPRASTVVISRGLIDDLSDDELDAV
FT                   LAHELAHVKNRDATVMTLASVLPALANGEYSTSDSVIPSMSGAHYLIGAIGLFVLYVMA
FT                   TPRLSGTAFGGSSLGEFLLVVGFTLLLGGVLLGLLAAPAVVLTRRLSRRRELVADTAGA
FT                   RATGDPAAMASAIRTLADEERTRRDLRSTASTLSGLCFLPHGFSTDAEDDEKATIATQT
FT                   HPSVEDRLENLRTVTATLES"
FT   gene            261639..262709
FT                   /locus_tag="Hbor_02820"
FT   CDS_pept        261639..262709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65892"
FT                   /db_xref="GOA:E4NTE7"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE7"
FT                   /protein_id="ADQ65892.1"
FT                   /translation="MSRDRTRAALALLCVVVVLFGGSLFPTAGFGSYPAGIGGGNGVPG
FT                   APGDSPGSGIDDRATPTPSPTEAAQTADDGQTETATGTPTPTPTPTETPVSDGPTDDGI
FT                   SMDGAFAGIMLIIGVCAAGLLVFSLAPGIDEQTTFAGLPIGRFQTNLRAFFAAVPRRTT
FT                   SFLVGLSASVPGVLDRVFSVTVAAAESFGVIAKGLVRGSGRTLAVLGGSLGTVVTVLPR
FT                   AFGGGLSALFGGLLRAGSGGLTGRRGNEREPNDGSPTPTADVEEETDPTPQSVEEAWAM
FT                   MAERVPIGNRKAATPGEYARAAVAAGFPESAVQRLTRAFERVRYGGKSGRDELPSVRDA
FT                   LSRIRSFLDSNGGENA"
FT   sig_peptide     261639..261722
FT                   /locus_tag="Hbor_02820"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            262706..263560
FT                   /locus_tag="Hbor_02830"
FT   CDS_pept        262706..263560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65893"
FT                   /db_xref="GOA:E4NTE8"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE8"
FT                   /protein_id="ADQ65893.1"
FT                   /translation="MILSWLRRHLQIVFAACALIGAVVVVLPEWLLPSFVVTLASSSLA
FT                   SSSLVLVAAGLVGLYGIRVLVSPDEEETSQTTVQYPQTPPETAVHEVRRVVGEDVNGAA
FT                   STAVPDEKWKQRRHRRRAYGTLRTAAVDAIAETTGCPRETATELVAEGRWTDKPRARAY
FT                   LAQDTSIHPPLRTRVRDWAAGERTERAVQDTVSAILSIRDGDADVARAELAAIESTASQ
FT                   SVAHADAPAATTDEFADAEPPYTPSEDADTEKIAMERNAALAETDGGAPAKSTTDTDEG
FT                   DRR"
FT   gene            263557..264885
FT                   /locus_tag="Hbor_02840"
FT   CDS_pept        263557..264885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02840"
FT                   /product="conserved repeat protein"
FT                   /note="PFAM: Domain of unknown function DUF11; Protein of
FT                   unknown function DUF58; TIGRFAM: conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65894"
FT                   /db_xref="GOA:E4NTE9"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTE9"
FT                   /protein_id="ADQ65894.1"
FT                   /translation="MSGRGRVTTRSTQSDLSLASTLLSSGPARTDIGLVFALFAGAAGI
FT                   VVSEPAMFVSAIVGFVYVGYRNANREPDPTLTLDRTLSTQSPAPGATVEVTLTVTNETE
FT                   EPVPDLRLVDGVPERLAVVDGSPRLGTSLGPGESESLTYAIRARRGSHSFDECVVAVRN
FT                   LSGSAETRDAVEIDTKLDCEGSVDDVPLTGQTITASGRVPTDSGGEGVEFYATRQHHRT
FT                   DPMRRVDWKRYAKTGELTTVEFRRERAATVICLVDVRVEAHVARREGEPDAVWLSKYAA
FT                   ERAMESLLSTGNRAGVALYGAFPGQRYLEPKTGRDQVLRARSLFEKAEIPDASRTDRNQ
FT                   SRRNVNLETLLKRIPDDAQIAFFSPFLDEDVVTDARRLAAHGHSVTAYVPDLAGKTPGG
FT                   EISKFERDRRLRKLHGDDVRVVLWSPDEPLRAATDRAKARWSA"
FT   sig_peptide     263557..263646
FT                   /locus_tag="Hbor_02840"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            264882..266402
FT                   /locus_tag="Hbor_02850"
FT   CDS_pept        264882..266402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65895"
FT                   /db_xref="GOA:E4NTF0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF0"
FT                   /protein_id="ADQ65895.1"
FT                   /translation="MSQFGPEWHDAVDTVGAPDSSAAPFSASLAFGIAVVATFALGVAV
FT                   GSPLGAVVTAVGASVVGWSAGELTSNENSRRAVGSISTLVGTSLLAVSIGLFGPEPFVG
FT                   SVAAFALVAVAFDRFAGLTEDTVGVVSRAIIHSGVAIAGFAALALLVHFHVASTAALTT
FT                   YGLFSLLSRMSPLVSVLVIELEVLFIVLTIEPAIERLERLTPETRVLDRITALDVVAVD
FT                   IAAVPRGVWILVAGTGYLTATSWARVMFEQFLDSLSMLGTAVAFLLQSGFITGPLGFVV
FT                   ALLLAVFAVNMARLVVMFWLGSDPSETLSLAAGGFVVGSVAFVGGLIPSLSSIVSTTFS
FT                   EGPLLQIMARVYGTGATLLAVVVGLLFVVLLILAVIVYLVEHEFVPPAAGGFALGSGLL
FT                   FIAGLLVAATDAAAIVTVATVGAALLVWDLGENAVDVGQTLGTDAETRRGEAVHAAGSI
FT                   AVVTGAVVLAAISLYVLGPLSVPAGRARFALLLLVVALCGFAVATYNE"
FT   gene            266481..266720
FT                   /locus_tag="Hbor_02860"
FT   CDS_pept        266481..266720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65896"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF1"
FT                   /protein_id="ADQ65896.1"
FT                   /translation="MSEPLRAKSGELTADEILDILREGRRVIVEAEMLGGVHEVSLRHD
FT                   GTTFYCDTPTTLHKHAEEEEMRNCIVKMGYAKDE"
FT   gene            266782..267153
FT                   /locus_tag="Hbor_02870"
FT   CDS_pept        266782..267153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02870"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65897"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF2"
FT                   /protein_id="ADQ65897.1"
FT                   /translation="MSDTPDMGDLIETDDPSFQHVLACVFGIQEHESRTYLTLLDNPGS
FT                   TVAELADILDRDRSNVNRSLTTLMEKNLADRERRLLDPGGYVYQYTGTPLPEAKEMLHN
FT                   ALDKWAEQVHESIEEYGTE"
FT   gene            267284..268549
FT                   /locus_tag="Hbor_02880"
FT   CDS_pept        267284..268549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02880"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="PFAM: Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65898"
FT                   /db_xref="GOA:E4NTF3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF3"
FT                   /protein_id="ADQ65898.1"
FT                   /translation="MSLELTAPAPDVPDVADDGVWLECIETGETYAPFDEIRYTSDHGH
FT                   LLEVRYANPPTFEDFQGQGRGVWRYRSALPFEEGVSLPEGDTPLHEAPRLREDIGVNTL
FT                   RIKHEGMNPTGSFKDRGMTVGVRVAKELGVDRLACASTGNTSAALAAYGARGGMETLVL
FT                   LPSGKVAAGKIAQAALHDARILEVDGNFDSCLDIVQELAERGEVYLLNSLNPFRLEGQK
FT                   TIGLEILEAFRDDYGRFPDRIVLPVGNAGNTSALYKAFRELVQSGALDPEQVPKLTGVQ
FT                   AEGAAPMVEAIENGWEDTKRWDEVETRATAIRIGNPVNAPKALPGIRETDGTAVAVSDE
FT                   EITEAQRDLAGEGIGVEPASAASVAGLQKLRHEGVVDPDEDVVCLTTGHLLKDPDAAFE
FT                   AGGEPEPVANDTEAVLEHIGAE"
FT   gene            268631..269056
FT                   /locus_tag="Hbor_02890"
FT   CDS_pept        268631..269056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65899"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF4"
FT                   /protein_id="ADQ65899.1"
FT                   /translation="MSSQTLPTGTVSGGSDGSRTFPVRDVPRLERACDEPSEAADPTTE
FT                   TESQSVSAELAHLRRENEELRRALSEARQQRQDVIDRYERLLDRAQAEASADSASVSHQ
FT                   SADGSSDSLAQRVADEFGSRWTAFRRRCRQWIHAPNL"
FT   gene            complement(269121..270725)
FT                   /locus_tag="Hbor_02900"
FT   CDS_pept        complement(269121..270725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02900"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, catalytic domain; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65900"
FT                   /db_xref="GOA:E4NTF5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF5"
FT                   /protein_id="ADQ65900.1"
FT                   /translation="MITRMKVLVTDPIDDAGLERLREAGHEVETAYDVTGDALLDAVAD
FT                   ANALVVRSGTEVTDAVFEAASDLVIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAA
FT                   AEHTVAMAFASARSIPQAHARLKTGEWAKGDYLGTELNAKTLGIVGLGRVGQEVAKRLD
FT                   GIGMDLVAYDPYIGEERAERLGAKLVEFEACLERADFLTVHTPLTPETEDLISTEELEL
FT                   MGGGYLVNCARGGVVDEDALAAAVEDGTLDGAAIDVFADEPVSPDNPLLDVDDVVVTPH
FT                   LGASTEAAQENVATSIADQIDAAFNGEPVMNALNAPSVDKSAFPRIRPYIDLAETAGKV
FT                   AAQLLDGRISNVEVSYEGDIAEEDIELVTASALKGVFEPLEWQVNAVNAPRIAEERGIE
FT                   VTESKTRQAEDFQSLVTVTVGNDDESLSVCGTLFAGEDPRIVRIDGYRVDAIPHGQMLV
FT                   ARNYDKPGVIGFIGTVLGENDVNIAGMFNARRSADGGEALTVYNLDDPIPEEVSEKLLA
FT                   DERITDVKYLTLNGTAE"
FT   gene            270881..271531
FT                   /locus_tag="Hbor_02910"
FT   CDS_pept        270881..271531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02910"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   Haloacid Dehalogenase superfamily, subfamily IB,
FT                   phosphoserine phosphatase-like; phosphoserine phosphatase
FT                   SerB"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65901"
FT                   /db_xref="GOA:E4NTF6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF6"
FT                   /protein_id="ADQ65901.1"
FT                   /translation="MRLVAFDFDGTLSDSEMTVLLGRQMDVADEMADITERAMNDELSY
FT                   ADSLRKRAALLDGLDDEAASEAYGQVTLRPGAADLIERLRDAGHHVAILTGGFERGVER
FT                   ALEKDGVEVDSIVANRLPVEGGRLTGEVEGPLIEGTKDDALESLADELDVDLARTVAVG
FT                   DGANDLPMLEVAGLSVGFLPKPAVRPSCDAVVASMYRLGKLFEGHSMLKNSDQ"
FT   gene            271578..272282
FT                   /locus_tag="Hbor_02920"
FT   CDS_pept        271578..272282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65902"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF7"
FT                   /protein_id="ADQ65902.1"
FT                   /translation="MTTSDRSSATDFRVAQQWDDGLSWISDPDEIVRRASHAVRGDDDG
FT                   VWLFDPVDAPGIDDAIAELGPVEGVAVLSAYHARDAGAFATRHDVPVSIPRWLPRVAER
FT                   VDAAVERFSGELGDSGFRVRRYEPIPGWSEAIAYRSSDDILYTPEVLGTAPLYTVGQER
FT                   LGLYLPQRLFPPTSFTEYAPERILVGHGDGLSREATAALTDAVTNGRKRLPRAILKHGP
FT                   TQFRAAIASMID"
FT   gene            complement(272311..272820)
FT                   /locus_tag="Hbor_02930"
FT   CDS_pept        complement(272311..272820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02930"
FT                   /product="universal stress family protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65903"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF8"
FT                   /protein_id="ADQ65903.1"
FT                   /translation="MTLLVPFDGSVLAAAALVRATEFGRVFDQNVLAVSVIPDRNAEYA
FT                   RERGWIETDEPFDRETVVSKLHEQVTECCPSSDFRHEVVDRYATPGTIANCLRKTAERE
FT                   QASMVFIGSENAGHIVTTITSVGSKVAADEAYDVVIVRHRSPSEISTLSDANDHRTRKS
FT                   DFHFPE"
FT   gene            complement(272915..274342)
FT                   /locus_tag="Hbor_02940"
FT   CDS_pept        complement(272915..274342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02940"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   Pyridine nucleotide-disulphide oxidoreductase, dimerisation
FT                   domain; TIGRFAM: dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65904"
FT                   /db_xref="GOA:E4NTF9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTF9"
FT                   /protein_id="ADQ65904.1"
FT                   /translation="MVVGDISTGTEVLVIGAGPGGYVAAIRAAQNGLDTTLVEKDAYGG
FT                   TCLNHGCIPSKAFITASSLAHEAGHAEEMGIHANPAVDMSQLRNWKDGVVDQLTGGVEK
FT                   LCKANGVNLIEGTARFKDDGAVRIEHGGEGQGSETVEFEHCIIATGSRPIQVPGFEFAD
FT                   DAVWSSRDALAADSVPDDLVVVGAGYIGMELSTTFAKLGANVTVVEMLDDVLPGYEDDV
FT                   ARVVRKHAESLGVKFHFGEGASGWSPDGEDVVVETETEDGEISTYRADKVLVAVGRSPV
FT                   TDTLDIENAGLEPNENGFLETDDRMRTDVEHIYAIGDVVADSPMLAHVGSKEGIVAAEH
FT                   IADEPVAYDAQAVPAAVFTEPEIGTVGMTQAEAEEAGFTPVVGKMPFNASGRALTTGHT
FT                   DGFVRIVADEDSGFILGAQIVGPEASELVAELALAIEMGATLEDVAGTIHTHPTLAEAV
FT                   MEAAENAQGQAIHTLNR"
FT   gene            complement(274344..275873)
FT                   /locus_tag="Hbor_02950"
FT   CDS_pept        complement(274344..275873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02950"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase component"
FT                   /note="PFAM: 2-oxoacid dehydrogenases acyltransferase
FT                   (catalytic domain); e3 binding domain; Biotin-requiring
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65905"
FT                   /db_xref="GOA:E4NTG0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG0"
FT                   /protein_id="ADQ65905.1"
FT                   /translation="MAIEEFKLPDVGEGVAEGELVTWHVTPGDTVEEDQVVAEVETDKA
FT                   LVDVPSPYNGTVKELLAEEGEMVPVGDVIITFEVEGEGDEEVAAEAEPETDEVSEEAAE
FT                   TGETETSSGRVFASPSVRQLARELGVDIASVSGTGPSGRVTESDVREAAESDDESAASD
FT                   DGPREVSFSGDDAVSKSGDVGNGEVTTGAASVEAAGREKTLAAPATRRVAEEKGVDINN
FT                   VPASEQRDGQAFVSAEAVHEYAEAQQAAQAADAQALAEEEGAGEAEAAEAAETGPVAGE
FT                   RVPYRGVRRAIGDQMERSKYTAPHVTHHDEVDVTELVELREELKPLAEEQDTRLTYMPF
FT                   VMKAVIAALKEFPFMNSQLDEENEEIVLRDEYNIGVATATDVGLMVPVVDDADGKGLLD
FT                   LSRDMNEKVEKARERKIAPEEMQGGTFTITNIGGIGGEYATPIINYPEVAILALGAIKE
FT                   KPRVVDGDIVPRKVLTLSLSFDHRIVDGAVGARFTNKVKEYLMNPKLLLLE"
FT   gene            complement(275877..276872)
FT                   /locus_tag="Hbor_02960"
FT   CDS_pept        complement(275877..276872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02960"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: Transketolase, C-terminal domain;
FT                   Transketolase, pyrimidine binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65906"
FT                   /db_xref="GOA:E4NTG1"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG1"
FT                   /protein_id="ADQ65906.1"
FT                   /translation="MSQSQQTQNLTLVQAVRDGLYTEMQADDRVVVMGEDVGKNGGVFR
FT                   ATEGLWEEFGDDRVIDTPLAESGIAGTAIGMAAMGMRPVAEMQFSGFMYPAFDQIVSHA
FT                   ARLRTRSRGRYTCPLVVRAPYGGGIRAPEHHSESKEAFYAHEAGLKVVIPSTPHDTKGL
FT                   LISAIRDPDPVIFLEPKLIYRAFRGDVPEDDYEVPIGEAAVRREGADISVYTYGAMTRP
FT                   TIEAAENLEEEGIDAEVVDLRTVSPMDKETIVESFKKTGRAAVVHEAPKTGGLGAEITT
FT                   TIQEEALLHQEAPVERIAGYDVPYPLYALEDYYLPSVARVEEGIRNAVEF"
FT   gene            complement(276876..277979)
FT                   /locus_tag="Hbor_02970"
FT   CDS_pept        complement(276876..277979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02970"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /note="PFAM: Dehydrogenase E1 component; TIGRFAM: pyruvate
FT                   dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65907"
FT                   /db_xref="GOA:E4NTG2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG2"
FT                   /protein_id="ADQ65907.1"
FT                   /translation="MSVLQRDPQDMLRVLDEDGEPVGEVPDLSDDELVRMYREMWMARH
FT                   FDTRAVSLQRQGRMGTYPPLSGQEGAQIGSAFALDEEDWMFPSYREHGAALHRGLPLKR
FT                   TLLYWMGHEKGNRIPEDANIFPVAVPISTQIPHATGAAWAKKLQGEDSAVLCYFGDGGT
FT                   SEGDFHEGLNFAGVFNTPNIFFCNNNQWAISVPRERQTASATIAQKAKAYGFEGVQVDG
FT                   MDPLAVYAATRAAVKKAKDPAEDERRPTLIEAVQYRFGAHTTADDPTVYRDSDEVEQWK
FT                   QKDPIPRLETFLRDTGRLDDEKVDAIQSEVEDEVAEAIKAAEAEPRPEPNEMFTNVFAE
FT                   MTPEVQAQAEAFAELYEEHGDEGFLRE"
FT   gene            complement(278248..279183)
FT                   /locus_tag="Hbor_02980"
FT   CDS_pept        complement(278248..279183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02980"
FT                   /product="lipoate synthase"
FT                   /note="PFAM: Radical SAM superfamily; TIGRFAM: lipoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65908"
FT                   /db_xref="GOA:E4NTG3"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG3"
FT                   /protein_id="ADQ65908.1"
FT                   /translation="MSGRRKPDWLKMRPPSGRRFTDIKQTLRDRDLHTVCEEANCPNMG
FT                   ECWSGRDGPGTATFMLMGDRCSRGCNFCDVQTGGMEPLDPDEPANVAAAVAEIGLDYVV
FT                   LTSVDRDDLPDQGASHFAQTIREIKQRDPSILVEVLIPDFQGDEEAVRKIIDAKPDVIA
FT                   HNIETVERLQWPVRDRRANYEQSLSVLEQVKRESDIYTKTSIMLGLGEYDHEIYQTLSD
FT                   LREADVDVVTLGQYLQPSRTHLDVFEYVHPDAFETWRQVAEDELGFLYCASGPMVRSSY
FT                   KAGELFVDAIVRDGKSVEQARREARTAAGS"
FT   gene            279731..281077
FT                   /locus_tag="Hbor_02990"
FT   CDS_pept        279731..281077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65909"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG4"
FT                   /protein_id="ADQ65909.1"
FT                   /translation="MTVDTMGKPRDMRAFRERQQGRSAEVPKDIERRNAKSVQRSRGAH
FT                   HEASKAGDTKVPDLVRDVISSPGQTLETSIQRTMEERMGDNLGDVRIHTGPLAAKACEE
FT                   INARAFTVGNHIAFNHGEYDLSSAEGQHVLAHELAHVRQQTGGAVSLLPQEGKLEIDPD
FT                   KRLEREAEETAQRVMKGGKLGVYRMHNSKVHVQRFPNDEDVRETTDGVGAHGIQVPEYE
FT                   NLDLEQLFESFEGNRKKAVEQIRQNDDLWTSLLRTIAMDVIQSSIEANGTNVIEDALDR
FT                   YHCNIVQHGHDPVRFMTGEEANEWHLELNPNDERPHKPDCIALEFKPASEDRLYKVTKE
FT                   GRKLGSFLAREETITSEDDREAILDVLGLKEMWSDYDMVSQLSITGEETVSVLSSVVGT
FT                   MTDDSPGVIEREGEPIERPGGEEQLWLSDFFPMEQFEMVGPLDDFQGGK"
FT   gene            281077..281415
FT                   /locus_tag="Hbor_03000"
FT   CDS_pept        281077..281415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65910"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG5"
FT                   /protein_id="ADQ65910.1"
FT                   /translation="MAKIEYDGRELTVGTQTVVLRHKIGQVLEEDGIILVVLSPSQTEG
FT                   RDQRNLLAFDEQGNKLWESEIPEHSERHMFGEIYKENGDIIGWSWNSNEYKIDLETGAL
FT                   ENIGYGGK"
FT   gene            281740..281847
FT                   /locus_tag="Hbor_03010"
FT   CDS_pept        281740..281847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65911"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG6"
FT                   /protein_id="ADQ65911.1"
FT                   /translation="MNWKHRRDRTKAESKKEETKTGTKWSFIAAAVGAA"
FT   gene            281980..284340
FT                   /locus_tag="Hbor_03020"
FT   CDS_pept        281980..284340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03020"
FT                   /product="superfamily II helicase"
FT                   /note="PFAM: Helicase conserved C-terminal domain; Sec63
FT                   Brl domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65912"
FT                   /db_xref="GOA:E4NTG7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG7"
FT                   /protein_id="ADQ65912.1"
FT                   /translation="MKVESVVPEFADAFGFDEFNRMQREAAPAILERDENVVAAAPTAS
FT                   GKTALAELAICRALRNDGTALFIAPLRALTNEKESEWERFEELGYSVYVVTGERDLNPR
FT                   RAERADILVMTPEKTDSATRKHESARYSFITDVDCCVIDEVHLLDSDTRGGVLEVTVSR
FT                   LRRICDPRVVALSATMPNVEDVANWLDAPPETTFEFGDDYRPVDLHAGVKTYSHGENSF
FT                   ADKYRRLYRAIDLSEQHIRDGGQALVFVSSRQDTVRAAGKARDELGKRDIPIGARGDYD
FT                   FHNEAKELSNDSLRKAVPDGVGFHHAGLAKDDRDKVEAWFKEGKIQLLFSTSTLAWGVN
FT                   LPARCVVIRDTKYHDPLEGEVDISPLDILQMLGRAGRPGYDDVGYGWVVCDRSDADKYR
FT                   RLLREGKEIESRLAEDLDSHLNAEIAMGTIGDLEDVMSWLQTTFYYQRARSKPNEYDFD
FT                   GLRERVRETLESLVARGFVEMESDLSIEATRLGRLASKYYLRLDTARRFASLCDRDTIT
FT                   DESILETVAGAAEFHDVSARQSEMDAVDSVLTGVDTTLEDGPRKVLAILYAGMSNSTPS
FT                   DLRSDAWVIRQNGLRLLSALREFVDAFAGPRAANLARRVEARVEHGVSRDAVALTAVDG
FT                   IGPNRASKLATGGLRSPRDVVEAGTAELTQAGLSDGVAKQVVQNARNFPDIDIAWGDFP
FT                   DCIGTGENQMCEVRVRNRAGGATVGIRVTAVAGETGADEAEMTTKRTYLSDETAVHVGV
FT                   FGAPADEVTYRVEVTFPDDPLHPITETRTVRVS"
FT   gene            complement(284472..285122)
FT                   /locus_tag="Hbor_03030"
FT   CDS_pept        complement(284472..285122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03030"
FT                   /product="haloacid dehalogenase superfamily enzyme,
FT                   subfamily IA"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65913"
FT                   /db_xref="GOA:E4NTG8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG8"
FT                   /protein_id="ADQ65913.1"
FT                   /translation="MNVPDEAVLFDMDGVLVDSETYWHQFEDDWVFAAAIESGDPSHEE
FT                   VTGMNYREIYDYLSETYGTTVTKAEFVAAYDDRAQSLYGEQVRLMDGANALFDDIRDDG
FT                   RQLGIVSSAPQDWIGIVRDRFGLDPLDLVLSADDIDKPGKPEPHIYEHAAEAVGLDPQS
FT                   CVVVEDSVHGVEAAVRAGAFTVAYRSTHNAELDLSRAAVVVDGPAELREVLFD"
FT   gene            285198..285935
FT                   /locus_tag="Hbor_03040"
FT   CDS_pept        285198..285935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03040"
FT                   /product="predicted nuclease of the RecB family"
FT                   /note="PFAM: Protein of unknown function DUF91;
FT                   Topoisomerase DNA binding C4 zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65914"
FT                   /db_xref="GOA:E4NTG9"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTG9"
FT                   /protein_id="ADQ65914.1"
FT                   /translation="MSETIRVFAGDCTTTFEGSRSRTQRGRVVVVVKPDRTVLVHDADG
FT                   YQPVSWLTRPDSLTVETDRSGFGLVARADEQVLRIRSHETSGWAEYPASEAGVPVGSHP
FT                   QTGEPLVRVGGAVVGLDTETRYGLPAGATVVDETCDDCGLPKISAECGAVFELCVDRAC
FT                   ESLDDAVRDRFDDEWTCPDCGSPLSIIRRGGRLLAGCSAYPDCETAFSIPAGVVVDDCD
FT                   CGLPVFETARGRRCLDGTCAQFE"
FT   gene            285961..287010
FT                   /locus_tag="Hbor_03050"
FT   CDS_pept        285961..287010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03050"
FT                   /product="tRNA intron endonuclease"
FT                   /note="PFAM: tRNA intron endonuclease, catalytic C-terminal
FT                   domain; tRNA intron endonuclease, N-terminal domain;
FT                   TIGRFAM: tRNA intron endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65915"
FT                   /db_xref="GOA:E4NTH0"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR023516"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH0"
FT                   /protein_id="ADQ65915.1"
FT                   /translation="MSSPGAFSNMDATLHDDVVRVGDDARQRFYDSRGYGRPLDGNRLE
FT                   LAPVEAAHLLSRGDLDDIDGMEFREFLAETGAALAFVVYKDLRDRGFYLSPAREEWPGV
FT                   SDADGIDFVVYPRGKGPTDGDVEYRIRVIGERERVAAASLGDVVLAVVDEDGDLTYFDT
FT                   DDDPDVGGTDDYIPPEGLDADLLSDRVVCYESPDEVYENGFYGQRLFGRNAEEGPLQLS
FT                   LIEGAYLARRGVIDVDDEEVVALARDVEGDRFDRRLKTYAALRDAGSVPKSGFKFGADF
FT                   RVYTDFETVSSLSHSADLVRVVTPDHAFFPRDLSLDVRLAGGVRKRMVFALTDANDGID
FT                   WLSVARLTP"
FT   gene            287007..288623
FT                   /locus_tag="Hbor_03060"
FT   CDS_pept        287007..288623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03060"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="PFAM: tRNA synthetases class I (W and Y); TIGRFAM:
FT                   tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65916"
FT                   /db_xref="GOA:E4NTH1"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH1"
FT                   /protein_id="ADQ65916.1"
FT                   /translation="MIRDDDIETDASVREDARTDGGTSAEGADDVALDPWGSSTISDYR
FT                   KLFEEFGIEEFDEVLSDVPNPHYLMRRGVIFGHRDYRPVAEAMRDGDPFAVLSGFMPTG
FT                   DPHIGHKLVFDEIIWHQQQGGDAYGLIADLEAHSARGMTWEEIDKHARDYLLSLLALGF
FT                   DPEEGELYRQSDNRQLQDLSFELGSKANFSEFEAIYGFDSGTNVSHLQSVVTQMADILY
FT                   PQLDEPKPTVIPVGPDQDPHVRLARDLAARMRFFKVTEAYASFELTDAERDLVASLYET
FT                   LDPADFDDDDLRCVHVAQFLDGVTPEELDVVVDAETISSAQTKLNEAGMEPLRPRVRFL
FT                   DANATDEAFDALVEAIDGEKRRYDEHIDAFDLSFEAADELAREVEVEHGGYGFVAPSSI
FT                   YHRFMTGLTGGKMSSSIPASHISLLDDPEDGYNKVKSATTGGRETAEKQRELGGEADKC
FT                   PVYELYAYLLSGDDDEFAKEVYDECVGGERLCGGCKEQAAELMRAFLEDHQEKREEMEE
FT                   LLDDLDISTDSQRRGVAPSDD"
FT   gene            complement(288682..289650)
FT                   /locus_tag="Hbor_03070"
FT   CDS_pept        complement(288682..289650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03070"
FT                   /product="predicted ornithine cyclodeaminase,
FT                   mu-crystallin"
FT                   /note="PFAM: Ornithine cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65917"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH2"
FT                   /protein_id="ADQ65917.1"
FT                   /translation="MADVRVLSDEQVASLLSLSDLLPEIERAFLKQGRGEVERPPRPHY
FT                   PVGTETPGTALTMPAYVHGDPTYATKLAAVHESNAEKGLPTVNAQIAVTDAETGLPRAY
FT                   LAGTRVTNARTGCIGGLAARELADAPVRLGVFGAGAQARWQTRAIASATNLERVRIYAP
FT                   SESRAQCASDLRERLSDVAVSAVESPDPVLDGSNVVVTATTSTEPVFDGARLEPGTLVV
FT                   AIGAFTESMRELDSETVRRASRLFADVPEEVAETGDFAYVGVDATDLTPFSDVFEAGTG
FT                   RENDAEIVVVASVGSAVLDAVTAGYLYERAETDGVGTVVEL"
FT   gene            289730..290884
FT                   /locus_tag="Hbor_03080"
FT   CDS_pept        289730..290884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03080"
FT                   /product="glycine/D-amino acid oxidase, deaminating"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65918"
FT                   /db_xref="GOA:E4NTH3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH3"
FT                   /protein_id="ADQ65918.1"
FT                   /translation="MHIVIVGGGVVGLSCAHALAERDANVTVCEAGTLGGGSTGRAAGG
FT                   IRMQFSTPVNVDLSVASVPVWESFEERFGVDIDYRKNGYLFLAREAETADDFESNVEMQ
FT                   TARGVPSRTLSPADAAELCPELHTEEFVAATYCPEDGVADPHSAVQGYSQAVTDAGVDV
FT                   RTNTPVTGLDREENENRWRVETPDETLTADYIVNAAGAWARRVGRFADVELPIAPRRRQ
FT                   AAVVEPERELDAMHPLTIDLDSGAYFRPEREGTALVGGHFADSDPDVDPDDFSESADLD
FT                   WTIEAVERAADVAGYFGPETRVRNGWAGLYAVTPDHHAVVDEVRPGFVVAAGFSGHGFQ
FT                   HAPATGQCVAELCLDGAASHVDISSLSLDRFEGDETGLVERNVA"
FT   sig_peptide     289730..289789
FT                   /locus_tag="Hbor_03080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            291220..292731
FT                   /locus_tag="Hbor_03090"
FT   CDS_pept        291220..292731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03090"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="PFAM: tRNA synthetases class II core domain (F);
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65919"
FT                   /db_xref="GOA:E4NTH4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH4"
FT                   /protein_id="ADQ65919.1"
FT                   /translation="MKLPESQVAVLNAASATDATTIGSLAEETGLKPETVTQAAFELRD
FT                   DGYVTVEEREEVEYELTEEGRQYVEDGLPEVRLYRAAVDAGATADPVQMGQVIGASGLG
FT                   GPEVDIALANFGRKGYGSIDSGELAADADADAENDPESTVLTTLADGEAVEDADEETLD
FT                   QLVSRNLVERHEETVRSVTLTDDGVTLLMEGVETAETVDRLTPEMLTSGEWEDVEFTEY
FT                   NVEADAPEVRTGKTHILRQTADRVKDVLVGMGFQEMEGPHADADFWINDCLFMPQDHPA
FT                   RTHWDRFALDVPPIEDVPEDLVDRVEDAHRNGVGPDGDGYHSPWSEDFARAIALRGHTT
FT                   SLSMRYLSGHEVGDLESPQRYFSVEKVYRNDTLDPTHLLEFYQIEGWVMADDLSVRDLM
FT                   GTFEEFYEQFGITDIQFKPHYNPYTEPSFELFGRHPETGELIEIGNSGMFRDEVLEPLG
FT                   VECDVMAWGLALERLLMLMYGFDDIRDVHGTMSDLELLREVEVLR"
FT   gene            292731..294509
FT                   /locus_tag="Hbor_03100"
FT   CDS_pept        292731..294509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03100"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="PFAM: tRNA synthetases class II core domain (F);
FT                   tRNA synthetase B5 domain; B3/4 domain; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65920"
FT                   /db_xref="GOA:E4NTH5"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH5"
FT                   /protein_id="ADQ65920.1"
FT                   /translation="MPVVDVHPDELRDLTGHEEKSDEEFKDDLFALGLEFEGETEDGAF
FT                   QLEFGPDRLDRLSVEGVARSLRYQYGDARGVYVPKTNDPDFTFVVDEDVPDERPYVTGA
FT                   VIRGVDLDDDALDSLIQLQEKLHATMGRKRAKGAIGIHDLTMLKGDALSEDSDGNSITY
FT                   TGIDPEGDTFVPLDADAEMTPARVLEEHPTGQTYADLVSEYERYPAIYDELGLFSFPPV
FT                   INGRRTEVTTDSRELLVELTGTDQWTIDRMCNIICYALDARGATIEAVEVEYPDGTYVR
FT                   PDFEVETKHVSHDRIETMLGVDLEPREVVDLFERSGLDADADDGADAGDGSDTTEAGGE
FT                   NATDAESDDLVYEVSIPPYRVDVLHPLDLVDDVGRAYGFNELQPRYPNVGTVGGRHERS
FT                   RLEDAARNSLVGLGFEDMLNFHMTSEEEVYDRMGIEAGSEVLGGGDTAEITGPYSEDYT
FT                   ILRTWALPSLMMVLENNTHRAYPQDLAEIGLVAERDDSVNTRVDERRHVAGVLARHDAT
FT                   FEDAKARLQSLCRDFGAELKTPATDHPSFIDGRAASVVVDGENVGVVGEIHPRVLVEHD
FT                   LELPVAAFEFDLDALR"
FT   gene            294765..295967
FT                   /locus_tag="Hbor_03110"
FT   CDS_pept        294765..295967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03110"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65921"
FT                   /db_xref="GOA:E4NTH6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH6"
FT                   /protein_id="ADQ65921.1"
FT                   /translation="MNDSDYQFETLAVTHGERQRPAEGVEDVAVPVHLASTFAVPEIDP
FT                   DASLESLDPDAGEYLYSRLSNPTRNALEHRIAALCGGDHALAFASGTAAIVTAISAAVQ
FT                   PGDHIVAFDDLYGGTKSMLSDLFEDRLNVSVSLVDARDTDTVAAAMREETSLVWMETPT
FT                   NPLLRLCDIEAIAAIADEYGATFGVDNTFVGPHFQRPLELGADVVVHSTTKYLNGHSDS
FT                   IGGALATNDEAYAEEMTFLQRVGMGNMLAPFDAYLTLRGLKTLPLRMEKHASNAQAVAE
FT                   FLADHPAVEAVHYPGLESHPQHDLASRQMSGYGGVLSIELDTDLDGVARFVAALEHFPL
FT                   AVSLGGVESLIEHPASMTHSPLSQEERDMLGITDSLLRLSVGVEHEADLLSDLSDALDV
FT                   I"
FT   gene            296103..298715
FT                   /locus_tag="Hbor_03120"
FT   CDS_pept        296103..298715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03120"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="PFAM: tRNA synthetases class I (I, L, M and V);
FT                   Anticodon-binding domain; TIGRFAM: valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65922"
FT                   /db_xref="GOA:E4NTH7"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH7"
FT                   /protein_id="ADQ65922.1"
FT                   /translation="MPSGEYDPETVEAKWQDRWVDEDTYSYDDSAVDADTAFSIDSPPP
FT                   TVSGSLHWGHAYGFTLQDFVARFNRMRGKEVFFPFGFDDNGIASERLTEDELDVRHQDY
FT                   DRREFQEMCREVCEQYEAEFTEKMQNLGISIDWDQTYQTISPEVQRASQLSFIELYDDG
FT                   REYRQRAPAIWCPECETAISQVETEDDEQGSHFHDIEFEVVDSEEEFVISTTRPELLPA
FT                   CVAVFVHPDDEENQHLVGEEARIPLFGQEVPIIEDERVDLETGSGIVMCCTFGDQTDIE
FT                   WYQAHNLDLRIAIDESGTLTDVAGEYEGLSSEEAREAIVSDLDDDGALLDKRAITHTVN
FT                   VHERCGTGVEFLVKDQWYVELLDKTDEYLEAGREMDWYPEKMFTRYKNWIEGLQWDWSI
FT                   SRQRSSGIPFPVWYCDDCEHVVVAERENLPVDPLSDDPPVDTCPECDHDEFVPEDDVFD
FT                   TWATSSLTPLINAGWDWDEDAEEIVIDREELYPFDVRPQGHDIISFWLFHTVVKCYEHT
FT                   GEVPFDSVMINGMVLDENREKMSKSKGNVVSPDEVMSKYPVDAARYWAAGSAVGDDLPY
FT                   SEKGLRAGEKLLRKLWNASKLVDSLSEDAPESFDHDDLKQIDRWLLASLDREIEHVTEK
FT                   LQNREFSKARDDLRSFFWNTFCDDYLEIAKQRVRESDDESAKYTLRTAHRRFLKLFAPI
FT                   LAHVTEELWREMHEETSVHRASWPEPLGLEADFEAGETAMAVVGALRKYKSDNQLSMNA
FT                   PIDLVQVYGDVQDFEADISGVMHVEEMETLAEEPQIESVVTGVDLDYSLVGPEFGAQVP
FT                   DIEAALEAEEYEVGDGHLHAAGVELAPEMFTIEEERKYMGDGEMLEAGDAVVIVQHEN"
FT   gene            complement(298760..300046)
FT                   /locus_tag="Hbor_03130"
FT   CDS_pept        complement(298760..300046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65923"
FT                   /db_xref="GOA:E4NTH8"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH8"
FT                   /protein_id="ADQ65923.1"
FT                   /translation="MRRPSIHDSGVLAVLASNAVAPLGIFFLGWSTTVLFGVFIAEIAV
FT                   VLFWSMVKMPFAAKRPNNALGERGLFGPLQTKRGSTSLPGPLPPVYLRNVPSVVIAAFL
FT                   LAPLELAVALGVFGLADPTITDETGGRILVGGLSVFIGHGIEMAAHYFGNGEYRNHSPR
FT                   SLLLLPFKQLFAVAILLFAAIPFEESPGSDAFVAVVVAGKFLYDLRTLQLEHDDDKRGI
FT                   FYRLYGSEETEILPVPVSEPTGEPVHCDRTNRWVAVADALYRGVRYTFTSVVLLFYAIA
FT                   AALALFGGDLVVVLIPITVAGVFAGVKAISRYLRYGTVEYRCYGDVLVVYDTLLDEPQA
FT                   RLERGAVTDLTITTDAVDRLFGTETMAFDTDEDDSPDVQLTVPDPAEINGDDANENHPL
FT                   TYPHVENPEAVADAFGVAWRLTSESDERR"
FT   gene            complement(300119..301177)
FT                   /locus_tag="Hbor_03140"
FT   CDS_pept        complement(300119..301177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03140"
FT                   /product="dihydroorotate oxidase A; dihydroorotate oxidase
FT                   B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: Dihydroorotate dehydrogenase; TIGRFAM:
FT                   dihydroorotate dehydrogenase, subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65924"
FT                   /db_xref="GOA:E4NTH9"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTH9"
FT                   /protein_id="ADQ65924.1"
FT                   /translation="MRLLYRILKPALFSLPPETAHGLVHHGLRTVQHTPIEDALATRYR
FT                   VEDDRLHTEAFGCSFDNPVGVAAGFDKNAEVPDVLGSLGFGHVEVGGVTAEPQDGNARP
FT                   RMFRLPEDGAIINRMGLNNEGADAVGARLAAGPRADIPVGVNLALSESTDAEDAPADYR
FT                   YTYEQVADAADYVAVNVSCPNSEGFRDLQNRDSLEAILGGLVDAGADPLLVKLSPDLPD
FT                   PAVEDALDVVNEYGLDGVVATNTTTDRPAELQNPNRAERGGLSGAPIEERATEMVRFVA
FT                   ERTDVPVVGVGGVASAEDAYAKIRAGASLVQLYTGLVFEGPTLTRDINEGLLTLLERDG
FT                   FDSIDEAVGADL"
FT   sig_peptide     complement(301112..301177)
FT                   /locus_tag="Hbor_03140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301238..301435)
FT                   /locus_tag="Hbor_03150"
FT   CDS_pept        complement(301238..301435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65925"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI0"
FT                   /protein_id="ADQ65925.1"
FT                   /translation="MVRKKKLSPSGAKDENGEYHNVHVNLHEDELAVAGMEIGDEVFVR
FT                   VRDGKIIIQKADPDEVEHDF"
FT   gene            301652..301966
FT                   /locus_tag="Hbor_03160"
FT   CDS_pept        301652..301966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03160"
FT                   /product="nucleoid protein MC1"
FT                   /note="PFAM: Non-histone chromosomal protein MC1"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65926"
FT                   /db_xref="GOA:E4NTI1"
FT                   /db_xref="InterPro:IPR008674"
FT                   /db_xref="InterPro:IPR036620"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI1"
FT                   /protein_id="ADQ65926.1"
FT                   /translation="MVREDGKRNFVLREENGTESSVFSGSMPRQAALKAARRLDPVDSE
FT                   DKAREQATEIRLREKGTDKVHIFDAWAWVDDAPDDKPDWMEGDITKGNVSKQGIEHLEE
FT                   "
FT   gene            302740..304218
FT                   /locus_tag="Hbor_03170"
FT   rRNA            302740..304218
FT                   /locus_tag="Hbor_03170"
FT                   /product="16S ribosomal RNA"
FT   gene            304309..304380
FT                   /locus_tag="Hbor_03180"
FT   tRNA            304309..304380
FT                   /locus_tag="Hbor_03180"
FT                   /product="tRNA-Ala"
FT   gene            304610..307519
FT                   /locus_tag="Hbor_03190"
FT   rRNA            304610..307519
FT                   /locus_tag="Hbor_03190"
FT                   /product="23S ribosomal RNA"
FT   gene            307652..307774
FT                   /locus_tag="Hbor_03200"
FT   rRNA            307652..307774
FT                   /locus_tag="Hbor_03200"
FT                   /product="5S ribosomal RNA"
FT   gene            307938..308013
FT                   /locus_tag="Hbor_03210"
FT   tRNA            307938..308013
FT                   /locus_tag="Hbor_03210"
FT                   /product="tRNA-Cys"
FT   gene            308202..309059
FT                   /locus_tag="Hbor_03220"
FT   CDS_pept        308202..309059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65927"
FT                   /db_xref="GOA:E4NTI2"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI2"
FT                   /protein_id="ADQ65927.1"
FT                   /translation="MQRRAAAIYVALFIVIGAASYSLVATAEAPHIEFQNPAYDLSSGD
FT                   SFEVGSQTYSVTEITAEVESGGHGGGSTLVRSGALQYTNQSARYTETWENNSTVTIDDT
FT                   EWTVLVSGEENETEFTLREDINETTILKQDPNASNEMVTHNGKQQVVLQENGSERLVPA
FT                   SEYFPEPQSQTYSEGNTFEYNGNETTVGAVTTEAVEISWTAPRTNSIDVANEGNVTLGE
FT                   QKYLAHFPDNETMKLTQDYESYRTQQEEIETFHTRESGLWGVSILSLLAIVFLVGFAYM
FT                   PSRY"
FT   sig_peptide     308202..308282
FT                   /locus_tag="Hbor_03220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            309189..309692
FT                   /locus_tag="Hbor_03230"
FT   CDS_pept        309189..309692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65928"
FT                   /db_xref="GOA:E4NTI3"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI3"
FT                   /protein_id="ADQ65928.1"
FT                   /translation="MVGVRHVGGVVVTRRIGHSVPSQRILAVVSAALLVVAHLGLAVGW
FT                   SVERLRRVLSMLAGVFLTVVSGSRTADRTSIPDIGRTVEMTAHAAPWPLAGKLTCLRVA
FT                   LVAHVLYEQFGVDADIRFGVMRKSGVFEAHAWVECDGAVVTGDVSNLDAYAVLEGKQGV
FT                   RAVR"
FT   gene            complement(309737..310003)
FT                   /locus_tag="Hbor_03240"
FT   CDS_pept        complement(309737..310003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03240"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65929"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI4"
FT                   /protein_id="ADQ65929.1"
FT                   /translation="MTGDVPDGLREMPPSSKLVYKVLEHDGPLTQRQLADHSLLPTRTV
FT                   RYALDRLEEEGIVKEKLYIQDARKRLYHLSEDERVPNTNPIPN"
FT   gene            310235..310588
FT                   /locus_tag="Hbor_03250"
FT   CDS_pept        310235..310588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65930"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI5"
FT                   /protein_id="ADQ65930.1"
FT                   /translation="MSDRTDDIDQTHSHDIDDTPSVTCSRCDREWDLSYELDDLEVGNQ
FT                   SFEQFALDHMRHTGHFPDGISPWIVSCRHCPEGEEFLAASAAQRWAKTHARHTRHSIEV
FT                   AHADEETTVVSPE"
FT   gene            complement(310736..311023)
FT                   /locus_tag="Hbor_03260"
FT   CDS_pept        complement(310736..311023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03260"
FT                   /product="translation initiation factor 1A (aeIF-1A)"
FT                   /note="PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: eukaryotic/archaeal initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65931"
FT                   /db_xref="GOA:E4NTI6"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI6"
FT                   /protein_id="ADQ65931.1"
FT                   /translation="MSEESSGRRNLRMPSDDELFAVVTQHNGGNHVRVRCQDGKERMGR
FT                   IPGRMKYRTWINEGDVVLVEPWDWQDEKANIEWRYSEQDAEQLRAEGHID"
FT   gene            complement(311112..311789)
FT                   /locus_tag="Hbor_03270"
FT   CDS_pept        complement(311112..311789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03270"
FT                   /product="methyltransferase family protein"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65932"
FT                   /db_xref="GOA:E4NTI7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI7"
FT                   /protein_id="ADQ65932.1"
FT                   /translation="MPRRTTTLYGGRANGRAVDSNDVHRRWTARSGAYSPEYYAYYGPN
FT                   ETSELLKETISQHAEPDAAILELGCSSGRHLAHLFDHGYENVSGVEINAEAFDVMDEEY
FT                   PELSDAGTFYHDAIESVVRKFEDDAFDVVYSVETLQHLHPDAEWVFDELARITETLLIT
FT                   VENEGEHSDAGGTADDEPSVNYVDGEVPLYYRDWNAVFTDVGLTEIESKSMDRDMFRSF
FT                   TPT"
FT   gene            312081..313793
FT                   /locus_tag="Hbor_03280"
FT   CDS_pept        312081..313793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03280"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65933"
FT                   /db_xref="GOA:E4NTI8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI8"
FT                   /protein_id="ADQ65933.1"
FT                   /translation="MVGDNENVRRRRFLKATTAGGLAGMTALAGCSGGDSTPEETDGGS
FT                   TGDSSDGETSGESGGSGERLPTYTYVNNSQSYNPPRHDAINLIARQLNDIGLDVEVDVL
FT                   EWGTLYNRVSVEYDYSFSTWHTFFTIDPVLELSSTMHSSNTGKGDGNYAGYENPDVDEL
FT                   LDGYMSEPDEAKRVDMVHEAQKTLMDDVPQMPITHMPAAAIYNKNQVGNWQSELSLGFN
FT                   SYWTMVNLEMKNGETQLKGYWPETLSTMNVLGHNDESKHTYQFTMMYDTLVRLDNEGKL
FT                   NADVSLATDWTRVDETTMEYTIRTDHAWHDGEDLTTEDVAFTYNYIAENEVPLYSVQTQ
FT                   YIDSAEAVDDSTVRINMSQALGPFHTLVGTQIPILPKHKWERRSNPSQANVEEPVGSGP
FT                   LMFDYWNKGTEFGLKKFADHFAPVDFEQRYWRIIPEASTVWELLKNGELNYEPFGRIDR
FT                   SLNENQDHEAIGTKFEPATTFWHFTPNERQTGLDDPVLRKAAVNAIPRTPIVKQILFDF
FT                   PQKGFDIVSPAFGPLHTEEVTRYEESKEKARSRLKEAGYSWTDDGMLQTPADD"
FT   sig_peptide     312081..312182
FT                   /locus_tag="Hbor_03280"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            313857..314834
FT                   /locus_tag="Hbor_03290"
FT   CDS_pept        313857..314834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03290"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65934"
FT                   /db_xref="GOA:E4NTI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTI9"
FT                   /protein_id="ADQ65934.1"
FT                   /translation="MGKASFVIRRSLQLVATFWAVGTVLFFLFRLMPGNPTSFVISPQM
FT                   TPEARRQIIESYGLDEPMHVQYVKFLQNAITLDFGQSFHSNAPVEDVILTYLPNTLVLM
FT                   LTAFVIAYAFGITLGVLSGWYRGSRFERSTVITALLARSVPSFWVGLMVLWVFGSMFNL
FT                   IPMAGMTSPGVEHENFLTMVLSVDFLKHLVAPALVLAYYFMGYPLLIMRSSMLEVLSED
FT                   FIDVCRAKGLKERTIMFKHAARNALLPIVTAAAIALGYAVGGSVLIETVFAWPGIGREM
FT                   VRAVLRRDFPVAQGTFMVLAATIILLNFVADLAYGYLDPRVTYD"
FT   gene            314838..315818
FT                   /locus_tag="Hbor_03300"
FT   CDS_pept        314838..315818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03300"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65935"
FT                   /db_xref="GOA:E4NTJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTJ0"
FT                   /protein_id="ADQ65935.1"
FT                   /translation="MAQEESTRSSVFADIEEVSSNEEINKWARTARLWQETLKRQWTLL
FT                   TDELSVKLSMLMVAFFVLVAILAPYIAPNPPLERQYQTADEILIAKWAEPSILGGNSEY
FT                   ILGTTAQGFDIFSQLIFGTRAALLVGLIAAVFTAGIGTMVGLVAGYYGGAVDDALMRLV
FT                   DFLYGMPLLPTVIILVALLGPNLWNIILAVIILQWRATARVIRSQALSLRERPFVKAAQ
FT                   VAGASDWHIISRHLAPNVLPMSFLYGSFAIAWAILTEAGVSFIGLGDPNTVSWGTMLQA
FT                   ARAYSALSFGAWWWFVPPGVCIGLLVISGFLIGRGYEEITNPKLQ"
FT   gene            315815..316852
FT                   /locus_tag="Hbor_03310"
FT   CDS_pept        315815..316852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03310"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65936"
FT                   /db_xref="GOA:E4NTJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTJ1"
FT                   /protein_id="ADQ65936.1"
FT                   /translation="MSLLEVEDLEVYYETDEGPAQAVDGVSFSLEAGENLGIVGESGCG
FT                   KTTLAKALIGILPNEGYVNAGRIEFKGDDLTEMSDSERRRLKWEEISMIAQSAMNSLDP
FT                   VYTIREQIVEAIETHRPGTGRVESTEIVTEMFELVGLDPDRADDYPHQFSGGMRQRAMI
FT                   AMALALEPSLILADEPTTALDVIMQDQILKRISQIQDEIQSSMLVITHDVSVVAETCDR
FT                   VLVMYAGKVAEEGPVEEIFNQPYHPYTIGLKRAFPNIRQPEQDLLSIKGYPPELVDPPT
FT                   GCRFAARCPMATDRCREEEPKAHRINGLRSYCHYAEDIDTELRPHADRSETWNQTEAAQ
FT                   QAGGD"
FT   gene            316855..317985
FT                   /locus_tag="Hbor_03320"
FT   CDS_pept        316855..317985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03320"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65937"
FT                   /db_xref="GOA:E4NTJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTJ2"
FT                   /protein_id="ADQ65937.1"
FT                   /translation="MAIDASPDDVPTKDDDVLLHVENLHKHFKVDEGWIASILQSVSGD
FT                   DPDYVHAVDGVSFDLRRGETLGLAGESGCGKTTTGMSLVKLHDATDGDIYYNGKSLGDA
FT                   TDAELKQFRQNAQMIFQDPFESLNPRMTVYDTVAEPLRIHNIANETARVQRALEFAELL
FT                   PAEQYFDQYPHELSGGQRQRVAIARALVLDPDFIVADEPVSMLDVSLRAGVLSLLERMT
FT                   EEFGLSVVYISHDLSLLRHMCDRLAIMYMGKIVEKGPTDQIIENPKHPYTQSLINAVPV
FT                   PEPSVGRERVELQGEVGDVIDIPSGCRFKSRCPEYIGDVCDEVVPPLEEKSDIEGERAV
FT                   ACHLYEDLHGTDPAAAFKSGPTSNVDTGSESTPADD"
FT   gene            complement(317994..319448)
FT                   /locus_tag="Hbor_03330"
FT   CDS_pept        complement(317994..319448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03330"
FT                   /product="predicted Zn-dependent protease-like protein"
FT                   /note="PFAM: Putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65938"
FT                   /db_xref="GOA:E4NTJ3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTJ3"
FT                   /protein_id="ADQ65938.1"
FT                   /translation="MDGERDEPIAAMEWLLDRFEGDDDVAYAEVGALSQTKTDLVLTEN
FT                   GPRDELSFDETGVWCRVFADGAADYRYTTSLDEETLADVADRAVRGGEFLAQDDSARYD
FT                   RLTTHQAVHDGWASGRIDDVALETKRSTLESGLAAVADAVERCWINYDDAHIDSTAATT
FT                   TGSTVRTTLDRANVTVTLSVRDGPTVRRHAGSTRGAVFLEELADVFADAAADVRTLANA
FT                   ETAAAPTGETTVALTPRAAGQLFAFAARYLEADTHYMGLSPYDVGDEFGPDSLSVADTV
FT                   HAGSWAARAYDAELRPTTPVQLIEGGTVTRLLHNTASAAEDDAFPAGHAVHSLGFDQPP
FT                   RIHARHLDVAPGDANRATLRAGADVLVERFDDPWLRDEFERVQRSGVMPASALYAKDID
FT                   RKTEDRTACGQATFPIAEGYRLRDGERDGRVAGVSLAYGPETLRSITAIGAVRGTLTGV
FT                   DEKHKSRVPYAVTAPGVRLRATLQKE"
FT   gene            complement(319540..319782)
FT                   /locus_tag="Hbor_03340"
FT   CDS_pept        complement(319540..319782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65939"
FT                   /db_xref="GOA:E4NTJ4"
FT                   /db_xref="UniProtKB/TrEMBL:E4NTJ4"
FT                   /protein_id="ADQ65939.1"
FT                   /translation="MPNSRLRRNGWATVGLGLSIAFAVGAFVYFALAGSPLRGAALGVL
FT                   VAAAGVWEYRRKIQDTVVAESYESEAEAQTRKNRR"
FT   sig_peptide     complement(319684..319782)
FT                   /locus_tag="Hbor_03340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(319851..321035)
FT                   /locus_tag="Hbor_03350"
FT   CDS_pept        complement(319851..321035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03350"
FT                   /product="ferrichrome-binding protein"
FT                   /note="PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65940"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP4"
FT                   /protein_id="ADQ65940.1"
FT                   /translation="MAKNDTECGKSTRREWITYGGAVLAGGLLAGCTGESEGNTSPTAD
FT                   TETETAEESGSYTVSMEPVGELTFESVPDRWVAYDGGYADMGVALGKTDGMTGIGGSDR
FT                   YYTDVYDELPGVSVERETLEANDLGDADMSKEVFYELDNDVHLMDPQMLVNWFGWSETD
FT                   VDEIATNVGPFFGNLIFRREDKWHDYRYYTLYEAFEKVAQLFQEEERFNAFQSLHDEFI
FT                   AEIQRQLPPADERPNVLLVYEGSDEPETFSPYRLNDRGTSKKQWRDLGVSDALSGTGIH
FT                   GISTTDRGRIDYETMLEIDPDVIMLRAHERKSATEFRETVLEFMRDHPVGSELTAVQNG
FT                   RVYRGGYLYQGPIHNLFLTERGAKQLYPDVFGDVTSDEKLFDRQRVADIVTGEF"
FT   gene            complement(321249..322550)
FT                   /locus_tag="Hbor_03360"
FT   CDS_pept        complement(321249..322550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03360"
FT                   /product="hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing); cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65941"
FT                   /db_xref="GOA:E4NKP5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP5"
FT                   /protein_id="ADQ65941.1"
FT                   /translation="MDGFVLAGTKSGVGKTVATLAIVQALQDDGYTVQPAKAGPDFIDP
FT                   SHHERVAGRPSRTLDLWLEGDDGVRRNYHRGDGDICVVEGVMGLYDGDCSSTAMVADAL
FT                   DVPVVLVVDAKAGMESVAATAHGFREYASHAGRDIDVAGIIAQRAHGGRHEDGIKEALP
FT                   DGMAYFGRIPPRSNLEIPDRHLGLHMGEESPLEPDALSEAAETIRTDRLVDAAREPPRP
FT                   AQREADKRTETGSRVAVASDAAFCFAYPATIERLRERAEVVTFSPIAGDNLPDCDGVYL
FT                   PGGYPELHGSELEGSPTLDDIAARAADGLPVIGECGGLMALTESLTTDEGTYEMAGVLP
FT                   ADVQMCDRYQALDHVELRAKTDTLTASQGDRLRGHEFHYSSADVASDARFAFDVVRGSG
FT                   IQDSSDGLTEYRTLGTYCHLHAESGAFDAFTANL"
FT   gene            complement(322550..323338)
FT                   /locus_tag="Hbor_03370"
FT   CDS_pept        complement(322550..323338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03370"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65942"
FT                   /db_xref="GOA:E4NKP6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP6"
FT                   /protein_id="ADQ65942.1"
FT                   /translation="MSEDDPYDLDSGPDPATFAAAEPEPPIEEANNPVYGVGIGPGNLE
FT                   YLTPRGLRAIQEADVVVGFQTVVDFVADETDADLLTCGYADEADALNEFAERVADGERG
FT                   TAVLMGDPNHSGYQFLGKVQQVVERPVKAIPGISSLQIAASRARTPMEDTRFVTLHKSG
FT                   SLDADLDRLTEVVGERHLLVLPRPFDWMPGDIAKLLLESGADRSLEALVLERLTHDDEQ
FT                   ITRTTLGELRESAGGSGPESTPYSDLSVLAVRAPVTLEDD"
FT   gene            complement(323331..324011)
FT                   /locus_tag="Hbor_03380"
FT   CDS_pept        complement(323331..324011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03380"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="PFAM: Precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65943"
FT                   /db_xref="GOA:E4NKP7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP7"
FT                   /protein_id="ADQ65943.1"
FT                   /translation="MTEKEDYADLGATTQEAMEIAETSMDIVRTFVPDETLNDRLRQKA
FT                   VHSTGDIEFQHLIRCQNNPAVAGARAVLDEQPIVTDITMAKAGITGRGHDCPVKKAIGN
FT                   GAELAAETGMTRTAASVLELDKQGVYDGAIAVVGNAPTGALALADCIEDGTRPAAIVAT
FT                   PVGFVKAEESRKRVRDIADEYDIPAVTNVGKRGGSGLAAALTNELIHVASDVRDGDVDL
FT                   SDHE"
FT   gene            complement(324004..327822)
FT                   /locus_tag="Hbor_03390"
FT   CDS_pept        complement(324004..327822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03390"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/Magnesium Chelatase; TIGRFAM:
FT                   cobaltochelatase, CobN subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65944"
FT                   /db_xref="GOA:E4NKP8"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP8"
FT                   /protein_id="ADQ65944.1"
FT                   /translation="MPTIGLYTATENELGAVQQAAQRLDGIDFVVRSSGDLDEVTDVDA
FT                   FIDEVESATAVVLWLHGDEDSMPGYDHAVERLSEAGVPLVVKSTGDAFALRDTSVSDAD
FT                   RERAVEYLERGGVVNIENLCRFLAAEYDDFDTDVEDPVSLPTEGVYHPDYPGIEYEELR
FT                   ETFDPDDPTVGVWFYESHWTHANTRYVDALVRRLESLGVNVLPAFCNPATDEEGQENAE
FT                   WVARNWFSDDDGPIVDAVVSSFMFSLSMSERGRDAADEGDDAEDVFLTELGVPVLQAIT
FT                   TMRSRSRYEGSDTGVMGFELALSVALPEFDGNVITHPISGKERMEDEAGVGSAPKQHFP
FT                   IEDRIDHVARLAVNWANLRYLPNDEKKVAVVLHNYPPSDDGIGTAFGLDTPASTVNLLH
FT                   ELDSRGYTVGDPPTDGQSLIDDLTSQLTLDDRWVAPEDVRDLSVDVVSPDQYEDWFEAT
FT                   DERFQDHLIEEWGEPPERPFAIPGVEFENVLVTVQPPRGFGMDPSKVYHDSDLQPPHDY
FT                   LAFYAWMREEFDADAVVHLGTHGSLEWLPGKTVGLNAESAPDQLVGDLPNVYPYIVNNP
FT                   GEGTQAKRRSYAAIVDYLTPVMRTAGTYDDLSDLEELAREYREAGMDEARPDRGEHLRE
FT                   LVLEAVDDLDLAVELGFEDLDDVHDLETTEFDELVERIHEYLTDVKTTQIRMGLHTMSE
FT                   PPADDRLVEYLVALTRLPNADTPSLRESVAGVMGVDYDRMRDEPGAYDEALGMYLSEAA
FT                   DHVYDQCVELVETLAEHDFDVPESEVEADADDEVNMNLLVVDIDQLGDAKAKRGAHDDL
FT                   REVLAFICEEAAPRVAAAADEIPQTADALDGEYVRPGGSGAPTRGGVDLLPTGRNFYTL
FT                   DPRKVPAKPAWDVGKRVAEGVLERHYDDHDEYPEEFGVVAWGTPTVRTRGETIAQVLAF
FT                   MGVEPVWTDAGRIDDVEPIPLDELGRPRVDVTTRVSGLFRDAFPQAASVINDAVDAVVD
FT                   LDEPHDMNYVKKHVEEDTAELEDDGVDEGDAEKLAKHRVFTTTPGGYGAGTNKAVDEGE
FT                   WDDRSDLADVYVQWGGYALGSRGRVTEAHDAFERRLSGVEATVKIEDTAEQDEFDSSDW
FT                   YAFHGGFVSAVGEISGSDPASYVGDSSDPDNPQIYTNEEKVRKAMRARVLNPDWLDSME
FT                   EHGYKGAGDLSTTVDVTLGWDATTGVISDTLWENLADAYAFDESRQEWMRDVNPWALES
FT                   ITATFLEAIDRGLWDADDDIEEQLRDINLSVEGDLEANTTTVTQSND"
FT   gene            327871..330087
FT                   /locus_tag="Hbor_03400"
FT   CDS_pept        327871..330087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03400"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="PFAM: Magnesium chelatase, subunit ChlI; von
FT                   Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65945"
FT                   /db_xref="GOA:E4NKP9"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKP9"
FT                   /protein_id="ADQ65945.1"
FT                   /translation="MSAETLPFPAIVGQEELKRALLAVGVNEQIDGLLVRGEKGTAKST
FT                   AVRALTDLLPEQTVVAACPYGCPPDDPTRQCDSCRERDDYDVETRPVPLVTLPLGATRD
FT                   RVAGTLSVSDALAGDASFDPGLLARANRGILYVDEVNLLEDHLVDLLLDAAASGVNRVE
FT                   RDGVSVEHPAEFTLIGTMNPEEGDLRPQLRDRFALQATVTGCRSVEDRVTIIDRALDGS
FT                   HDARNTDGGDTDGVSNEAGLAADQYDDAVATLEQDVRTAHNRLERVTLPTDFKVEIAEL
FT                   CLDAGVEGHRADIAIARTARTLAALDGRTKVIGGDVRDAAELALPHRLRSRPFDDAPDT
FT                   DDVLDDHFEDESDSGESGDGETGDDADTGDDEPGDGEDSADGETGGDTDASDADGTDSD
FT                   TGDGDESGAADDDSDGSQRPDRTGSSDDERTAEESEAETAADDDQRGDSPDEDGSSDDE
FT                   GDGGDEDGNPDEATPLLPGQQRAAVGAADEPPVDDTALRSETPGEGTRATVGESRHGRG
FT                   SRVRTEPATNTDDIDVPASVRAAASNGRTQIDRSDLRTSVNRGTARTLIVFVVDASASM
FT                   RPAMRETKGTVMSLLEDAYQQRDEVAFVAVAGDEAEVVLPPTDSVSLAARHLKQLPAGD
FT                   RTPLPSGLDAAHRLVTRADADSSLVVVVTDGRANVADGSPTAATRSAARHLATSDASVV
FT                   LVDAGDDGTGLTDILESETGARRISLADLSAERVSEAAASVHDA"
FT   gene            complement(330130..331344)
FT                   /locus_tag="Hbor_03410"
FT   CDS_pept        complement(330130..331344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03410"
FT                   /product="PQQ enzyme repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65946"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ0"
FT                   /protein_id="ADQ65946.1"
FT                   /translation="MAAFTNRTELGDLEAAASRHNWARSAVAAAAGRVFVGTNDGQVSA
FT                   FDSALDSELWSADGATSVVSMAATDDCLVVGERGEDSSLRVLDPETGERRWEYATTDDI
FT                   GTATKESLFFYPYVVDVAVTDDRVIAAARRYERDGDERVWSSVVLGFDRDGAVQWRYRV
FT                   GASPIALTVENGRVAVAYNRCPKPDQDGLVVLDSETGDTLTTWDPDTDEDRRVGDVAFA
FT                   DGDIAVCCHGDKRGYLLDSDGHEQWGFDLATKQDIDGETVYAYPNHVCVADGVAVFVTG
FT                   NTFAESTRDPDARHPDEHTAFAVENGEQLWTHSNGGFARAARSSDGRAIIPSAQNFRRR
FT                   SAETHGVHTFDAEEGHVETDSIAGIPTAVAVGDDVLAVVEEPVEYHDEGVTHGAYRLHT
FT                   RPATR"
FT   gene            complement(331353..331730)
FT                   /locus_tag="Hbor_03420"
FT   CDS_pept        complement(331353..331730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03420"
FT                   /product="Protein of unknown function (DUF3209)"
FT                   /note="PFAM: Protein of unknown function (DUF3209)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65947"
FT                   /db_xref="InterPro:IPR021577"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ1"
FT                   /protein_id="ADQ65947.1"
FT                   /translation="MACAELEALRLALMNITGTVDEGVKQHAEAELEGYLDEPGPIQAL
FT                   AEASTLDEAQRHLDAALVELEEEAMQADDDDPQSGYLRGRVVAVRDAQRTLSRLRGQTD
FT                   SFLEDLGEAHHTLHETFPVEE"
FT   gene            complement(331733..332947)
FT                   /locus_tag="Hbor_03430"
FT   CDS_pept        complement(331733..332947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03430"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit; CbiX"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65948"
FT                   /db_xref="GOA:E4NKQ2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ2"
FT                   /protein_id="ADQ65948.1"
FT                   /translation="MRTEQPSLDDDAILLVGHGSRREKSNEQVRTLAGKLETELSVPVD
FT                   AAYIELAEPSIEDAIETLAPTCRTLTVIPLSLFAASHVKNDVPMAVQTARTKYDDVTFH
FT                   FGSHLGIHPSIVDLLDDRIRTVESDLGVDRDNDDVAVVLCARGSSDPDSNGDVHKLSRL
FT                   LYEGREFTRVEPSFIGVTSPRLEDTLHSVAKDRPDAVVVVPYMLGDGVLTQRIIDTAET
FT                   FDDEYPYVRAGASGPLGTDERLVDVLADRCQEARSGSVEMSCDTCKYKVELSGYEDDQG
FT                   GARAMLRSLVHQAEHADRSDVDDDPHVHDAPAKHVAVCTNQTCAASGAATVLEQLRQHA
FT                   RDSDDCDVHFSRSSCLGQCGDGPIVAVYPDSIWYGSVTPDDTERIVSSHLERDRIVSDL
FT                   VHQSL"
FT   gene            complement(332947..333615)
FT                   /locus_tag="Hbor_03440"
FT   CDS_pept        complement(332947..333615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65949"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ3"
FT                   /protein_id="ADQ65949.1"
FT                   /translation="MSDTDIEPASDLLKGAPETAYLWGHVAGSGDIQPGEFTISTNDET
FT                   CADRLAAIAGGGDIDQRETERPYAHNTAVTRTKDEYLVTVEGDVVSNATAAFGLPVGDD
FT                   AGGYRFDVFEEFQRQLLRGLLESCGTVCFKSSSGTVGISFVHDDRKLLETVDSLLDACP
FT                   VDAPTGEISETSSGGYWFGLDDDAAAPFGTWVYDGSDETNLFAPTRRQKLTRSLEQAEN
FT                   "
FT   gene            complement(333612..333863)
FT                   /locus_tag="Hbor_03450"
FT   CDS_pept        complement(333612..333863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65950"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ4"
FT                   /protein_id="ADQ65950.1"
FT                   /translation="MFEIEIDRTACDGIFACLARDGRFVEDETGLATIDADAEGVIEVA
FT                   RDDERNSVVATVEGNIDDAQLAAQACPPDAITVREVDT"
FT   gene            complement(333865..334827)
FT                   /locus_tag="Hbor_03460"
FT   CDS_pept        complement(333865..334827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03460"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65951"
FT                   /db_xref="GOA:E4NKQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ5"
FT                   /protein_id="ADQ65951.1"
FT                   /translation="MSESNTQSESKCGGKTSESSEETTSKCGGSSKSKDTSSSSKCGSS
FT                   KKEQTDEKVEATVEDFDAEPGQLVAVGLGPGRASEMTTLAKETLRDAEHIVGYTTYIEL
FT                   LPDDIVEGAEDIYSTPMCGEVSRTEEAIDRTLAGNDVAIVGSGDPNVYALAGLALEILE
FT                   SKGATASMVDFDVVAGVPAAQSCAARLGAPLVNDTVTISLSDHLTSMPTIESRLHSAAK
FT                   EGFTIVIYNPWSRKRRSNYEKCCEILLEHRDPETPVGIVHGAGREDEEVEIVELQDLPE
FT                   LGETDLIDMTTTLLVGNEETYVWDGRMVTPRGYEQKYEY"
FT   gene            complement(334830..335681)
FT                   /locus_tag="Hbor_03470"
FT   CDS_pept        complement(334830..335681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03470"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65952"
FT                   /db_xref="GOA:E4NKQ6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ6"
FT                   /protein_id="ADQ65952.1"
FT                   /translation="MSEGAETTTDSHAEVPDDYGTLYVVGIGPGLPDHMTQRAKEVIQT
FT                   SDCVVASNLYQEFLRDDGTLPPEDSDDGPEVVRSSMGQQVELTREAFERVRDGEDVAHV
FT                   SGGDPNVYGKSDLVFTMAESDDATDVPIEIVPGVTAALGGAAMMGAPLSNDFCTISLSD
FT                   KWRGWDEIEEKLRAAAISNFVIVLYNCWRNYTRAIDIVREERADDVPVGIFNDAGRGEA
FT                   GRNLDDETFSITTLGDAKSHDDDVGGMGTSILIGTHETEPWSNDYETYLVTPRGGRDVD
FT                   DF"
FT   gene            complement(335678..336640)
FT                   /locus_tag="Hbor_03480"
FT   CDS_pept        complement(335678..336640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03480"
FT                   /product="cobalamin biosynthesis protein CbiG"
FT                   /note="PFAM: Cobalamin synthesis G C-terminus; Cobalamin
FT                   synthesis G N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65953"
FT                   /db_xref="GOA:E4NKQ7"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ7"
FT                   /protein_id="ADQ65953.1"
FT                   /translation="MSDSDSGSGHCSTPDSDGEVAREIAIVSFERKLETAEEIKRDLAD
FT                   DYDRIDILTYHGDVFAEHWGEYDCFVGLMASGIAMRKTAGLLDDKWEDPAVVVVDEELT
FT                   WAIPLTGGHHGANQVAYDLSKLGAVPAMTTASEAAGKQGVESKAKALDTHVVNGDSTVA
FT                   TNLAVLNDELGPVARLDGPKAVLVDDDVTVLKRNGDDGVVLGTGSVSGAKKEQFLTAWE
FT                   RALDDADCDWDDVDFVATGTRKADEPGMLDAAQEIDAGVVYFEKETLTEFEGPTPSRSK
FT                   ELIGWPGIAEASAIAGGRDHELIVEKQRYDDAVTVAVGR"
FT   gene            complement(336637..337482)
FT                   /locus_tag="Hbor_03490"
FT   CDS_pept        complement(336637..337482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03490"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-4 C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65954"
FT                   /db_xref="GOA:E4NKQ8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ8"
FT                   /protein_id="ADQ65954.1"
FT                   /translation="MSDPVDGDADTGFTDKEGIPFVGAGPGDPELLTVAGRRLVEEADL
FT                   VVHAGSLVNSELLDEYCDHAEQVNSVGKDLEELIPLMADAYESGETVVRLHSGDPAVYG
FT                   AALEQMDALESEGVPTYLVPGVTSAFAASATLRTQLTLNEVANHVVFTRPQGRTLSAEE
FT                   DHISDFVGFGDTTVCIYLGTHAVEETMDRLLDEGHDPETPVAVVYHASWPDEDVIEGTI
FT                   ETIGQKVSEAGYRASALVMIGEAVTGSDYERSFLYGDWARGGDAPNDGDDSETQERDTQ
FT                   "
FT   gene            complement(337479..338207)
FT                   /locus_tag="Hbor_03500"
FT   CDS_pept        complement(337479..338207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03500"
FT                   /product="precorrin-2 methylase"
FT                   /note="PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-2 C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65955"
FT                   /db_xref="GOA:E4NKQ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKQ9"
FT                   /protein_id="ADQ65955.1"
FT                   /translation="MTVYGVGLGPGDADLVTVKGKRILESVDVVYSPGRLSRTVALNHV
FT                   PEERIGDLDFPMTRDPDELRRAWKEAAAEVAERAESGDVAFVTLGDPNVYSTFGHLRRT
FT                   LDAFHPAVELEVVPGVSAMTAFATALGVEIESGTGLSLREAANGAAPTGPDRMILFKVT
FT                   DAPATYEGLTEAGYDVKFGRRLFMEQGETLVTSNPQEIAERDYYTLAYAEREGLERDVA
FT                   TAEFDAESADTDAVEPEVSK"
FT   gene            complement(338207..338764)
FT                   /locus_tag="Hbor_03510"
FT   CDS_pept        complement(338207..338764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03510"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="PFAM: Methyltransferase small domain; TIGRFAM:
FT                   precorrin-6Y C5,15-methyltransferase (decarboxylating),
FT                   CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65956"
FT                   /db_xref="GOA:E4NKR0"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR0"
FT                   /protein_id="ADQ65956.1"
FT                   /translation="MSRVTLPHDAKAGPTKSEVRAVTLDKLDLRPTDHFVDVGSCTGSV
FT                   SIEAAQRVKRVTAVERKAKRLEVTRKNLAANEYDADVALHEAEAPAGLPDDADAMFIGG
FT                   SRNFEAVLDHAVKSEIDRVVMNVSRVEPTGAAIEAFRERDLLDEVVQMQVSHGYELAGA
FT                   TSFKSNNPVYIIVGRRDAGGLD"
FT   gene            338930..339592
FT                   /locus_tag="Hbor_03520"
FT   CDS_pept        338930..339592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03520"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="PFAM: Cobalt uptake substrate-specific transmembrane
FT                   region; TIGRFAM: cobalamin biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65957"
FT                   /db_xref="GOA:E4NKR1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR1"
FT                   /protein_id="ADQ65957.1"
FT                   /translation="MHIMEGFLPPFWAFVWTAVALPFVAYGAKRTIKTMRADTKMKALI
FT                   AIGTAFVFVLSALKLPSVTGSSSHPTGTGVMVVLFGPAVTAFAAAIVLLYQSLLLAHGG
FT                   LTTLGANVVAMGIVGPFVGWVAYRAVRSSLSLEQSTFVAAVLADWTTYLTTSVQLGVAF
FT                   PGGGGIDGILTSVIDFVAVFAITQVPIGILEGVIAAALVGYLARVGSVTKDRLGVTA"
FT   sig_peptide     338930..338989
FT                   /locus_tag="Hbor_03520"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            339589..339861
FT                   /locus_tag="Hbor_03530"
FT   CDS_pept        339589..339861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03530"
FT                   /product="ABC-type cobalt transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Cobalt transport protein component CbiN;
FT                   TIGRFAM: cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65958"
FT                   /db_xref="GOA:E4NKR2"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR2"
FT                   /protein_id="ADQ65958.1"
FT                   /translation="MKRPLAAGLLVVGLVILSTIAVSGLGATDEQAVATITDKDPNYSP
FT                   WMGPVWEPPGGYGEMALFALQGGVAAFVLTYYVERLTDGTYASDA"
FT   sig_peptide     339589..339666
FT                   /locus_tag="Hbor_03530"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            339845..340576
FT                   /locus_tag="Hbor_03540"
FT   CDS_pept        339845..340576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03540"
FT                   /product="cobalt ABC transporter, permease protein CbiQ"
FT                   /note="PFAM: Cobalt transport protein; TIGRFAM: cobalt ABC
FT                   transporter, permease protein CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65959"
FT                   /db_xref="GOA:E4NKR3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR3"
FT                   /protein_id="ADQ65959.1"
FT                   /translation="MHQTLEGIQAEATPVIDGPLKVYFVAVSLLLTATSARLPTFVAVI
FT                   VVFSVLTTHAVGRAYFRFVRYPFWFLVPSLALITFVTPGQTVFEYSVLHVSEEGVRLAI
FT                   RTGLRSVASLSVLSFLALTTTVPQLVSALDRLGLPDSIVEMLLLVYRGIQVLIDESIRL
FT                   YTAAKLRGGFTSRRSTFRTTKHVATSLLLSSLDSAEQLDLSMRSRCYSGRFPVREYESH
FT                   GHAYALGVLAVIVFVKFGQLL"
FT   gene            340573..341268
FT                   /locus_tag="Hbor_03550"
FT   CDS_pept        340573..341268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03550"
FT                   /product="cobalt transport protein ATP-binding subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: cobalt transport
FT                   protein ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65960"
FT                   /db_xref="GOA:E4NKR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR4"
FT                   /protein_id="ADQ65960.1"
FT                   /translation="MIRTDDLHFGYDEQSILRGIDFRAETGDVTVLLGRNGAGKSTLLK
FT                   HLNGLLEPDRGHVMIDGDRIQYDDDSLLSLRQEVGFVFQDPDDQLVAPTVEQDVAFGPI
FT                   NLGTDPTEAVEWALSRVGLAGYEDRLCSRLSGGEKKRVALAGVLAMKPKYLIFDEPTAG
FT                   LDGDGTRALVDLIRELTNEGISFVVSTHYPDFAAAVGDTFTLIDDGQVACRESSLDEIP
FT                   AKKYGLRGV"
FT   gene            341368..342012
FT                   /locus_tag="Hbor_03560"
FT   CDS_pept        341368..342012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03560"
FT                   /product="predicted DNA binding protein"
FT                   /note="PFAM: HTH DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65961"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR5"
FT                   /protein_id="ADQ65961.1"
FT                   /translation="MHQAVLRINSNTPYERATAGSDARIELWCNNHCDLLSVDGRVGEE
FT                   VFDHIEETVGVYNELRGEHGRVIVTDACLKAHSKHNIEPYLESNNCLLVPPIRYEGGAK
FT                   RVRVLASRAEDLTNFYAEITETYEVHVESKREITAVFADQPVVSLQALLPTLSPRQREI
FT                   FTLAHERGYYEIPRETTTTELAEEVGIQRRTLEHHLRRTEEKLADAFVELL"
FT   gene            complement(342057..343490)
FT                   /locus_tag="Hbor_03570"
FT   CDS_pept        complement(342057..343490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03570"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65962"
FT                   /db_xref="GOA:E4NKR6"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR6"
FT                   /protein_id="ADQ65962.1"
FT                   /translation="MATEGKQAEQTWTVEQERHAKSIEELDLHEIRRQPVVKFVTAFLI
FT                   GAVFFLVPVPYQGELTVPFDIVVSTITETFPTAVGVYALAIIVAGGVLTTAARVGDGTV
FT                   AGYDLSYFDTSVAFWILRLAGVVVAPVMFFKLGPSWLHTPGTGGLMWGTLVYSVGVIIP
FT                   IGAVFITIFVELGGLEFVGTIARPVMRPLFKIPGRAALDSLASWVGSYSVGLYVTRNVF
FT                   EQGGYNKRDVFTIATCFSTVSIGFVGVVAATLDILQLFPVVFGAYFLCVIVTAAILVRI
FT                   PPISRVPAEYITEPDPETAFSGSIREYFRLALAEAVEKADEGESFLEAAKRGFVDGLKL
FT                   TTLILGTILTVGLAATLLSANTPIFDILGRPLTPVIAALGIPNAETVAPATIVGITEMY
FT                   VPVLLVTETALKAKFFIAVLAVSQLIFFSSVGPMTMDMFSDVPIRFRDLVALFVMRTVI
FT                   LVPIIAGMTHLAAAIGLLG"
FT   gene            343670..343825
FT                   /locus_tag="Hbor_03580"
FT   CDS_pept        343670..343825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65963"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR7"
FT                   /protein_id="ADQ65963.1"
FT                   /translation="MVLGLILSGLIGFVLVMIATYAGALRALEVYFDPKQNSIFLSDDH
FT                   EPPGGQ"
FT   sig_peptide     343670..343750
FT                   /locus_tag="Hbor_03580"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(344295..344828)
FT                   /locus_tag="Hbor_03590"
FT   CDS_pept        complement(344295..344828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03590"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65964"
FT                   /db_xref="GOA:E4NKR8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR8"
FT                   /protein_id="ADQ65964.1"
FT                   /translation="MGDRRSQPTTEWLENEKVKRILTEYLDETDYRIYKELNRDGRISD
FT                   TELGERVGLSRTAARRRREKLQSEGLVDVLGVLVLQEAELAYADAFVTLNSDISQDDFD
FT                   DFLSKIEGEELIYEIDEYMGKYDLLLRVWHASLSDIKSYLRAQLQTHDAVERYETVPVT
FT                   KTHKAWHKILSNSD"
FT   gene            complement(345058..345297)
FT                   /locus_tag="Hbor_03600"
FT   CDS_pept        complement(345058..345297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65965"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKR9"
FT                   /protein_id="ADQ65965.1"
FT                   /translation="MSKHEATFEIHSKSDSYAVRRILEQAYDTIREESRSVREGTDDAT
FT                   AILQEFKTLREEARQPTTGKLTITYEQYGDEFDS"
FT   gene            345527..346213
FT                   /locus_tag="Hbor_03610"
FT   CDS_pept        345527..346213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03610"
FT                   /product="HTH DNA binding domain"
FT                   /note="PFAM: HTH DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65966"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS0"
FT                   /protein_id="ADQ65966.1"
FT                   /translation="MGLVAEFEIDCDALPLVEVAAAVPEAMIEVAIQFNHGNRPPFIAH
FT                   ITHGDPDAIERAFESGAFAAEYTLVGRAGETHRYQILPAVGLEAKLGEQIDDLDGLRAL
FT                   ATTDAIIERIRVTSSGWIQTGWFANTDEFDMFRRFWQQNAGFSLRRLTHDGEPEEPGDG
FT                   LTDPQREALRTAYEMGYFEIPRTASLDDVAGELGITASSLSERLRRAQTHLIETTVAST
FT                   WPPLPV"
FT   gene            346327..347460
FT                   /locus_tag="Hbor_03620"
FT   CDS_pept        346327..347460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03620"
FT                   /product="daunorubicin resistance ABC transporter
FT                   ATP-binding subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65967"
FT                   /db_xref="GOA:E4NKS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS1"
FT                   /protein_id="ADQ65967.1"
FT                   /translation="MNAPRSTVQTNRADRSDAANQSGAADQSDAANQSGAADQSDAAQL
FT                   AIDATDVHVTYDDGTEAVCGVNLSVSAGEFFGFLGPNGAGKTTTIKTLAALLRPNLGSV
FT                   SINGFDIENDSKAVRESIGYMAQETSVDEALTARENVRFACDIYGVPAGERDERVDELL
FT                   ALVNLTHVADKRAENFSGGMKKRLDAATVLVHRPPVVFLDEPTTGLDPEARIRFWEYLR
FT                   SINERGTTVVLTTQYLEEVDRLCDRLAVIQDGEIIATDTPDALKSRVGGDIIELALDDP
FT                   AARTTERATRIVRESNAFEAATIETTDRGLIITSEHAREAVTDLFVSLDDADITVTGLD
FT                   IRSPTLDDVFLSITGERSNSSDLSPQHGVTSMQEVSK"
FT   gene            347457..348374
FT                   /locus_tag="Hbor_03630"
FT   CDS_pept        347457..348374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03630"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="PFAM: ABC-2 type transporter; TIGRFAM: ABC
FT                   transporter efflux protein, DrrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65968"
FT                   /db_xref="GOA:E4NKS2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS2"
FT                   /protein_id="ADQ65968.1"
FT                   /translation="MSRFTDDADTSEIGTAQRASGNRFVVDIRVSLKRWLIKTSRNPFV
FT                   TFSSLVQPIIFFVLMAEVFGSIAGGTLSQTLGDEINYVTYLTPAIVIQSALAAAAVSGI
FT                   GLVDDIETGMFEKILVSPMNRGAMFLGKVLSEVVRIAIQTAIILALGYAMLFLQSAASV
FT                   ETYLQTGAIGAIGIVGIAVIFGGVFMAYSNIVALVTRDREATIMIANLLTFPLLFVSSA
FT                   FLPLSVLPGWIRTFAVFNPITYGVDAIRALMLGQDTLSVLHVTVFSGFWNTVIPSLIVL
FT                   LGANAALGGIAVRLLTRASRADVQ"
FT   gene            complement(348383..348994)
FT                   /locus_tag="Hbor_03640"
FT   CDS_pept        complement(348383..348994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03640"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Tellurite resistance protein TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65969"
FT                   /db_xref="GOA:E4NKS3"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS3"
FT                   /protein_id="ADQ65969.1"
FT                   /translation="MTNWDERFRSGEYPSDPEPAPLLEQYVDALPPGRALDVAAGTGRN
FT                   AVFLAEEGYEVEAIDQSREGLRITRERARDRDVADQLDCLQVDIPSHEFPQDRYDLITV
FT                   SFYRTVDRLPDLIDALAEDGVLFYEHHLRSTDQYEAGPSGDQYRFGANELLHTCLDLTV
FT                   LAFDAKTESRDDGRTAMRTQIVARNSSGQAQSYPAVGLDS"
FT   gene            349342..349668
FT                   /locus_tag="Hbor_03650"
FT   CDS_pept        349342..349668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03650"
FT                   /product="thioredoxin-like protein"
FT                   /note="PFAM: NifU-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65970"
FT                   /db_xref="GOA:E4NKS4"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS4"
FT                   /protein_id="ADQ65970.1"
FT                   /translation="MSAESLERRTRNYLSNNVPQIQEHGGHFEIEDVDNETGEVTVAIG
FT                   GACSGCGIAPMTMRAIRHRLPDEVDDISKVTVRRAGGPRAAVMPDKTAEMEEMEEYKDY
FT                   EPPF"
FT   gene            complement(349776..350195)
FT                   /locus_tag="Hbor_03660"
FT   CDS_pept        complement(349776..350195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03660"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /note="PFAM: Iron dependent repressor, N-terminal DNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65971"
FT                   /db_xref="GOA:E4NKS5"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS5"
FT                   /protein_id="ADQ65971.1"
FT                   /translation="MSGRPQYLIALYIAEHRESAPVSPGIVASMLNRSSATAIETFHRL
FT                   DDEGLVTYKPYDGAELTQVGRETAAELHDTYVTLSWFFRSVLELDDYESEAMEMAGVVS
FT                   PDIADRLASTLPYDGDAAVETRGEPYVSTGDSAQE"
FT   gene            complement(350192..350293)
FT                   /locus_tag="Hbor_03670"
FT   CDS_pept        complement(350192..350293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65972"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS6"
FT                   /protein_id="ADQ65972.1"
FT                   /translation="MSEFDGGNTAPFGDRPTETDSYVESSVVRWGSG"
FT   gene            complement(350533..351219)
FT                   /locus_tag="Hbor_03680"
FT   CDS_pept        complement(350533..351219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03680"
FT                   /product="GMP synthase family protein"
FT                   /note="PFAM: Glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65973"
FT                   /db_xref="GOA:E4NKS7"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS7"
FT                   /protein_id="ADQ65973.1"
FT                   /translation="MYIKLGTEPGGIVILVVDNAVEGGYMAGEVARLLPGDDVRMYNYP
FT                   NGDDDPSLEDVDGVVIGGSGAGVYDEPDQPWITRQKEFVEAVIDEEIPLLGICFGHQLV
FT                   NEVLGGTVVNSGESRNYLVEASLAEIPLFEGVRNVVPVLHSDIVTEPGEGMEVVGTADY
FT                   NRYFATRHHERPIWTVQYHPEFTPEIRPEYSDSWDESEYSFEASTATRTLENFSQCCQQ
FT                   RTSVSD"
FT   gene            351393..353537
FT                   /locus_tag="Hbor_03690"
FT   CDS_pept        351393..353537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03690"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Peroxidase; TIGRFAM: catalase/peroxidase HPI"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65974"
FT                   /db_xref="GOA:E4NKS8"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS8"
FT                   /protein_id="ADQ65974.1"
FT                   /translation="MNRSNQDWWPNQLNLEILDQNARQTDPMGEEFDYAEEFEKLDFEA
FT                   VKEDIEAVMTTSQEWWPADYGHYGPLFIRMAWHSAGTYRTVDGRGGAAGGRQRLPPISS
FT                   WPDNVNLDKARRLLWPVKQKYGRKLSWGDLIVLAGNVALESMGFETFGFAGGREDDYVP
FT                   DKAVDWGPEDEWEKTSSDRFDEEGDLKEPLGNTVMGLIYVNPEGPNGEPDVEGSAKNIR
FT                   QAFSRMAMNDEETVALIAGGHTFGKVHGADSGDNLGPEPEAAPIDLQGLGWENEYGSGK
FT                   GPDTITSGIEGPWNTTPIQWDMGYIDNLLEYKWWPEQGPGGAWQWTTQGGELDDAAPGV
FT                   EDPSEKEDVMMLTTDIALKRDPDFREVLERFQENPDEFQECFAKAWYKLIHRDMGPPER
FT                   FLGPEVPDEVMLWQDPLPDADYDLIDDEAAAELKEEILGSDLSVSQLVKTAWASASTYR
FT                   DSDKRGGANGARIRLEPQRSWEVNEPEELETVLETLEGIQDEFNSSQSDETRVSLADLI
FT                   VLGGNAAVEKAAADAGYDVEIPFEPGRTDATQEQTDVESFEALKPKADGFRNYIESGVD
FT                   EKPEELLVDKAELLNLTVEEMTVLVGGMRALDANYQGSDLGVFTDEPETLTNDFFVNLL
FT                   DMDSEWEPVSDSEDVFELRDRETGEVQWKGSRFDLIFGSNARLRTVAEVYGAADGEEKF
FT                   VHDFVETWHKVMTLDRFDLE"
FT   gene            complement(353936..354232)
FT                   /locus_tag="Hbor_03700"
FT   CDS_pept        complement(353936..354232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65975"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKS9"
FT                   /protein_id="ADQ65975.1"
FT                   /translation="MQPERGDVVRSSDPFKLGDDRQRPWLIVNNSTHPFGDQQYIAVAI
FT                   STKGYDDSLPLTDDLWEVGGVPRDSFVSPWAVHSPRKEDFVAWQGRLEKAFVD"
FT   gene            complement(354233..354604)
FT                   /locus_tag="Hbor_03710"
FT   CDS_pept        complement(354233..354604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65976"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT0"
FT                   /protein_id="ADQ65976.1"
FT                   /translation="MPVSIDDFESGDLPRGPSVPEQVVTYLYTHSDQAFTRSEIATAIS
FT                   EDPNTVGTALSRLKDRNLVRHKREFWAITDDDERVAAAYDLHTTTDRLDDEDGGIDADE
FT                   WETVAPEAPHPSERDEDEQ"
FT   gene            complement(354835..354907)
FT                   /locus_tag="Hbor_03720"
FT   tRNA            complement(354835..354907)
FT                   /locus_tag="Hbor_03720"
FT                   /product="tRNA-Arg"
FT   gene            complement(354964..356442)
FT                   /locus_tag="Hbor_03730"
FT   CDS_pept        complement(354964..356442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03730"
FT                   /product="putative efflux protein, MATE family"
FT                   /note="PFAM: MatE; TIGRFAM: putative efflux protein, MATE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65977"
FT                   /db_xref="GOA:E4NKT1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT1"
FT                   /protein_id="ADQ65977.1"
FT                   /translation="MPTTPPPDGGSLTEGDLRRPMFALAWPIIVTELLQVAYNLADTIW
FT                   LGRLSTDAVAAISLAFPLIFLLISVGGGFTVAGTILVAQYTGAKEEGSAGVVAGQTFAF
FT                   ISIIAVVVGLLGFASTDLMLGVLPSSAATAGQVIPHAGDYMRVFFLGLPFLFGFFVFSS
FT                   LMRGYGNTRAPMVVMFISVAINVLVDPIFIFGFESNPLFGMLGIRGVESTLFAATGFEG
FT                   YGVTGAAIATVLSRAVATVIGLYVIFGTSAGPDVSVSDFVPQREYIEKIIRLGVPSALE
FT                   QSASALGFITLTAMVVTFAPEVVAAYGLGNRLTSLVFLPALGLGRATDTIVGQNLGAEK
FT                   PERAERAVWLAAKVGASVMVVIGVVAFLFAEPIVSVFIDTGTDSATKTIELGAEYIRVR
FT                   AFEFGFIGVLQTVLGAYRGAGNTKTALAFSLFALWFGRIPIVYYLSFMQGFGEMGIWIG
FT                   MAVGQILGAIAAAAWFTRGTWKRAVIDHSEAAME"
FT   gene            complement(356593..357180)
FT                   /locus_tag="Hbor_03740"
FT   CDS_pept        complement(356593..357180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03740"
FT                   /product="ferredoxin"
FT                   /note="PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   TIGRFAM: ferredoxin [2Fe-2S]"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65978"
FT                   /db_xref="GOA:E4NKT2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT2"
FT                   /protein_id="ADQ65978.1"
FT                   /translation="MVEINLVGLGIGMTLTLMAVALHFSRGTEWTPAADISQEVLERRA
FT                   STVPETDFPEPMNRSIGGGGVAAGAVASGEEGAELEGEAEEESSSPADIPEDEVEYFEV
FT                   EYAKQGATIEVANNETVLEAGEDEGMDLPYACRQGQCVSCAGQITSGGSSEDYVVHDNQ
FT                   QMLGDAELDDGYTLTCVAYPKADFTIETGEAP"
FT   gene            357313..357486
FT                   /locus_tag="Hbor_03750"
FT   CDS_pept        357313..357486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65979"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT3"
FT                   /protein_id="ADQ65979.1"
FT                   /translation="MAKIVYDDGTGVVEYEAPTIEYDKTRRAWVIRQGGDKPVSIYIPE
FT                   TQVFRVEKQGGR"
FT   gene            complement(357585..358481)
FT                   /locus_tag="Hbor_03760"
FT   CDS_pept        complement(357585..358481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03760"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, C-terminal
FT                   domain; NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65980"
FT                   /db_xref="GOA:E4NKT4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR032883"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT4"
FT                   /protein_id="ADQ65980.1"
FT                   /translation="MQLGVIGLGRMGQIVVNRVLDAGHDVVAFDLSEEAVATAADAGAE
FT                   PASSIEDLMNRLGDEKRIWLMVPAGEAVDATLDELDPHLDGQDVVVDGGNSYFEESVRR
FT                   AEATEAAYLDCGTSGGPAGAELGFSLMIGGPEWAYEELTPVFDAVATGPDGHDRMGPAG
FT                   SGHYVKMVHNGVEYALMQAYGEGFELLANGRYDLDLEAVSRTWNNGAVIRSWLLELCEE
FT                   AFREEGNDLGDVADHVAGGSTGTWTVQEALEQEVSVPLIYQALAERFDSRNEGRFSRRL
FT                   ANRLRYGFGRHEVVREE"
FT   gene            358582..358980
FT                   /locus_tag="Hbor_03770"
FT   CDS_pept        358582..358980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03770"
FT                   /product="predicted signal-transduction protein containing
FT                   cAMP-binding and CBS domains"
FT                   /note="PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65981"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT5"
FT                   /protein_id="ADQ65981.1"
FT                   /translation="MLDELLRTDVPTAAPETPIADVATVMRDTDADAVVVLDEDRPLGI
FT                   ITPATLGRAVVAGEDLGSESVAELVSGDPVTIRRVASRSDLVAVFAREDVREAIVLDEM
FT                   DQYVGIVSFKDVLTAYSREFDALLDLLE"
FT   gene            359038..360135
FT                   /locus_tag="Hbor_03780"
FT   CDS_pept        359038..360135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03780"
FT                   /product="leucyl aminopeptidase (aminopeptidase T)"
FT                   /note="PFAM: Thermophilic metalloprotease (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65982"
FT                   /db_xref="GOA:E4NKT6"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT6"
FT                   /protein_id="ADQ65982.1"
FT                   /translation="MDPRIRDHAEVLVDWSARIESGDDVVVSVAEGAHELAVAVAEKLG
FT                   ERGANVVTTYASDEVLRAYLRAHDAEFDFGAHELALYENADSVLFLGGGRNTFATADVP
FT                   GETRQASDRASQPVREARMDTDWVSTVHPTRSLAQQAGMAYEEYQQFVYDAVCRDWEEL
FT                   ADQMANMKEILDEGSEVRLVKGDNTDIRMSIEGRTAVNSAASVAYDSHNLPSGEVFTAP
FT                   YDPEGEVFFDVPMTISGSRVRNVHLTFADGEVTDFTAESGEDALAEIFDTDDGARRLGE
FT                   LGIGMNRGIDRFTDNILFDEKMGDTIHLAVGRAYGSCLPEGESGNDSAVHVDMITDVSE
FT                   ESRMDVDGEVVQRNGVFRWEDGFEG"
FT   gene            360315..360719
FT                   /locus_tag="Hbor_03790"
FT   CDS_pept        360315..360719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03790"
FT                   /product="SSU ribosomal protein S6E"
FT                   /note="PFAM: Ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65983"
FT                   /db_xref="GOA:E4NKT7"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT7"
FT                   /protein_id="ADQ65983.1"
FT                   /translation="MAEFKVVVSDPDAGDTHQFEVDGQDANRFLGRDIGDEVDGGAVGL
FT                   DGFTLEITGGSDEAGRPMRENVAGSNLKELLLEGGVGYKPSRDGERKRVTVRGRQVSDE
FT                   TAQVNAKVIDGGDVAAALGEDDEEDEADEE"
FT   gene            360733..361170
FT                   /locus_tag="Hbor_03800"
FT   CDS_pept        360733..361170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65984"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT8"
FT                   /protein_id="ADQ65984.1"
FT                   /translation="MSERVPSDHDSVMSYRATIARSGGTRRPCLRLPDEVTAVEDGDII
FT                   RLSLGGELFHARVTADSSSRLLRGAYDNKRLARTPGEGTNRLVEWCEATSRDPGSAVEF
FT                   DELDAGFCYGLREPGKRTVYSVPSRPNESLANIAEKFTRDE"
FT   gene            361215..361694
FT                   /locus_tag="Hbor_03810"
FT   CDS_pept        361215..361694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65985"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKT9"
FT                   /protein_id="ADQ65985.1"
FT                   /translation="MSKLDEFLAGERHDDVALFLTHEYLDSQGKLPNLGEEVENGYVLV
FT                   VPGDDGRRAFAAGTGMDAMEFSRTAMAEKGHIDRELGGGECPDHDSDENHQAEFIFSFS
FT                   EEQNEEVGGLYARGDVVHAYAHCACGANYSDKWVIGEETETGVQPGESEPAEADE"
FT   gene            complement(361734..361871)
FT                   /locus_tag="Hbor_03820"
FT   CDS_pept        complement(361734..361871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65986"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU0"
FT                   /protein_id="ADQ65986.1"
FT                   /translation="MGHCTDCGAELIEVIESDTSAKFSDARVWECNQCGAILGVTRIGV
FT                   "
FT   gene            complement(361972..363231)
FT                   /locus_tag="Hbor_03830"
FT   CDS_pept        complement(361972..363231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03830"
FT                   /product="predicted DHD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65987"
FT                   /db_xref="GOA:E4NKU1"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU1"
FT                   /protein_id="ADQ65987.1"
FT                   /translation="MEEELIDSSRLSLSRKSQLPGTGFFYPDSLDEERAEERVKEAVED
FT                   AEAVVIADTDADGLGCVALIREMYDATLDVAAFEDDVARRVERWEADGPIDDEDEDEDE
FT                   ELPRSTVALVGAGPYSLDDALERVAEYAPEDIDAYVCDLCPDQYEWVEDELAALLDRAD
FT                   SVSWYDHHQWDDETMVAVRDAGVELVVGESDEECSTGVTLRSLDYDFDDRWTELAAVTR
FT                   DHDLWLKEDERSDDLADYAYWVSPEEYVAVVGAYGVDLPEIVEQFIELRRVEKQQLIDA
FT                   ALDRAEIKQVGPWTVGVTYGRCSQNEVAEGLRERGADAAVVVKPAGSASIRGSDGFERA
FT                   HEVAGQVNGGGHPKAAGCKPDIYDDMLDYAHHWTTNGAAAKRVILAAFERVAEQVAEES
FT                   EDEEGAETADADDEADKTES"
FT   gene            complement(363308..363772)
FT                   /locus_tag="Hbor_03840"
FT   CDS_pept        complement(363308..363772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03840"
FT                   /product="universal stress protein UspA-like protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65988"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU2"
FT                   /protein_id="ADQ65988.1"
FT                   /translation="MFDTIVVATDGSESVRRAVDVALDLADRFGASVHALYVVDASEVD
FT                   SSPERLRDEMREALTERGQRALSEVEEATDRSVTTAVREGRPATVVGDYAREVDADMVA
FT                   MGTRGRHGENRFLIGSVAERVVRTCPVPVLTVRQLAEDETDGLEGTPESA"
FT   gene            363868..364326
FT                   /locus_tag="Hbor_03850"
FT   CDS_pept        363868..364326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03850"
FT                   /product="universal stress family protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65989"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU3"
FT                   /protein_id="ADQ65989.1"
FT                   /translation="MSDRRPLDVNLVLVPVDRSEESANAVEHAAAIAAEYDAAVHAVHV
FT                   LGGDVVRAIETGAVDDEDVVADSTAIQETAGEIAARYDVELATSVAYGFSTKMKLRHPG
FT                   SVVLDTAEELGADFVVVPREPVSGDPGEVLAKAAEYVLLYASQPVLSV"
FT   gene            complement(364364..364909)
FT                   /locus_tag="Hbor_03860"
FT   CDS_pept        complement(364364..364909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03860"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65990"
FT                   /db_xref="GOA:E4NKU4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU4"
FT                   /protein_id="ADQ65990.1"
FT                   /translation="MSTERRYPDAVAGPFESPPVTFEDREGRDIEVRPYDGSDEEFESL
FT                   VSMYDAFDPADRAQGIPPGQERRIRDWLDNILAEECLNVIAWDGDDAAGHATLVPDDDA
FT                   YELAIFVLQEYQEAGIGTLLIKSLLGHGAENSVKKVWLTVERWNRPAVGLYKKIGFETS
FT                   NSESFEMEMTLRLTESAD"
FT   gene            complement(364906..365274)
FT                   /locus_tag="Hbor_03870"
FT   CDS_pept        complement(364906..365274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03870"
FT                   /product="universal stress family protein"
FT                   /note="PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65991"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU5"
FT                   /protein_id="ADQ65991.1"
FT                   /translation="MKVLLGVGGSDDSIRAVKQTVARAAAAGDDLTVAVVENPASDRSR
FT                   EEITEIVREILDEEGVEAEVRHLEGDPGSQLVDTAESENFDEIVLGGGETSPMGKINIG
FT                   SIAEFVLLNSHVTVSLVR"
FT   gene            365401..366234
FT                   /locus_tag="Hbor_03880"
FT   CDS_pept        365401..366234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65992"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU6"
FT                   /protein_id="ADQ65992.1"
FT                   /translation="MTDDDRTTPDRNGRSDADPDATTGSTEDAAETPQDGERPGAIDRD
FT                   EPRPTDGDASADAEDIESVDATDSEGDDGAGATDAESTDAESTNEKSTDADGTNGESTD
FT                   EEPEIPRDVQKYARFKKMDGAQYDRVNEFLRDRTYVTAREWAIARLCADFRTETGVEMT
FT                   KIGENLPELVPFMTDTYTPQAVNQARSSFEGKVRKAGATFLYGAMSGFFTAEELDELMY
FT                   EVSEVAKFLLEVEGVDLSVEEELEAEERISSVMREVRDASEDLRREELADEASDD"
FT   gene            complement(366361..366909)
FT                   /locus_tag="Hbor_03890"
FT   CDS_pept        complement(366361..366909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65993"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU7"
FT                   /protein_id="ADQ65993.1"
FT                   /translation="MDDPEREREAHPLSGVMEFWDHVIEDMEATAAEYREAGWNVTELH
FT                   PGDVTPVPATLDTVETDRAGLDVLVPGDEFETVEALVEDATFDSYDAYRAERGDVMFAV
FT                   VVMQAESAGEAVAVPVYYTMTEGQPMLEQIEERGEMRLYIRPLSDDRRVVFVQEDPEAL
FT                   VPDADGNSDTADDTSDADS"
FT   gene            367007..369460
FT                   /locus_tag="Hbor_03900"
FT   CDS_pept        367007..369460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03900"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM: phosphonate C-P
FT                   lyase system protein PhnK; oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65994"
FT                   /db_xref="GOA:E4NKU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU8"
FT                   /protein_id="ADQ65994.1"
FT                   /translation="MTLLSISDLRTQFATDRGQVKAVDGVDLEIDEGETVGLVGESGSG
FT                   KSVTALSTMGLVDDPGHIVGGEVTLTSPELATQLREEYGAPSFVDGDEIDLTAAPEEAL
FT                   RSVRGGEMSMIFQDPMTSLNPALTVGEQVSESLRLHQYGGRKKDTWLNAVREVLPKIGG
FT                   QELDEQVVERAVEVLSEVGIPEPTSRVDEYPHEFSGGMRQRVLIAIALACRPKLLIADE
FT                   PTTALDVTIQAQILDLINELQDDLGMSVLMITHDLGVVAETCDRVAVMYAGEIVEEGPV
FT                   EEIFANPSHPYTYALLESIPTEDKERLTPIEGNVPDLIDMPTGCNFAARCPWATDECRQ
FT                   GDIPYLQHGPDGVEHRAKCIMEEFDTSVYGSDDALEKGDSDIGEELLRAEGLKKHFSRA
FT                   EGLLDEWLGLEDASVKAVDGVDLSVYEGETLGLVGESGCGKSTTGETILQLLDATEGRV
FT                   VFQGEDLTELGGTDLRKKRRDLQMIFQDPMSSLDPRMTVGQIIAEPLQIHDLPAEEPGE
FT                   DQNRREQRRDRVVELMRAVGLEPGQRTRYPHEMSGGQRQRVGIARALAVDPDFIVADEP
FT                   VSALDVSVQAQILNLLEDLQDEFGLTYLFIAHDLSVVRHICDRIAVMYLGEIVETAATD
FT                   DLFAEPKHPYTQALLSAIPEPDPTAETDRIILEGDVPSPIDPPSGCHFRTRCPQVIPPT
FT                   DIEIEQAAYREVMDLRQRVESENIDVAAVREEVSASGGKAETAAATDGGVPANAVAAEL
FT                   YDRLFEEPLQDENRRVVESALNSIAAAEWDEAASILRDRFESVCERSAPTLDGDTHATS
FT                   CHLYD"
FT   gene            369556..371289
FT                   /locus_tag="Hbor_03910"
FT   CDS_pept        369556..371289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03910"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /note="PFAM: TAT (twin-arginine translocation) pathway
FT                   signal sequence; Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle; TIGRFAM: Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65995"
FT                   /db_xref="GOA:E4NKU9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKU9"
FT                   /protein_id="ADQ65995.1"
FT                   /translation="MGETMSRDIDRRAFLKAAGGAAAAATLAGCAADPDESGTGTEDAT
FT                   DTQTNGGETDEETTETDGEDTTTLTFARGNTSGTLDPQNSTSGEDVKVTNQVYDQLIMF
FT                   EPGKTSLREGLATDWSLEGTTVTLTLREDVTFHNGEEFTADDVVATFNRFTNPDYEHYP
FT                   GDKYISAYGPFTLGNWVKSVSKDGDYALTIQLNQKYAPFLRNLAMFASSILSEKAIKEL
FT                   GQDLSKKPVGTGPFKFENWDTSNQQIRLSANTDYWGEVPKVDEVVFTSVGSNTTRAQTL
FT                   DSGGADIIDGLGAQASKIVENSSNAKLVSKAGINVGYMAFNMAKVEAFRNKKVRQAISY
FT                   AINTEALVNNIFKGIAEQASQPIPSNVFGYNDDLSPYPQDLEKAESLLEEAGYGDGFSF
FT                   ELATFKNPRTYNPSPLSAAQLVKSNLAELGIEVSINQQSFNPFLDYTNSGKHDACFLGW
FT                   MTDNADPDNFFYALLHPQVEDSEFTEGEDWVSFDSKGYNTLNAAGWANRDYMQLVEDAQ
FT                   TTYDKETRAEKYKQAAKVAHEEAPWVFLDHAKELRGVSNKVSGFVLAPISGPFLNLVSL
FT                   D"
FT   sig_peptide     369556..369648
FT                   /locus_tag="Hbor_03910"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            371313..372338
FT                   /locus_tag="Hbor_03920"
FT   CDS_pept        371313..372338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03920"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65996"
FT                   /db_xref="GOA:E4NKV0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV0"
FT                   /protein_id="ADQ65996.1"
FT                   /translation="MVSKRFILKRLLLLVPVLFGVATLVFAILHLSPGDPARVIAGQRA
FT                   TEAQVAAVRSDLGLDDPLWMQYGRFLVDIVTLNLGESYIIQRGTSILTILRARLPVTLE
FT                   LAIYGQLIGVLLGIPFGIISAVKQDTITDHLTRVGALTGISMPIYWTGPLVILLFAQFL
FT                   NVLPASNRIASQFDPPVYTGLITFDTFIFGIQSGDFAAFISAASHMLLPAAVIGIYGMA
FT                   LISRMMRSSMLEVIRQDYMRTARAKGQGAKITVMKHGLQNALIPVITVIGIQFGTLLGG
FT                   AVLTETVFGIGGIGTMLVKAIEVGDYPVVQGTVLVFAFLFTLVNLGVDLTYSYLDPRID
FT                   Q"
FT   sig_peptide     371313..371393
FT                   /locus_tag="Hbor_03920"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            372340..373281
FT                   /locus_tag="Hbor_03930"
FT   CDS_pept        372340..373281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03930"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65997"
FT                   /db_xref="GOA:E4NKV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV1"
FT                   /protein_id="ADQ65997.1"
FT                   /translation="MSTPTQTETGRNRRGLLSRLRASPFLSDLLSNRLALAGIVLILVM
FT                   VVIALYARLGAFLGFAPSYAELTSSQFGANPSLAAPSAAHPFGTDIQSRDIFNRVLYGS
FT                   WLALKFGTVTVGISTAAGVSLGIIAAYYGDITDNIIMRSMDVLLAFPSLLLALALVAIF
FT                   PNELGLWRAVTALTLVYTPRFARVVRGAALKVLEDEYVDATIALGATDPRVLARHVMPN
FT                   CLAPITVQSTLNFGLAIIDLAALSFLGFGAEPGSPSWGLMLSNGVEKGLLTGDWWWSFF
FT                   PGLFLAVTVLGFNLLGDGMRDALDPRMREAVD"
FT   gene            373299..373682
FT                   /locus_tag="Hbor_03940"
FT   CDS_pept        373299..373682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65998"
FT                   /db_xref="GOA:E4NKV2"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV2"
FT                   /protein_id="ADQ65998.1"
FT                   /translation="MSRLDDTPRDAPTRASPTLSRRVTVVGGAFLVGVAGGGVALAVAT
FT                   YHFSSLPDGADAVFLLGILALGFGVLGWSGSVLAGRGFEEMQRHLDTGAEWTEMDSRRA
FT                   MARIGGFGAGVMLAAMTLGSLLA"
FT   gene            373947..375203
FT                   /locus_tag="Hbor_03950"
FT   CDS_pept        373947..375203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03950"
FT                   /product="transposase"
FT                   /note="PFAM: Putative transposase DNA-binding domain;
FT                   Probable transposase; TIGRFAM: transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ65999"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV3"
FT                   /protein_id="ADQ65999.1"
FT                   /translation="MLETTRTYVARITNHEQVRDDLDQCGFSASKLWNVGRYYIQQRWD
FT                   EDDEIPDEAELKSELKDHKRYSDLHSQSSQRVLEELAEAFTGWYNSDDGNNPPGYRKCG
FT                   DDHPRSTVTWKKRAIKHDDKHGQLRLSKGFNLKESRSDFILAKYETRPDVEVENIQQVR
FT                   AVWNGDEWELHLVCKTEIPVEDAPGNNTAGIDLGISNYLAIDYEDGPSELYPGNVLKED
FT                   KHYFTREEYQTEGENGPSKRARKARQKLSRRKDHFLHTLSKHIVERCVEEGVEKIAVGD
FT                   LSDIRENENGDSRNWGASENKKLHGWEFDRFARLLEYKAEEHGILVDRVDEENTSKTCS
FT                   CCGKIRDSNRVERGLYVCSSCETTMNADVNGAVNIRRKITQSPPTGDMSNGWLAQPGVF
FT                   LFDRESGRFTPREQGVCKP"
FT   gene            complement(375249..376592)
FT                   /locus_tag="Hbor_03960"
FT   CDS_pept        complement(375249..376592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03960"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="PFAM: Amidohydrolase family; TIGRFAM:
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66000"
FT                   /db_xref="GOA:E4NKV4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV4"
FT                   /protein_id="ADQ66000.1"
FT                   /translation="MKNRGAYPLRVERTDMSLLITGATLADGRVRDVRVEGETITAIEE
FT                   SLDPREDERVVNATGKMLFPGAIDAHVHFREPGFSHKETWETGSQSAAAGGVTVVADQP
FT                   NTQPPTTTGSAFDEKAGLAAASLIDFGISGGVTADWDPDSLFDRPLFALGEVFLADSTG
FT                   DMGIDADLFADAVERAADADVTVTVHAEDADLFDESAQKRDTGGTGEAADADVWSQYRA
FT                   AEAEEAAVERAVSVGSDSEADIHIAHTSTPEGVDAAKAGGATCEVTPHHLFLSRADATE
FT                   LGTYGRMNPPLRSEDRREGMWERVVSGEIDIVATDHAPHTRAEKDADLWDAPSGVPGVE
FT                   TMLPLLLEEARKGTISYERVRDVTAANAAEIFDLPQKGRVEVGSDADLVVFDPEESQEI
FT                   HGADLHSRCGWTPFEGMRGVFPEMTLVRGHVVYEDGKFGDAVGENVRN"
FT   gene            complement(376615..377334)
FT                   /locus_tag="Hbor_03970"
FT   CDS_pept        complement(376615..377334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03970"
FT                   /product="lipoate-protein ligase A"
FT                   /note="PFAM: Biotin/lipoate A/B protein ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66001"
FT                   /db_xref="GOA:E4NKV5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV5"
FT                   /protein_id="ADQ66001.1"
FT                   /translation="MADERGDRAVRVVRGRVATRDSDQTVTTEMSEYVAETGNPAFRAW
FT                   TPHRQMAFGRRDAHAEGYERACEAAESRGFPVVKRSVGGRAVAYTGRTVAFASAVPIEN
FT                   DRTGLDERYETATTAVIRALRSLGVPARRGEPANSFCPGDHSVQAHGKICGIAQRVRRD
FT                   VALVSGVVVVADHDAIAAVLEPVYEALDVPFDPGSVGSVARSGGPGDAERVIRALEDAF
FT                   VGDAERRVTDARERVDD"
FT   gene            377451..378308
FT                   /locus_tag="Hbor_03980"
FT   CDS_pept        377451..378308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66002"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV6"
FT                   /protein_id="ADQ66002.1"
FT                   /translation="MVTLSASVLRRYQRFSLYNSPYSAHDHGHAIDLYPATNEGLSPVS
FT                   GEVLETRTVRAPPKPYAHEDEYLILVDAGEYVARILHVEPAVEAGERVEVGDSLGPMVR
FT                   SGFFAPWVANHVHVGFRRHDQNLQRATGSLPLVADVPVEPLAWDGTGTIVETGDTYARL
FT                   DSPTHPAPGESFAGIATDGGYVLDGGFGHYTGGGAITAGPDGAGASGTVSLLGHPVGDV
FT                   RQRDVAWRDVDVMANGERITGISLFAARDSGFGAKLVCPGHEFAVGDEIRVEISDSDDP
FT                   VRLG"
FT   gene            378402..378905
FT                   /locus_tag="Hbor_03990"
FT   CDS_pept        378402..378905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_03990"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Thioesterase superfamily; TIGRFAM:
FT                   uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66003"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV7"
FT                   /protein_id="ADQ66003.1"
FT                   /translation="MSEDAPEGFPDDAASFVQQYIEQEHGYLSWLGTQVNEFEDGRVVM
FT                   TIPYDEKLTNTTNPPTVHGGIAATLIDTAGGIAQRTMLSDPMNGGVATVNLNVNYLRRA
FT                   AGDLRATAEVVRAGGSIGVSTVTVVSRPPERVRENDEAFERWQGTTDEEAVATGQGAYR
FT                   LFRD"
FT   gene            complement(378924..379499)
FT                   /locus_tag="Hbor_04000"
FT   CDS_pept        complement(378924..379499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04000"
FT                   /product="nicotinamidase-like amidase"
FT                   /note="PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66004"
FT                   /db_xref="GOA:E4NKV8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV8"
FT                   /protein_id="ADQ66004.1"
FT                   /translation="MSEFDPERTAVVVVDMQNGFCHPGGSLYAPKSEAVVDDVAALVAD
FT                   VRDAGAAVVYTRDVHPPEQFDDAHYYDEFDRWGEHVVEGTWETELVEELDVREDDHVVV
FT                   KHTYDAFHQTELEGWLDAHGIDDLLFCGTLANVCVLHTAGSAGLRDYRPVLVADAIGAI
FT                   EADHKEYALEHADWLFGEVTTREEIRFE"
FT   gene            379710..381197
FT                   /locus_tag="Hbor_04010"
FT   CDS_pept        379710..381197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66005"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKV9"
FT                   /protein_id="ADQ66005.1"
FT                   /translation="MLTKHGIAVGALSLLLVLAGCTAPMVEPELGDGGVAGGPSDTSVI
FT                   ASPDANFTDPADDPLGWEDGYWYNESIAVDQSDGLSDTELRAYVARSMARVEYLRHKEF
FT                   KKRVSVDILSREEYQEQQRANAQNGSAAGNQTEFNQWNNQVWEALFISGESGDSQAEIS
FT                   ETQGSSVAGFYSPSNDAITVITPSPDSPRIDNATLIHELTHALQDQHYDLTSQTYRGDT
FT                   QDRSLAIDGAVEGDAKYVELLYADRCGIEWECVETPPATGAGGSAGSAGNGPNLGIFLT
FT                   IFQPYSDGPVYVHDKVQQGGWQAIDELLRNPPESTEQTIHSTDEKPVPIEYQDRSTNGW
FT                   ATFPQQGQDGSDTVGEVSMYAMFWYQARMSGAETIPSQSILRTESQYDTYNYDAAPSNG
FT                   WGNDRLFPYKNSVNGSDEYGYVWVTEWDSKGDAQQFYDAYVNILDAHDATKQSKNTWVV
FT                   ESGQFADSFRVQQDGTRVTIVNGPTVEDVDDIRPPAN"
FT   sig_peptide     379710..379787
FT                   /locus_tag="Hbor_04010"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            381366..382727
FT                   /locus_tag="Hbor_04020"
FT   CDS_pept        381366..382727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66006"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW0"
FT                   /protein_id="ADQ66006.1"
FT                   /translation="MNISRSSLVPVVLALSLIISGCSAPVSDPSASWSWPEDPPTDRIG
FT                   WEEGYWYNESIAVNQSDGLNETELDAFVARTMARVEHVRQLEFREEVPVEVISRKEYRN
FT                   EANVFRAEPDSWQEQVYEASFLIGEDESVADVLNGLYGGAVAGYYTPGDDQIVIVSNSE
FT                   QPKINRVTLAHELVHALQDQQFGFNPPQETHDARIADNGLYEGDAKYTESLYEERCADD
FT                   WDCVPIPPAGAGGGASFDFGVYLTIYAPYSEGPEFVAALHERGGWKAVNDAYDNIPTTA
FT                   EQIWHPEKYPDEGPTNADVPDRSSTEWSRFDRETVTTRLGEAYLYVMLWDTRAIDRQSL
FT                   RQATGQYSRYNYTSGASAGWGGDTLVPYRSESGEFGYVWAIEWDTEADAEQFDERYRKL
FT                   LLQLRMNAERIDSETYVIRDGPFADAFRVQQNGTRVTIVNAPSVEALDRVHASG"
FT   sig_peptide     381366..381446
FT                   /locus_tag="Hbor_04020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            382782..383204
FT                   /locus_tag="Hbor_04030"
FT   CDS_pept        382782..383204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66007"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW1"
FT                   /protein_id="ADQ66007.1"
FT                   /translation="MHLRKALLVALLVSFAGCSGVPSLSDNGTPTPTQTATSTPTPTAT
FT                   PTPTPTPTPTATPTETISYIDCPGVLSIDSVENVTDDATVIPYANLSAERQSEFDAAVG
FT                   GQSVELDQQGDGYDFWVGRPYVRYNGSVYRATVAIC"
FT   sig_peptide     382782..382856
FT                   /locus_tag="Hbor_04030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            383294..384442
FT                   /locus_tag="Hbor_04040"
FT   CDS_pept        383294..384442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04040"
FT                   /product="nicotinic acid phosphoribosyltransferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66008"
FT                   /db_xref="GOA:E4NKW2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW2"
FT                   /protein_id="ADQ66008.1"
FT                   /translation="MDFDIVGTDAIRDGSATDAYFERTETTLRHAEKNPHVVAEVTADQ
FT                   FPDGDYELLAGVKDAAALLEGHDVDVDAIPEGRLFDGGPVMRIEGSYLDFGRFETSLLG
FT                   FLSHASGVATAALDVRRAAPDSTVLSFGARHVHPALTAMIERSALLAGLDGISHVAAGD
FT                   VLGREASGTMPHALLICFGRGNQEEAWKAFDEAVEESVPRVALCDTYSDETDEVLRAVE
FT                   ALGDDLDSVRLDTTSSRRGDFRHIVREVQWTLNAHDHESVDVFVSGGLGPSDLRHLRDV
FT                   ADGFGVGGYVSNANPVDFALDIVEIDGEPAAKRGKLTGVKEVYRTADGGHHVGLEDADS
FT                   PTDAEPLLEPLIRDGEIVREFDLDAAAARARADAERCGYGAE"
FT   gene            complement(384521..385123)
FT                   /locus_tag="Hbor_04050"
FT   CDS_pept        complement(384521..385123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04050"
FT                   /product="conserved hypothetical protein TIGR00296"
FT                   /note="PFAM: AMMECR1; TIGRFAM: uncharacterized protein,
FT                   PH0010 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66009"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW3"
FT                   /protein_id="ADQ66009.1"
FT                   /translation="MSEAQTVRLTYDDGSRAVELARESVESYVLHGQREQPGSMRDAFY
FT                   ARTGAFVRIRSTRGRGRLRGCAGAYRGKDQLGHAIVDAAIQAASGDSCGSEIEPPELPN
FT                   LNISVCIVCNHVLTNDPVADLELGTHGVAIDKDGKHGWLYPTIPVENGWSAEQFLTHAC
FT                   RKGGLSPLAWQDEDSMVTLFEGQVFRERTDGGSVEEL"
FT   gene            385922..388630
FT                   /locus_tag="Hbor_04060"
FT   CDS_pept        385922..388630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04060"
FT                   /product="heavy metal-translocating P-type ATPase,
FT                   Cd/Co/Hg/Pb/Zn-transporting"
FT                   /note="PFAM: E1-E2 ATPase; Heavy-metal-associated domain;
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66010"
FT                   /db_xref="GOA:E4NKW4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW4"
FT                   /protein_id="ADQ66010.1"
FT                   /translation="MNRDSHDTEEAGHDHGRDHPPSSDDTEACGCDDGCDTDESSTSVA
FT                   SGFDGDGQTLRLSVPEMDCPSCAEKVTKSVRGDAGVRDVDAQPTTGTLYVQYDPTATDD
FT                   SAVRSRVESAGYAIADEETVTFSVPEMDCPSCAGKVENSLDGVSGIVDFETQPTAGKVT
FT                   IRYNPDEASRGDFVAAIEGAGYAVEDDGGADSPHDVWRSQRALKTWGGAAFLAVGLGLE
FT                   FVVEGLDLVLAAPVGYEISVAWVSYTLAVLLAGIPILRNGYYSAKNLSLDIDLLMTAGI
FT                   VGAMAVNMPFEAATLAVLFSVAELLERFSMDRARNSLRELMELSPDTATVLRNSGSSKT
FT                   SQAEREEVVVPVEDVAVGETVIVRPGDRVPLDGTVTEGTSAVDESPITGESVPVDKEPG
FT                   LEVFAGSIVEEGYLEIETTTPASESTLSKVVDMVEDANREKTEAERFIDRFARYYTPII
FT                   VVGAIATATVPPLLFEEPFRMWFVRALTLLVVACPCAFVISTPVSVVSGITSAARNGVL
FT                   VKGGQHLEAMNDVDAVAVDKTGTLTTGELGVTDVVALNGNDESDVLGCAAAIESRSEHP
FT                   IAQAIVEYAADRDVPERDIREFESITGKGVKAVLDDKVHYAGKPGLFESLGFDLEHTHV
FT                   QADGGVRSDGGQAVEDARNCDHGRYLDLANEVVPRLQAEGKSVVLVGTEDEIEGVVAVA
FT                   DTVRPESAWAVSRLHDHGISQVVMLTGDNERTAQVIGERVGVDEVRADLLPEQKVEAVR
FT                   ELLAEHDSVAMVGDGVNDAPALAAATVGVAMGAAGTDTALETADVALLSDDLTRLPYLV
FT                   DLSNGTSSVIRQNVWSSLVVKGALAVAAPLGIISVATAIIVGDMGMSLGVTTNALRLAG
FT                   VDPESAVADAEADPGDAESSVDDSLADTSAA"
FT   gene            388686..389759
FT                   /locus_tag="Hbor_04070"
FT   CDS_pept        388686..389759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04070"
FT                   /product="Matrixin"
FT                   /note="PFAM: Matrixin"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66011"
FT                   /db_xref="GOA:E4NKW5"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW5"
FT                   /protein_id="ADQ66011.1"
FT                   /translation="MSARRSPAVALVLLLVLSGCLAPFSGAESPIPVGDETPSATTSTE
FT                   QAAARTATQNPSTTAAPTGASPWGDDPIVVAVSDPEHTGRDWTPLVRQAAAYWETNAEQ
FT                   YAGYTVEYEVRPDAANPDIVVEFVDDVPDCDGAEDAAGCAPLITDRRQIDTPETVSIQT
FT                   RFSNDSTVLVLEHEFGHTLGLTHDDAPADVMASRSVLYTTPQPNATERAFPWDDGEFTV
FT                   YVDSANATKSEQAREQVQHALDYYERGAEGMPNNLTFTVVDDAENADIVVGFSDESPCS
FT                   PDAASCGATRGWDPDGDGVVETYSNLRIVLVDLDTDAVGWHTGYWLAFGFGAEDDAEKP
FT                   DPFRDASYRERRNEWWE"
FT   sig_peptide     388686..388766
FT                   /locus_tag="Hbor_04070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(390323..390796)
FT                   /locus_tag="Hbor_04080"
FT   CDS_pept        complement(390323..390796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04080"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW6"
FT                   /protein_id="ADQ66012.1"
FT                   /translation="MDETTLLFYSIEEGDEEKFRDLINTVDINTLDESGDNLLHAAAAY
FT                   GQDEFAKELIDRDIDINHRGKEGKTPLHYALEMGYEDMVRILLSEGADVTVTDDYGNQP
FT                   LWSAVVNEETKDDIIQSLVAHGADPANQNDAGKSPRSIARRRDDQALIEIFTD"
FT   gene            complement(390799..391608)
FT                   /locus_tag="Hbor_04090"
FT   CDS_pept        complement(390799..391608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66013"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:E4NKW7"
FT                   /protein_id="ADQ66013.1"
FT                   /translation="MLSDQRLNTSIQRAMEDRMGDTLGDVRIHTGPSAAKACEDINARA
FT                   FTVGNHIAFNHGEYDPSSAEGQHILAHELAHVRQQTGGAVSMLPQAGELEIDPDPRLER
FT                   EAEETAQRVMQGGKIGVHRMANAGIHVQRIKQWEKQKRDEKGKFSELEERYKQPRSGEE
FT                   KDKPYANNRPDYADGQVEAVWEQAKDEDGNVYDPNTGERLEWDRGEPREGQWDMGHKPR
FT                   REYRKLHQKYISGLISKEEFLNRYRDPDNYRPEKPKANRSRKYEGDE"
FT   gene            complement(391631..392593)
FT                   /locus_tag="Hbor_04100"
FT   CDS_pept        complement(391631..392593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66014"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLB8"
FT                   /protein_id="ADQ66014.1"
FT                   /translation="MDAIITGESERIGLSVIDNNDVEHLIETNESGEITYHEQDGYPDD
FT                   SSKRTDEGNEYVNQARKYAKYYVYLKRGYDTVSAPENPVRIDAVRQAIAQMDLETFETH
FT                   FGDLYQQFSSETDGSAEPVYDVPPQATTPPIYAQNVYLGIDPLETDLGDELAAKHDLDI
FT                   TAESAADVAIADLSTEEIKQWGEFTGEFATRAIEEQIDLSDAVYIDNTSQLYVKHPEGT
FT                   DLVAADDHLEPTSREPDTVIELLPIELESLEYFQSFMDHYLRCQIRDVFIEMGVVPPEE
FT                   FRVLGLGQFMAAHCYSYIDFYPEFHNPESGAFTQQTSLF"
FT   gene            complement(393085..393639)
FT                   /locus_tag="Hbor_04110"
FT   CDS_pept        complement(393085..393639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66015"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLB9"
FT                   /protein_id="ADQ66015.1"
FT                   /translation="MQLPSRRVILTSLLTSLVLVVGFTTLLSDDETQILIENERESSYL
FT                   VTAFQSAQESPEKLRFDVTTRDGHQTLVEIEELQTEANYTNVTLHDPVCSDRVSTVSDG
FT                   NSTQFVDDWNESQTTVYVVETYQNELLEVNIMQCDRDMALTFATAPDGDFRTTSRCVQD
FT                   VHGRLSVNRWTLSKQGWIVCK"
FT   sig_peptide     complement(393556..393639)
FT                   /locus_tag="Hbor_04110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(393896..394414)
FT                   /locus_tag="Hbor_04120"
FT   CDS_pept        complement(393896..394414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66016"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC0"
FT                   /protein_id="ADQ66016.1"
FT                   /translation="MAALVADTSALVSLGIVSDSDPNPLSRCLTGYDVSVPKVVIEELR
FT                   EIASYDDAHGHAATVVLDQTAELLVRSVDLDVEFPLDDGENAAVTLANDIDAALFLCDE
FT                   FNSLGLIHASLVDTRLVTTPTLLSVFVRTGQLMPAEACTLLDDISTARSWDTNSYVQRA
FT                   RSVLEDDSS"
FT   gene            complement(394415..394777)
FT                   /locus_tag="Hbor_04130"
FT   CDS_pept        complement(394415..394777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66017"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC1"
FT                   /protein_id="ADQ66017.1"
FT                   /translation="MRLTLYTRKRLSVLAHIVHIMSTDKKRVQFRAPNRLIDRADALAA
FT                   VLGEDRTDVLVTALREYLQDAAHDDALVQEIAAAYYDDEITFEQLKALVGAEEAANLRV
FT                   LKQQLDDSFVDEVADV"
FT   gene            complement(395044..395433)
FT                   /locus_tag="Hbor_04140"
FT   CDS_pept        complement(395044..395433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66018"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC2"
FT                   /protein_id="ADQ66018.1"
FT                   /translation="MGSKLPNSDEYEWEFQKRDNVGVWDIRGWAGFADETLEAVSQHYR
FT                   ERASKEDITATLAIFGDKTNLSAETQEYMAEEWSGNCKYAGVEKVGFVAEGITGMAVKS
FT                   RMKVPQAEIADFDTLDEGLEWAREV"
FT   gene            complement(395693..396148)
FT                   /locus_tag="Hbor_04150"
FT   CDS_pept        complement(395693..396148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66019"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC3"
FT                   /protein_id="ADQ66019.1"
FT                   /translation="MKLRNFDRFVEYTQFDLSEGVGDEFTDIEDQDISGVCSEVDGVWV
FT                   AIYPDSEKNTILVQIDGTTWDLYSPGTEVTYNHDYENGKTSFRIYDNSNTFTTTYDAWW
FT                   QDRPDFDPNKWAASREDENADEDILMLWHRQEKKQHYINNWANEQVD"
FT   gene            complement(396181..396276)
FT                   /locus_tag="Hbor_04160"
FT   CDS_pept        complement(396181..396276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66020"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC4"
FT                   /protein_id="ADQ66020.1"
FT                   /translation="MKDFFGYIKYLSINEEDKNNWIEPWSEALQR"
FT   gene            complement(396463..396648)
FT                   /locus_tag="Hbor_04170"
FT   CDS_pept        complement(396463..396648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66021"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC5"
FT                   /protein_id="ADQ66021.1"
FT                   /translation="MYLKQFNRRSEYTCFDPSDDSVSEFQEIEDEATSGFCKNIDNRWI
FT                   AVYPDADGESLIVHID"
FT   gene            complement(396738..397250)
FT                   /locus_tag="Hbor_04180"
FT   CDS_pept        complement(396738..397250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04180"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66022"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC6"
FT                   /protein_id="ADQ66022.1"
FT                   /translation="MSEDKGPDDLYISTDIESAIIQGNTEEFDELIDDADLTHRSDNGS
FT                   TLLHKAAGADRPEIARELIDRGIDLDAQNNGGHTALLHAIEVESYDTAEVLLEAGADPN
FT                   IFDNKGRCPLSVAVTRGRSDRKFVKLLLEHGADPTATDESGESVLEWVKKHGITDVVEL
FT                   LDPYVDE"
FT   gene            complement(397257..398510)
FT                   /locus_tag="Hbor_04190"
FT   CDS_pept        complement(397257..398510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66023"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC7"
FT                   /protein_id="ADQ66023.1"
FT                   /translation="MRFRSANERTTPSKESSSVPSIQELTGGSNRNRSRGGGGSLTPQE
FT                   CESRFGVEIYMDGLDTKIQRLAKKHGAGQVREWADEGMTVDTIGKPRDMRAFRQRQKER
FT                   PAEVPKDIERRNAKSVQRSRGAHHEASKAGDTQVPDSVRDVISSPGQSLNASIQRVMED
FT                   RMGDNLGDVRIHTGPSAAKACEDINARAFTVGNHVAFNHGEYHPSSAEGQHILAHELAH
FT                   VRQQTGGTVSMLPQEGELEIDPDPRLEREAEETAQRVMQGGKIGVYRMEHSEVHVQRHH
FT                   EDQKRRPNGEFGPLKEEIAKKRTKREEKPYGHDQRPRYEPGQREEVWNRAKGPNGVVFC
FT                   AVDEVPLDRDEWCMGHKPRREYWYLVEYYLRGIITREEFLAEYRNPDHYQPESHRASSS
FT                   GEHEQEGEYWAEKWGPLE"
FT   gene            398567..398926
FT                   /locus_tag="Hbor_04200"
FT   CDS_pept        398567..398926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66024"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC8"
FT                   /protein_id="ADQ66024.1"
FT                   /translation="MCRDGRASGFLRFEFQRSRMPSTAPSFDPEELMTSLEDEFGGREA
FT                   ERRVVARQARDLADSGKVERDRGQPLTVEEVVRQMRDAPDDSTIPERWNWWLGSLEAAY
FT                   GGYREFQVTRIPNGD"
FT   gene            complement(398944..399234)
FT                   /locus_tag="Hbor_04210"
FT   CDS_pept        complement(398944..399234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66025"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLC9"
FT                   /protein_id="ADQ66025.1"
FT                   /translation="MTSVDEATRAKLRKLHDHLAATAERPVERTASAHLGEAEAVAGDV
FT                   ADDPNVAPAVVKSRIETVSNLLSNVEKTGDDAADKHVERARELVAELLSSE"
FT   gene            399411..400100
FT                   /locus_tag="Hbor_04220"
FT   CDS_pept        399411..400100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04220"
FT                   /product="plastocyanin"
FT                   /note="PFAM: Copper binding proteins, plastocyanin/azurin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66026"
FT                   /db_xref="GOA:E4NLD0"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD0"
FT                   /protein_id="ADQ66026.1"
FT                   /translation="MTDSPLTRRRVLRATTGLAVVGLAGCTTGENGDSTNGTATGSHEG
FT                   TATESGHSEGGTASGHHDSDGHEDSHSHEDDGHSHDETVGEPTDTAVVKMLSKDGGYHF
FT                   SPHVVRVTVGGTVTFQNESGSHSTTAYHPDNGQPQLVPDGAAAWDSGILSEQGATFEHT
FT                   FETEGVYHYYCTPHESMGMISTVIVGEPDAHGQPALETSLADKSETVRTKIANLNEQVN
FT                   EALGNTH"
FT   sig_peptide     399411..399497
FT                   /locus_tag="Hbor_04220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(400143..401453)
FT                   /locus_tag="Hbor_04230"
FT   CDS_pept        complement(400143..401453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04230"
FT                   /product="predicted exonuclease of the beta-lactamase fold
FT                   involved in RNA processing"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily;
FT                   RNA-metabolising metallo-beta-lactamase; Beta-Casp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66027"
FT                   /db_xref="GOA:E4NLD1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD1"
FT                   /protein_id="ADQ66027.1"
FT                   /translation="MRLAIKSNMDIRFLGGAREVGRSAILVNDRLLLDYGMLTGNPPQF
FT                   PVDTPEPDAVVVSHGHLDHVGAVPSLLSGDRRPPIHWTPPTRELALTLARDTLKLRGIS
FT                   GRGATGGSQGQRRRGGTYDCPFTEEEIRRVTQVSETHSYRETFEAAGHEVTFYNAGHIP
FT                   GSAHVLIDDGDTRLFYTADFHTDDQRLVSASTARPDADVIICESTYSDVEHERRQRIEK
FT                   RFVESVRTAVWEGGTVVIPAFAIGRTQEMLLVCAANDIDCYVDGMGKQVTKMLRRHPEF
FT                   VRDEDALRRAKSNARFVTGRDGQRRRIAKQNTVIVTTSGMLSGGPAMTYVPEIRSNPTN
FT                   KITLTGYQVEGTPGRDLLERGRAEIDERVMPVSAQVEWYDFSAHADRDGLLELLSAYRE
FT                   APILVNHGDRCELFADELNDDGFDASAPELGEKVTVN"
FT   gene            complement(401562..402752)
FT                   /locus_tag="Hbor_04240"
FT   CDS_pept        complement(401562..402752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04240"
FT                   /product="predicted permease"
FT                   /note="PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66028"
FT                   /db_xref="GOA:E4NLD2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD2"
FT                   /protein_id="ADQ66028.1"
FT                   /translation="MHFGFTSTIDRSRAIWWVLGVAIFVVLAFVADAFLGTFMLGLFLY
FT                   YATRPVYSRIRGRIGQPSIGAAVALLVLSLPVVLLVNYTVLIAVQELSAFVGQNQQGIL
FT                   AALKPYLGSFESLQAPSELLATLLENPSELVDMTDTATVEAVLSSIAGTASFILDAAFQ
FT                   LFIAFAFAFYLLRDDRRLSAWTRENLSGHGGVMDAYMTAVDRDLRTIYFGNILNAFAIA
FT                   VIAAVSYNAINLFAPPSLWIPSPTLLGALTGAASLIPVVGMKIVYVPVTVLLAVEAALT
FT                   APDAFWVALAYGAVSLVVVDTIPDFLLRPYVSGRNLHTGTVMFAYIIGPALFGWYGLFL
FT                   GPLLLVIAVHFVRIVLPELVTGEPLKPDARGRNPLSAIDDEQQKISDFEATSTADD"
FT   sig_peptide     complement(402654..402752)
FT                   /locus_tag="Hbor_04240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(402826..403620)
FT                   /locus_tag="Hbor_04250"
FT   CDS_pept        complement(402826..403620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04250"
FT                   /product="predicted amidohydrolase"
FT                   /note="PFAM: Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66029"
FT                   /db_xref="GOA:E4NLD3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD3"
FT                   /protein_id="ADQ66029.1"
FT                   /translation="MNVAAVQLTAEESVEANVERAVSRVRDAAKRGAELVVLPEMWNVG
FT                   YFAFDAYDDAAEPLDGPTATRLAELADELDIHLHGGSIVERDGDDLYNTSLLFDPAGER
FT                   IASYRKIHLFGYESEESTVLTPGEEVCAVETDLGTVGLTTCYDLRFPELYRQLVERGVE
FT                   LLLVTSAWPAARSDHWHLLTRTRAVENQLFLVAANLTGTNRGVELGGQSVVVDPWGIQR
FT                   ANAGNGDRTVTAEIDRETVEEVRAEFPALHDRRFRGDYTIDE"
FT   gene            403715..404857
FT                   /locus_tag="Hbor_04260"
FT   CDS_pept        403715..404857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04260"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66030"
FT                   /db_xref="GOA:E4NLD4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD4"
FT                   /protein_id="ADQ66030.1"
FT                   /translation="MSGDTRTNRVLSSRGVLAWVDAKLLSVCLTSVAMVVLAGLVQVSF
FT                   GTYSMTIEQAWRAVLDPTVIFDSRWLLNFLVGEELMRFITGFQGELPELANETLIVWSI
FT                   RLPRVFVGILVGANLAISGAIFQAVTRNELASPYILGVSSGAGLAILLTLVVFSGLAPF
FT                   LPLIAAAGGAIAFFLVYIIAWQNGTSPVRLVLAGVIVSTVFQSLQTGIFFFADDLAVVQ
FT                   SAIAWTTGSLTGVDWEQVRLALPSTTLAVILAALGARQLNVLLLGEQTARSLGMSVERT
FT                   RFLLSGVAILAASAAIAAAGIVGFVGLIVPHVVRNLVGSDYKRLMVGCLFVGPALMVIA
FT                   DVGARLAMAPVQVPVGIVTGLIGGPYFLYLMRKQQDLGDV"
FT   gene            404858..405706
FT                   /locus_tag="Hbor_04270"
FT   CDS_pept        404858..405706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04270"
FT                   /product="ABC-type cobalamin/Fe3+-siderophore transport
FT                   system, ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66031"
FT                   /db_xref="GOA:E4NLD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD5"
FT                   /protein_id="ADQ66031.1"
FT                   /translation="MAESEYEHMTVEQTQNKGEQTDVVSALVGDDLTLSYATTDQPVVE
FT                   CDRIDIPRGEITALVGPNGSGKSTLLKALSKQLAPDTGNVLLDGQTIQEYGDKEFAREL
FT                   GLLSQENDSPNTITVEELAYHGRYPHRGFFEQVSEEDEEAVERAIDLAGVDHIRDQTVG
FT                   NLSGGQKQLAWIAMVLAQDTDVLLLDEPTTYLDLHHQLRVMETVQQLNDRRDVTIAVVL
FT                   HDIAQAARFADYLIALQDGEVYDWGPPREVVTEELLADVFRVEAAVSYTPDPEIIPKHS
FT                   L"
FT   gene            complement(405865..406182)
FT                   /locus_tag="Hbor_04280"
FT   CDS_pept        complement(405865..406182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66032"
FT                   /db_xref="GOA:E4NLD6"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD6"
FT                   /protein_id="ADQ66032.1"
FT                   /translation="MGYEELGRSIAVIAATALTFALLALLPRPGYSTSRFVLFGVMAGA
FT                   GWVGAFGVVTNRLGVALVGVIGLFLFGFWQFTVGLAALPVAVALLVSAAATGPTRSNAT
FT                   A"
FT   gene            complement(406253..407419)
FT                   /locus_tag="Hbor_04290"
FT   CDS_pept        complement(406253..407419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04290"
FT                   /product="Cdc6-related protein, AAA superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66033"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD7"
FT                   /protein_id="ADQ66033.1"
FT                   /translation="MNLEERILQRKRRGDRRQLVLEEASLSPVWHSPEPTGRGPTIERL
FT                   LDRLEPVFEHRTPENVYVHGPAGSGKSAVVSALFSQFTRLLSSPEDSIVTTTRGGSADT
FT                   RSFAYVDLREATSEFEFYHTILDAMTSESIPQRGLSTTDLRTRVSRHLRGGRILVVAMD
FT                   HADENGTDRLASFAGELESLGHRTSWVAVGRTDPEEVLPDPRATRTVTVEPYHRAELTD
FT                   LLTARVSTGLTRNATTHQQLRRLAAWADGDAHDALAALLGAVDIALDDDSGVIEDDHLD
FT                   AGMESVPRPCIALGRVLTLSENRLTVLRRLVALDATDRSSVGRAASTIASAASLSESTI
FT                   TRYLYEFAESGIVERVPVKETNGAGRPPSRVETRVPTRAFLRLTRGAD"
FT   gene            complement(407493..408563)
FT                   /locus_tag="Hbor_04300"
FT   CDS_pept        complement(407493..408563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66034"
FT                   /db_xref="GOA:E4NLD8"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD8"
FT                   /protein_id="ADQ66034.1"
FT                   /translation="MNELMLQLPVIDMGAEAFAVLFITALAGGAFGAAIGALPAFIFTG
FT                   FVVFLGEGLAILEGNLATLSGIPGGEVATGLTGVIGFGAITGPHIAFAGGVAASAYAGK
FT                   KYPEMGPEEGYHFGKEITYAFGTKPDILAVGALFGGLGAIINQIAIGLGFPTDTIALTV
FT                   FLSAMIARVVFSYPLIGSAAGNSLLDMSPFERGEERVATDGGVETVRPATEPWLPHQYK
FT                   WSGVTVIGLVGGILGGYIWLKTGSFFLGYGISAMSLLFLNLGVEKIPVTHHITLMGASG
FT                   AAVAAATVGSPIAILLAAGVFGALSGLLGELTQRIFYSHSGTHVDPPAMAIVLVTVLIA
FT                   VLYFAGVIPTSVYLPL"
FT   gene            complement(408567..410102)
FT                   /locus_tag="Hbor_04310"
FT   CDS_pept        complement(408567..410102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04310"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66035"
FT                   /db_xref="GOA:E4NLD9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLD9"
FT                   /protein_id="ADQ66035.1"
FT                   /translation="MTEDTYVGAIDQGTTGTRFMVFDHDGRVVANAYQKHEQIYPEPGW
FT                   VEHDPEEIWENTQAVMLTALEEAGLDAEQLDAIGITNQRETTLIWDKESGRPVYNAIVW
FT                   QDRRTTDRVETLQDEGKEEWVREKTGLEPDAYFSATKAEWLLDNADPIKLARMRPDDVR
FT                   ERAEEGELMFGTIDTWVTYKLTGAHVTDVTNASRTMLFNIHDMDWDDELLEEFDVPKAM
FT                   LPEVRPSSDEDLYGTTDSDGFLEAEIPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSF
FT                   MLMNTGDEAVMSEHGLLTTVGFQRSGEPVQYALEGSIFITGAAIEWLEDVSLIDDAAET
FT                   EELARSVDSTDGVYFVPAFTGLGAPHWDQRARGTILGMTRGTRREHVVRATLESIAFQT
FT                   RDVAEAMEEDSGIDLSTLRVDGGAVKNNFLCQLQSNIVGTDIVRPMVDETTALGAAYAA
FT                   GLAVGYWSNLDELRNNWQVDREFSPDDDAENVDGRYGRWKEAVDRSLDWAREE"
FT   gene            410457..411881
FT                   /locus_tag="Hbor_04320"
FT   CDS_pept        410457..411881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04320"
FT                   /product="NAD(FAD)-dependent dehydrogenase"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   Pyridine nucleotide-disulphide oxidoreductase, dimerisation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66036"
FT                   /db_xref="GOA:E4NLE0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE0"
FT                   /protein_id="ADQ66036.1"
FT                   /translation="MSDPFVVVGGDAAGLSAASKCRREDPERAVLVFEKGRWVSYAHCG
FT                   TPYFVKGEVDSLTDLLSLSPADIEDRGIDLRREHEVVAVDTDAQTVTVRGPDSKFTQSY
FT                   GDLLVATGGSAVSAPIEGFHLDGAFTMHGLDHAAAVRAFLADPGEFSVGDLGGATDVDR
FT                   DMAARYGAMEPPETVAVVGGGYVGVEMAEAFSAHDLDVHVFQRPNRLLSPFGEAVGERV
FT                   ADHLREQGVTLHLGEEVAALRGEGQVETVVCGSGTKLAVDAALVGIGIQPNTALIEETP
FT                   VELGDSGAIATDEFGRTTVENVYAAGDVAEMRHVVTDDPTWDPLGLPANRAGRAIGSTV
FT                   AGTPEPVGGVAGTAVVKAFELECGRAGILDYERARTAGFDPVSETITAGSRSGYYPGGS
FT                   ETTVTLTADRSSGRLLGGSIVGADRAAIRIDTIATALGSKMTVAELERQDLAYAPPFSP
FT                   VWDPILVAAKVLGGRL"
FT   gene            411967..412614
FT                   /locus_tag="Hbor_04330"
FT   CDS_pept        411967..412614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04330"
FT                   /product="archaeal flagellin-like protein"
FT                   /note="PFAM: Archaebacterial flagellin; TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66037"
FT                   /db_xref="GOA:E4NLE1"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE1"
FT                   /protein_id="ADQ66037.1"
FT                   /translation="MRLVCREDSVGHTGRRGQVGIGTLVVFIAMVLVAALAAGVLIHTA
FT                   SFLQATAEDAGKESIDRVVNGVEVVTTAGHVTDGDDGSVDTVRLWVRPRPAAGDINVSR
FT                   LTVKWVGEQAGQSLTFSGTDPVSPSTASDAHTTFNASESIGDGDKILEQGEEFVLYFNV
FT                   SQIESGDADPANLAPLHPGDQATTEITVATGSTSAAYLTVPDYSGNATYVRL"
FT   gene            complement(412618..412803)
FT                   /locus_tag="Hbor_04340"
FT   CDS_pept        complement(412618..412803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66038"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE2"
FT                   /protein_id="ADQ66038.1"
FT                   /translation="MSQTACDYCGCDVTAHAPVYVEELVDGTRTQTGAFCTYGCLAAHI
FT                   EHEGLATGTTCRVEFE"
FT   gene            complement(412895..413488)
FT                   /locus_tag="Hbor_04350"
FT   CDS_pept        complement(412895..413488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04350"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family;
FT                   Archaeal TRASH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66039"
FT                   /db_xref="GOA:E4NLE3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE3"
FT                   /protein_id="ADQ66039.1"
FT                   /translation="MRELDETDLQILELLTEDARRPFSDIAEQVDLSPPAVSDRVDKLR
FT                   ESGVIRRFTLDLDRSQLRAGVPVLVRLDLPSTEVAAVTDNLRESEGVEHVFVTVEGDVV
FT                   FSARFRSDAVREGIDEVVDLKRVTDYDVTIVSEMEWVPSVGGTEFALTCAECGNTVTSE
FT                   GESDRIGGNQYHFCCPSCAARFREQYERFSADAE"
FT   gene            413732..415036
FT                   /locus_tag="Hbor_04360"
FT   CDS_pept        413732..415036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04360"
FT                   /product="PKD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66040"
FT                   /db_xref="GOA:E4NLE4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE4"
FT                   /protein_id="ADQ66040.1"
FT                   /translation="MKRQQTVILVAVATVVAVGGGAILFTDQGGEADASTAANDASAAV
FT                   GESTPTAQSSNSNNQQTETSGESDSSESGDVTSGADDSDTTSSSSNSTDAQSVERANEP
FT                   PTAEAGANRTVPEWLRVHFDATSSSDPDGNDANLTYEWTQIDGPAVDIVDADTAKPNIL
FT                   TPEIVYRTDLTFQLTVTDEAGETATDTVTITVRPPDRDDSDDEQTESDNSTDESDNSTD
FT                   ESDDSDSEQPSDPNDDAGDSDDDSDDSSDDSGDSDDSDSGDSDDDAGDTETTRDDIAQA
FT                   VFDSNFDGLNAADAAVVEEFYMRQPDGDWDLSTVQTRDELAQEEYGSDYDELGFDARVD
FT                   VQTAFDAQFDDTGGALSKDEISQAKWGYDFDELSNESAGQITELYDRQPWADRETEHVR
FT                   TREQWSQRLYDSTLSDLTRDARLDVERRYNNQFDD"
FT   sig_peptide     413732..413809
FT                   /locus_tag="Hbor_04360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            415190..415387
FT                   /locus_tag="Hbor_04370"
FT   CDS_pept        415190..415387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04370"
FT                   /product="copper chaperone"
FT                   /note="PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66041"
FT                   /db_xref="GOA:E4NLE5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE5"
FT                   /protein_id="ADQ66041.1"
FT                   /translation="MSQTLTVEGMSCGHCEQTVEDALSNVDGVESAAADHESASVTVRG
FT                   DVSVNKLVTAVEDAGYDASA"
FT   gene            415460..416140
FT                   /locus_tag="Hbor_04380"
FT   CDS_pept        415460..416140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04380"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase (PCMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66042"
FT                   /db_xref="GOA:E4NLE6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE6"
FT                   /protein_id="ADQ66042.1"
FT                   /translation="MARDERGRGVYDWWSGHQRLFGVLSTLLLFGKGDDARARGVTSLA
FT                   LDPGDTVLDVGCGPGVNFPALREAVGPDGTVVGLDYSAGMCHRARKRVRKAGWENVHVV
FT                   RGDAARPPFETPFDAAYATLSMTAMPEATAVIDAVYDSLRPGGRFVVVDTRPIQDAPWD
FT                   RLNPLFTPISRLATNWLPDVDVVGALRDTFETYSLTEYNGGTLYVATATREDGRAADTT
FT                   PLQE"
FT   gene            416204..416620
FT                   /locus_tag="Hbor_04390"
FT   CDS_pept        416204..416620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66043"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE7"
FT                   /protein_id="ADQ66043.1"
FT                   /translation="MSDDHDSLSQHDPDISDAEREALHELQLGIEHVYRGYGTLLTFHH
FT                   QVGHAMDHLANAEAYLREAGHKEWANILRDHHLPAGAVDDQWTYELVQAFREGLLQDVA
FT                   DFEHDVRDDLVDGLDHVTERQQQSQWRERAGWDE"
FT   gene            complement(416902..417198)
FT                   /locus_tag="Hbor_04400"
FT   CDS_pept        complement(416902..417198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66044"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE8"
FT                   /protein_id="ADQ66044.1"
FT                   /translation="MPNRLLRVNAYTTFDMLDAEAVGHDFTEEAFAVLNVTAPRKNPDH
FT                   VRLELELDNSQLDHLPAHADKVTLSASEARELSEELASYAERVEKAQQETDGE"
FT   gene            417298..417960
FT                   /locus_tag="Hbor_04410"
FT   CDS_pept        417298..417960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04410"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /note="PFAM: Protein of unknown function DUF124; TIGRFAM:
FT                   conserved hypothetical protein TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66045"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLE9"
FT                   /protein_id="ADQ66045.1"
FT                   /translation="MQFEIADGHSYATLEIDFDEGERVGIEPGSMVTRSENVRVETTSG
FT                   DDGIGGMLKRAVSDEIDVMTTYFIAESDGAHALLAPDYLGDIARVELDGTEGVKVQSGG
FT                   LLAWSEGVERGTARNEASNFFSSGELTVLKLDGKGSAFISAFGAVRKETVTAEDPLIVD
FT                   EDHLLAWTDGLSASRQKDSNLTSSLLGGEGFVTKLSGEGSAWVQTRDPMVLFGPSGN"
FT   gene            complement(417989..419761)
FT                   /locus_tag="Hbor_04420"
FT   CDS_pept        complement(417989..419761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04420"
FT                   /product="sulfite reductase, beta subunit (hemoprotein)"
FT                   /note="PFAM: Nitrite and sulphite reductase 4Fe-4S domain;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66046"
FT                   /db_xref="GOA:E4NLF0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF0"
FT                   /protein_id="ADQ66046.1"
FT                   /translation="MPTDVERWKSEVYGNEIREHLYEFAEEGWDAIPEDEHDEWFERFK
FT                   WWGLYHQRNGQESYFMMRIGTPNGVLEPGQLRVVGEIAAEYATGPGTNPIFGDAYADFT
FT                   TRQSIQLHWINIEDVPAIFEKMEKNGLSAQQACGDSWRNIVGNPVAGKDAQEVIDAWPV
FT                   IRELNETFKGNEDHSNLPRKWKVSVTGSADGSGQGDINDLAFEPAYKEVDVEEKVGFNV
FT                   RVGGGLARNEERFARDIDVWVAPENVSDVAGGLSALFRDNGDRENRYNARIKFLVDEWG
FT                   PEKVRNVLQEEYVDFELHTAGRDVREEYTYNTGSGGRNDLIGVHEQKDGNYFVGLNVLV
FT                   GRMGAEDVLELADLADEYGSGEVRLSQRQNVIVTDVPEEDLDDFLGEDLLEHYSPDPSP
FT                   FMRGSVACTGTEFCSLSIVETKNRQVRYARWLKENVELPDDIDQFHIHLSGCTASCAQP
FT                   QIADISLRGMKTRKNGEPVEALDVGLGGGLGEEPQFARWVTQRIPVDEVPGAISNLLDQ
FT                   FKANREDGESFREFVARHDDEELDEFVEPEETDYEDPMMHNTKMTWYPYADEDSMDASP
FT                   APTFPDDSPMSADD"
FT   gene            complement(419853..420164)
FT                   /locus_tag="Hbor_04430"
FT   CDS_pept        complement(419853..420164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66047"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF1"
FT                   /protein_id="ADQ66047.1"
FT                   /translation="MAVALRILDDGAWISVNDDRKVSVSELWRFPDPDFCGCDLTDMVV
FT                   EGFVEVGVDGRTVEVRAYGQCIACGAAETTDWTPVGRIVNGTFRHLDRESVLKPVAKN"
FT   gene            420477..420647
FT                   /locus_tag="Hbor_04440"
FT   CDS_pept        420477..420647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66048"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF2"
FT                   /protein_id="ADQ66048.1"
FT                   /translation="MNSGDYDSEQETDTEEDTADVSENDTTDDDYEHLKSLDDGVGCTE
FT                   IWEHLSESRDG"
FT   gene            420825..421511
FT                   /locus_tag="Hbor_04450"
FT   CDS_pept        420825..421511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66049"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF3"
FT                   /protein_id="ADQ66049.1"
FT                   /translation="MTDDDSVTDGGRRNSLPADREEPVGEPVVRADPAVTGERAREAVG
FT                   FDPDDPESVAEAAETVRAFSENTIGSEDNVYMLRGAAACAALVRGVGSYKAAAARAGGD
FT                   VSVSFIRKWARVHDLPQAVRRHVARGHIAPTAAKHIARVSGPDRFDLAWAVLDGDLTVR
FT                   EVRRVASEVNDGRPVADALTERGVRPGRLELSISTDHYRELRRRASLENRTPGDIVDEA
FT                   LDDYLG"
FT   gene            complement(421546..422814)
FT                   /locus_tag="Hbor_04460"
FT   CDS_pept        complement(421546..422814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04460"
FT                   /product="acetylornithine
FT                   deacetylase/succinyldiaminopimelate desuccinylase-like
FT                   deacylase"
FT                   /note="PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66050"
FT                   /db_xref="GOA:E4NLF4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF4"
FT                   /protein_id="ADQ66050.1"
FT                   /translation="MREHSNEVPLTEFVDRFLRFETTDGDEAEAQSWLRDQFEAFGFDT
FT                   YEWTADADRLASHPSFPDDSAEIRVADRPSVAGVVTFGDPDAGPTLVLNGHCDVVPVDR
FT                   ENWSSDPFDPVWSDGEVTARGAADMKSGLAACVFAVRDLQERVGDGELDGLDGRVVVES
FT                   VVGEEEGGIGAAAAALDNPYPFDRDAAIVAEPTELRCVTATEGTVMKRLRLRGRAAHAA
FT                   TRWNGEDVLPHFERIRKAFFELESERSESVSHPLYDAFPIPWPVCIGTVRAGSWASSVA
FT                   GTLTAECRFGVAPGETVDEVEEAYEARLAEVVAESDWLSEQPPTFERFSIQFEPAEIDA
FT                   DEDVVRSLQTAMGVTGHDTTDPVGATYGADSRHYVAAGIPTVLYGPGSIEQAHFPDETI
FT                   NWDDVETARETYTEAAAEFLLSG"
FT   gene            422895..422968
FT                   /locus_tag="Hbor_04470"
FT   tRNA            422895..422968
FT                   /locus_tag="Hbor_04470"
FT                   /product="tRNA-Lys"
FT   gene            complement(423125..424924)
FT                   /locus_tag="Hbor_04480"
FT   CDS_pept        complement(423125..424924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04480"
FT                   /product="oligopeptidase F"
FT                   /note="PFAM: Oligopeptidase F; Peptidase family M3;
FT                   TIGRFAM: oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66051"
FT                   /db_xref="GOA:E4NLF5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF5"
FT                   /protein_id="ADQ66051.1"
FT                   /translation="MSSVPERSEIDSEYKWDLESIYASDDEWETAFEDVQERLSEIAAY
FT                   EGRVTESPETLLELLELQEEIMREVSKVANYASLRSAEDTRDQEYQALQAKAESLSSEA
FT                   QSTVSFVEPELQELSEADVESFIETEPELVDYEHYFDDVLRMKPHTRSAEVEEVLAELG
FT                   EVASAPSDIFGMLSNADMTFPTVENPEGEEVEISQGNFTKLQKHPNRQFRREVYQQFYD
FT                   EWGDVRNTVGTALKNSVKKDVKYANARNYETAREAALDGTNVPVEVYDNLVETVRDNLD
FT                   YLHRHAELKRGALGVEELEMWDLYMSLTGDEGPEITYEEAKEYIIEAVAPLGEEYQSQL
FT                   AQGLEDRWVDVYENRGKRSGAFSSGTYDTQPFIMMNYQEDISSMFTLAHELGHSLHSEL
FT                   AKEEQPWHYADYTIFVAEVASTVNETLLTQYLLENVEDDEFRMHVLDEYLERFRSTLYR
FT                   QTMFADFEHQMHTISEEGGALTPDRLDQLYGDLKREFYAPANVDDRIAREWMRIPHFYY
FT                   NYYVYQYSTGISAAVAIVERILNEGEDAAADYRDALALGGAKYPIEVLETAGVDMASPE
FT                   PIESALSVYGDYLDEMAGLLDTE"
FT   gene            425306..425464
FT                   /locus_tag="Hbor_04490"
FT   CDS_pept        425306..425464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66052"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF6"
FT                   /protein_id="ADQ66052.1"
FT                   /translation="MGGDVFVMPNHFGSSENQTDSIARLYNDWCRVRGQITASPVEMEI
FT                   DGVLDFY"
FT   gene            complement(425472..425627)
FT                   /locus_tag="Hbor_04500"
FT   CDS_pept        complement(425472..425627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66053"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF7"
FT                   /protein_id="ADQ66053.1"
FT                   /translation="MPKCDNCGSFVTTEYVRVFAPEGMNNPRVCPSCEDKVRDGGDVRE
FT                   ARATRH"
FT   gene            425792..427117
FT                   /locus_tag="Hbor_04510"
FT   CDS_pept        425792..427117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04510"
FT                   /product="predicted aminopeptidase"
FT                   /note="PFAM: PA domain; Peptidase family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66054"
FT                   /db_xref="GOA:E4NLF8"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF8"
FT                   /protein_id="ADQ66054.1"
FT                   /translation="MDNHNKERNAALGRAWTDDESWDFLTRLTRIGNRMGGSNGERRAA
FT                   TLVAEAFRDAGVCDVHTDPFEMQAWSRGRSRLSLEADGRAFDTVALPYSPSGDVTGELV
FT                   YVGHGTPDEVDEHDVAGKIVVASTTTPPGGRFVHRMEKFGYAIDAGAEAFVFVNHVPGQ
FT                   LPPTGALKFGEEAVAPAVGVSKESGAWLKDDAEDGTMARLTVEAETTTGESQNVVGRLG
FT                   PDTDEEILLLAHYDAHDIAEGALDNGCGIAVVVTAARILAQFDLSVGVRIAGVGCEETG
FT                   LTGSEHLAEQLAHDRIKAVVNVDGAGRFRDLIAMTHTSEATASVAERVADETRHPIQIE
FT                   TEPHPFSDQWPFARAGVPALQLHSDSGERGRGWGHTHADTRDKVDDRNIREHAMLTALL
FT                   VAELAGEDEVPRLDTEELAAAFRDAGFETGMRAADLWPDAWE"
FT   gene            complement(427158..427403)
FT                   /locus_tag="Hbor_04520"
FT   CDS_pept        complement(427158..427403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66055"
FT                   /db_xref="GOA:E4NLF9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLF9"
FT                   /protein_id="ADQ66055.1"
FT                   /translation="MSDDPADSFAVSESAISVGARHLTVAFVIFAVGNFVAERIGGIAD
FT                   EIGFGVFVYAIIMIPVVYFAARQFLRGIAIAVDGVR"
FT   gene            complement(427521..428183)
FT                   /locus_tag="Hbor_04530"
FT   CDS_pept        complement(427521..428183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04530"
FT                   /product="haloacid dehalogenase superfamily enzyme,
FT                   subfamily IA"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66056"
FT                   /db_xref="GOA:E4NLG0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG0"
FT                   /protein_id="ADQ66056.1"
FT                   /translation="MRHARMCYDAVIFDNDGVLTRPTATTVHREAVRAAFSEFGVEPTT
FT                   EGVDSVIHGSFARVQRICEIHDVDYEAFWPRREANAAAAQAAAIERGEKTLYDDVSVLS
FT                   DLDRTMGVVSNNQHETVETILDAFELRDQFEVAYGRSPTVEGYRNRKPSPHYLERAIDE
FT                   LDAESVLYVGDSNVDVLAATRAGADSAFIRRPHRDDYQLAANPTYEVESLDDVVAIC"
FT   gene            complement(428298..429116)
FT                   /locus_tag="Hbor_04540"
FT   CDS_pept        complement(428298..429116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04540"
FT                   /product="pseudouridylate synthase I"
FT                   /note="PFAM: tRNA pseudouridine synthase; TIGRFAM:
FT                   pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66057"
FT                   /db_xref="GOA:E4NLG1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG1"
FT                   /protein_id="ADQ66057.1"
FT                   /translation="MRAFRIAYDGRPFYGFQRQPSVPTVEDSIFDALRSLGVLDEDARK
FT                   PTGYAAAGRTDAGVSALAQTVAFDCPEWCTPRAMNAELPESVRAWAAADVGERFHATHD
FT                   AARRAYVYDLYAPEADESKAQAAADALTGEHDFHNLTPDDTGTVRDVTVSVEADGEFLV
FT                   LSVAAGGFPYNLVRRLASIVHSVATGDRPLADIETVLGPETVPGPEGVPTAPAEPLVLE
FT                   RVVYPGVTFERDPEAVESAAGVFEKRRRDGLIRTRVAGRIRRGIEGDSER"
FT   gene            complement(429204..430499)
FT                   /locus_tag="Hbor_04550"
FT   CDS_pept        complement(429204..430499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04550"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66058"
FT                   /db_xref="GOA:E4NLG2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG2"
FT                   /protein_id="ADQ66058.1"
FT                   /translation="MYDRLKGFRDFYPDEMSARRQVFDAVEDAAARYGFREIATPRLER
FT                   TQMYVDKSGEEIVEELYAFEDKGGREVSLTPELTPTVARMVVAKQQALSKPIKWVSSRP
FT                   FWRFEQVQQGRFREFYQTNVDIFGSSEPEADAEILAFAADALTSLGLTADDFEFRVSHR
FT                   DILGGLLDSFDADVDTRNAIRAVDKRAKVEDEEYLGLLSDAGLSYDQAREFDNLIVAGD
FT                   LDAIAEFGGDDVKDAVENLRAVLAATEDFGVRQYCDISLTTARGLDYYTGVVFECFDST
FT                   GDVSRAAFGGGRYDNLIEDFGGQPTPAVGVALGDATLQLLCERADVWPEEELQTDYYVL
FT                   TVGDTRAVASRVARDLRDRGNVVEMDVADRSFGAQMGYADSINAETVVIVGEQDLENDE
FT                   VTVKDMDTGDQTTAPVSDFPGDRDRPTYDDFA"
FT   gene            complement(430585..431781)
FT                   /locus_tag="Hbor_04560"
FT   CDS_pept        complement(430585..431781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04560"
FT                   /product="WD40-like repeat protein"
FT                   /note="PFAM: PQQ enzyme repeat; FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66059"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG3"
FT                   /protein_id="ADQ66059.1"
FT                   /translation="MPDWSRRDILLALGVTGTAGGGWYLAEEPHCASPLEPGWTYHGDY
FT                   WGPVVETENALLVPEGYGTTGGDQHRLAALNHHGQAEWTTVSEGGGFGVPAVHENRVYI
FT                   GTGDDTVRALDAATGRIEWTYDAGGVEEYGGGAWGQPLVADGRVYVGISHSNKPDPDPS
FT                   DESQYTHRVVALDSTDGSELWATEVTAMVEHGPALASDIVVSGSEDSVLRGFNPETGDV
FT                   RWTVSLPGKTWWQPVFVNESLVFATTETVAKVNAAEGTVQQTKNPLDEMASFDHDEDTV
FT                   YLGGTSGRVVALTATPEAETSEWSVKWEYDAEISVGAIAAGDAGVFVVDQSGYLHRVTD
FT                   EGRRGNRVPLVESRYEDRCGWMIDSPDEKIESAHLDSWRSWLYVSTVGWVRPFDVGDV"
FT   sig_peptide     complement(431719..431781)
FT                   /locus_tag="Hbor_04560"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(431829..432746)
FT                   /locus_tag="Hbor_04570"
FT   CDS_pept        complement(431829..432746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04570"
FT                   /product="EamA-like transporter family"
FT                   /note="PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66060"
FT                   /db_xref="GOA:E4NLG4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG4"
FT                   /protein_id="ADQ66060.1"
FT                   /translation="MDLLFDAAALQSGALSLPPGIAYAVVAAFVWGTYIFALKRYFDDY
FT                   PGTVFTVVVNVAAVLWYLPITLSTPTAEIPDAGTFGIGDAGIILLTVVMTATAFLVFLS
FT                   ALDAGEVSYVAPINKIVPVFVLPIEILFLHEQLRPIQLVGVGVATLAVYVANYRSGSLL
FT                   DPLKKAATARPAQLALVSALCYAIGDVGKRLVLQEMNIPPTIWVPTLLGGVVVVLLPLV
FT                   VRDWVSVRGDLPKFALAGAGVALGEHLTSLAFAVAPASIASPVVNTQAVVAVLLGGVLL
FT                   RERAFGTRLVAAALAVIGVALIAL"
FT   sig_peptide     complement(432675..432746)
FT                   /locus_tag="Hbor_04570"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(432829..433419)
FT                   /locus_tag="Hbor_04580"
FT   CDS_pept        complement(432829..433419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04580"
FT                   /product="predicted subunit of
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66061"
FT                   /db_xref="GOA:E4NLG5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG5"
FT                   /protein_id="ADQ66061.1"
FT                   /translation="MELALLYSGGKDSTLAALLLDSFYDVTLVTAHFGITDDWVHARDA
FT                   ADRLGYEFDVVELDEAVAREAAEQMVNDGYPRNGIQQVHEHALERIAELDVAAIADGTR
FT                   RDDRVPTISRAQAQSLEDRHDVDYLAPLSGFGRRAVDRLVDSTLNVESGPSERITKGDY
FT                   EAELRAMIADKHGQDTVESVFPDHVQTYVRGLK"
FT   gene            complement(433425..433784)
FT                   /locus_tag="Hbor_04590"
FT   CDS_pept        complement(433425..433784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04590"
FT                   /product="DNA-binding TFAR19-related protein"
FT                   /note="PFAM: Double-stranded DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66062"
FT                   /db_xref="GOA:E4NLG6"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG6"
FT                   /protein_id="ADQ66062.1"
FT                   /translation="MSGNPDDERLEKLRQEKMEELQERAEGQGGQQNEAAQEAARERAE
FT                   AQKDALLKQYLTDGARQRLNAVEMSKPDFAEKVKQQLVALAQSGRIQDRIDEDQMKDLL
FT                   RELQPDSKSFNIRRR"
FT   gene            complement(433890..434345)
FT                   /locus_tag="Hbor_04600"
FT   CDS_pept        complement(433890..434345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04600"
FT                   /product="SSU ribosomal protein S19E"
FT                   /note="PFAM: Ribosomal protein S19e"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66063"
FT                   /db_xref="GOA:E4NLG7"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG7"
FT                   /protein_id="ADQ66063.1"
FT                   /translation="MVTLYDVPADALIEDVADRLEDRIEEPEWMAFAKTGQTRELPPQQ
FT                   DNFWYVRTASLLRKVAMNGPVGVDRLSTEYGGRKRGTNRYVVSGKHSDTGSKNIIRTAL
FT                   QQLEEEGLIRTAQGEGRVITDEGRSFLDNAAADVFESLDRPELERYA"
FT   gene            complement(434433..435521)
FT                   /locus_tag="Hbor_04610"
FT   CDS_pept        complement(434433..435521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04610"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Uncharacterised protein family (UPF0104);
FT                   TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66064"
FT                   /db_xref="GOA:E4NLG8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG8"
FT                   /protein_id="ADQ66064.1"
FT                   /translation="MRCGFDGLIATTANVRDMARENLRATALGFLGAFVVFVLLFYFAG
FT                   VDELIDTFQKAEAAPVGLVILVTLVWLAAWSFSLKTVLDILGVSVTFPKAFFIFAGAMF
FT                   SNNVTPFGQAGGEPVTAYLISQASDAEYETSLAAIASVDTLNFVPSITIALVGAGYYAT
FT                   EVTLGTNRNLLLALVAVVALAVVVPSVGYVAWQRRYRLEDRVVSAFVPLIQTVARYAPR
FT                   VPVPTEDGIERRINGFFRAIERIATNPRGLALALGGSAIGWFCQMLGLWLSFRAIGIEV
FT                   PLSIAMLVVPIGAIAGVTPLPGGAGGIESVLVVLLLAVPLPSVTKSVAVAAIVIFRGAV
FT                   YWLPTLLGGGVMAWVSLGGSRS"
FT   gene            435542..436468
FT                   /locus_tag="Hbor_04620"
FT   CDS_pept        435542..436468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04620"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66065"
FT                   /db_xref="GOA:E4NLG9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLG9"
FT                   /protein_id="ADQ66065.1"
FT                   /translation="MAVDGEFFVGRVVRRDMDERSALRLLAADLPDAGDDAAVVDGLVV
FT                   TTDMLHESTDFPAGTTRYTAGWRSVAASLSDVAAMGADATAAVAAYGAPSLEESELRDF
FT                   VRGAREVCAAVGAEYVGGDLDTHEEFTVATTALGETDNPLLRSGATPGNVVCVTGALGR
FT                   SAAALRAFEAGDCDRANDLFRFTPRVAAGVALRPYATAMMDSSDGLARSLHQIAEASDC
FT                   GFAFEWDALPVHDAVTEYARDTDDERAMAAYFGEDFELVFTLPADAVDTARDALSIPIT
FT                   VVGQVTDEQIVANGDPVPDEGYTHADD"
FT   gene            complement(436494..437633)
FT                   /locus_tag="Hbor_04630"
FT   CDS_pept        complement(436494..437633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04630"
FT                   /product="predicted membrane-associated Zn-dependent
FT                   protease"
FT                   /note="PFAM: Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66066"
FT                   /db_xref="GOA:E4NLH0"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH0"
FT                   /protein_id="ADQ66066.1"
FT                   /translation="MDPVDSAEIPPIEALQSVFSLHETRRDGERILYYGESLVPEQMLV
FT                   REVWPSFRQAGYEIQVATTPAGREDIIVARPVTNGTDGIPWKNLGLFFATVLSTMIVGA
FT                   LAWYHVPGSEILSNPATVLQAWPFTAAVLGVLTTHELGHYALSRYHGVDVSLPYLIPFI
FT                   VPFGTLGAIIQMRGQIPDRKALFDIGVAGPLAGLAATIVVTAVGLSLPPMTVPESMVRG
FT                   SGQVIIFNNPPLLNLIAAILGEQTSYPDPTTTAHPVIIGGWVGMFFTVLNLLPVGQLDG
FT                   GHIIRAMLGEAQERLAAFVPIALFGLAAYLHYGLGYSFNESVGIWAFWGFLSIFIAYRG
FT                   PADPIDDAPIGPARMAVGLLTFALGALCFLLVPIEMMTV"
FT   gene            complement(437857..438117)
FT                   /locus_tag="Hbor_04640"
FT   CDS_pept        complement(437857..438117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66067"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH1"
FT                   /protein_id="ADQ66067.1"
FT                   /translation="MSATANPSTEPTANELSKEDRLKQYLQEKAQDGEMYFKSKFIADE
FT                   VELSPKEIGALMVKLRDSATELTIEKWSYTSATTWRVEPSA"
FT   gene            complement(438429..439214)
FT                   /locus_tag="Hbor_04650"
FT   CDS_pept        complement(438429..439214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04650"
FT                   /product="molybdopterin synthase subunit MoaE;molybdopterin
FT                   guanine dinucleotide biosynthesis accessory protein MobB"
FT                   /note="PFAM: MoaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66068"
FT                   /db_xref="GOA:E4NLH2"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH2"
FT                   /protein_id="ADQ66068.1"
FT                   /translation="MHVLGAVGPGATALLERIIPHLDGRVATVESGDWNDEPTPLSDVE
FT                   TAYTLGDDSSWRASGTERPLERVLDDLSTRHDYALLSRFPEATVPTVALGGADAANAVL
FT                   EAADGDELDTDDIVAAMEASEPHVTLSTLVEQVKQSPRADRAGAIATFTGRVRAKEGDD
FT                   DARTTQLTFEKYDGVAEEKMRTIESEIAARDGVEEVTMFHRTGVIEDGEDIVFVVVLAG
FT                   HRRESFRAVEDGIDRLKDEVPIFKKETTVEEDFWVHDRD"
FT   gene            439338..440057
FT                   /locus_tag="Hbor_04660"
FT   CDS_pept        439338..440057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04660"
FT                   /product="uridylate kinase, putative"
FT                   /note="PFAM: Amino acid kinase family; TIGRFAM: uridylate
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66069"
FT                   /db_xref="GOA:E4NLH3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH3"
FT                   /protein_id="ADQ66069.1"
FT                   /translation="MRVVVSIGGSVLAPDLDARRVEDHADVIEHLAREGVELGAVVGGG
FT                   GVARDYITAARDLGANEVQLDQIGIDVTRINARLLIAALGPKVDPKVAHDYEGAGDAIR
FT                   RGDISVMGGVMPGQTTDAVAAALAEYVDADLLIYATSADGVFDADPNVDDDATRYEELS
FT                   ASKLVDVIAPMSRDAGASAPVDLLAAKLIERSRMRTIVLDGTDPESIKQAALHGEHSGT
FT                   DIIPEGTDDEPSYWAQR"
FT   gene            440058..441707
FT                   /locus_tag="Hbor_04670"
FT   CDS_pept        440058..441707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04670"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="PFAM: tRNA synthetases class I (K); TIGRFAM:
FT                   lysyl-tRNA synthetase, archaeal and spirochete"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66070"
FT                   /db_xref="GOA:E4NLH4"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH4"
FT                   /protein_id="ADQ66070.1"
FT                   /translation="MTNDSDSPDDAPDAGETAHHAFWADSVADDIEARDPDEPIVIKGG
FT                   VSPSGVAHLGNFNEIMRGYFVAEVLRERGHEVRQVFTSDDKDPLRKLPRKLADAEGNIV
FT                   GLGDVDAGALGRNLGKPYTEIPDPFGEADSYAAHFADLLKADADRLGVPVEMVSNTELY
FT                   DDGTFDPVVERVLSDIDNARDVLGKYQRKVDEEYVPFNPVCEECGKITETVTDIDLDAK
FT                   TVEYACTDMTVGDETIEGCGHEGTATFRQGKLPWRFEWPGQWQVLGVDFEPFGKDHAEG
FT                   SWPSGKDIAENVLTIEPPVPMTYEWFTLNGEALSSSAGNIVTVPEILELLEPEVLRYFF
FT                   ALNPRKARDLDLSRLDQLVDDFDRFERAYFGDVDDETLTEFAERAYPFVVDEVREDRVR
FT                   FPYTFAAVLGMTDDREVRIQMARNEGHIIDDTPEWAVEEALERVEKARAWAERMDNAYN
FT                   YRLQVEMPETDFDDDVVAALDDLADFVDAGHDGEEIQGEIYETARRHDIEVSDLFGAGY
FT                   RLFFDQPQGPRLGEFLGDLDRTFVVKRLRREE"
FT   gene            complement(441788..442324)
FT                   /locus_tag="Hbor_04680"
FT   CDS_pept        complement(441788..442324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66071"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH5"
FT                   /protein_id="ADQ66071.1"
FT                   /translation="MFDGRHYEVRQKIRVGNAYRIYENDTAILESKQKKFRLKEDFSFT
FT                   DPDTGAERFRVKADSVLDISAAYDIVDSQTGERVGSVKRSAMSFFKHEYKLLGPDGQTV
FT                   ATVVEDNVPMALARRLITTLVPFSYDIISPSGEKLGSASESFSFRDTYSIDIRGDIDPR
FT                   LTVVGMVVIDAIEEN"
FT   gene            442480..442755
FT                   /locus_tag="Hbor_04690"
FT   CDS_pept        442480..442755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66072"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH6"
FT                   /protein_id="ADQ66072.1"
FT                   /translation="MPLIEFNFGRERTDDTADTGKEQVEIPIDDESSSKSSSTGRKLLR
FT                   TTVLLALVAAAGYLLYRRATAADDSEFAEIVFEDETAEAGTESTDE"
FT   gene            442987..443463
FT                   /locus_tag="Hbor_04700"
FT   CDS_pept        442987..443463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04700"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66073"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH7"
FT                   /protein_id="ADQ66073.1"
FT                   /translation="MQMSSNDIFHIIRWENYDSYRKTIESVTLGAVDESGNNMLHVAAS
FT                   RGKIDIGSDLIERGIFLNRQGKEGKTPLHYALEMGDNEMATLLISAGADVTVTDDYGNQ
FT                   PLWSAVMNEEVDDNVIRLLVQHGADPVNQNEAGKSPLDVARRREEETLIEIFTD"
FT   gene            443637..444014
FT                   /locus_tag="Hbor_04710"
FT   CDS_pept        443637..444014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66074"
FT                   /db_xref="GOA:E4NLH8"
FT                   /db_xref="InterPro:IPR015287"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH8"
FT                   /protein_id="ADQ66074.1"
FT                   /translation="MENSGRHGNSAGSKKSTCLPQEISENNMAEKTIIKKYINPLQRYT
FT                   EGEMSASELSTGYLEEFKNESQGFSEETYQILQNMFRKSDAYCEPEIREDVRGSIGEQE
FT                   LLEAATQTIKKLEERLERIDS"
FT   gene            444216..446054
FT                   /locus_tag="Hbor_04720"
FT   CDS_pept        444216..446054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04720"
FT                   /product="predicted membrane-associated Zn-dependent
FT                   protease"
FT                   /note="PFAM: Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66075"
FT                   /db_xref="GOA:E4NLH9"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLH9"
FT                   /protein_id="ADQ66075.1"
FT                   /translation="MNTLIWVLVGLLAYSLVALLLRQYGLLPSSVRLQGPLATIHTKRG
FT                   RDFIDWVATPKRFWRAWTNFGLGITLVIMVGMFLFLFVQGIFILLNPPAPSVANQPQNF
FT                   LVIPGVNDFLPLSVAPEIVFGLLVGLVVHEGGHGILCRVEDIEIESMGLVLFTLLPLGA
FT                   FVEPDEESQRNADRGGKSRMFAAGVTNNFAVTIVAFALLFGPVIASISVAPGMAISGAY
FT                   DGSPAATADISQGDRITAVAGMPVNNETTLDAALYSTSDQRVEVELNGGESAADREKRT
FT                   VSVERSLIVAGTVAGNPAGLSVGDDDSAASQNDDPIRVTQVNGTAVHTQRGFSEAVGDG
FT                   RFATITTSRGTVTIPVGAYLTRVSADGPLGSTGAPTDGGAIVTAIGDERVTSSASLSRV
FT                   MGDTQPGETVPVELYHDGAFKTYDVTLGENPRDNGGFLGVNLFPGTSGLLLTDFGVQSY
FT                   PAGTYVSLLGGDGGPDALGLSGAVADSPLSAVYVALILPLASLVLGIPNFPGFTDSVAN
FT                   FYAVSGPFGFLGSGVFLLANVCFWMAWINLQLGLFNCIPGYPLDGGRILRTSVEAVVSR
FT                   LPVSEPYTVVRTITTGIGVTMLLSLLLLVFGPTVLN"
FT   gene            complement(446055..446579)
FT                   /locus_tag="Hbor_04730"
FT   CDS_pept        complement(446055..446579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04730"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66076"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI0"
FT                   /protein_id="ADQ66076.1"
FT                   /translation="MRKSGPPKGLISYLVLELLDEKPRYGYEILKEINDISGGHWEPSY
FT                   GSVYPILYKFEDKGWATRIERETESDRKYFELTDSGREELAEKRRESGGKAADFADIIL
FT                   GFYHVYVAFATDDRFEVETPDDVWRFDETFSSWIIEQLIRHHERDFGTFERIDETPAEF
FT                   YEREGVEFDDS"
FT   gene            446809..448341
FT                   /locus_tag="Hbor_04740"
FT   CDS_pept        446809..448341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04740"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase;
FT                   Chlorite dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66077"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI1"
FT                   /protein_id="ADQ66077.1"
FT                   /translation="MTDAPPTDEGWFALHDFRTVDWDAWRDAPEHERNRAVGEGVEYLR
FT                   THEAVEDAEDGTSAVFSILGHKADLLVIHFRPTLDALSRAERQFERTALAAYTEQATSY
FT                   VSVTEVSGYVSQDYFEEGEDADVDEGLRRYIEGKLEPDVPDDQYVAFYPMSKRRGEKYN
FT                   WYDLSFEERAEMMSVHGDTGREYAGKIKQVIASSVGFDDFEWGVTLFSEDPTEIKNIVY
FT                   DMRFDDVSSKYGEFGQFYIGRRFPPADLGAYLDGESVPTSEHETAHEHGAHGEAHGHAH
FT                   GDSPHGGSDHGGAHGGGGGHAHGDSPHGESDEDDASGDIRGELEDLNIYAGQPHGEDVY
FT                   ATVLYSEADSDELFEEVEGLRGNFDHYGTHVKTAVYEAKERGRSAVVSIWDTQSAAETA
FT                   AGFLSELPGIVSRAGEESGFGTMGMFYTVKSEHREDFVEKFDTVGDVLADTDGHQETDL
FT                   MVNIEDEDDMFIASQWNAQEDAMEFFRSDAFRDTVQWGRDILADRPRHVFLA"
FT   gene            complement(448480..448968)
FT                   /locus_tag="Hbor_04750"
FT   CDS_pept        complement(448480..448968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04750"
FT                   /product="Predicted membrane protein (DUF2078)"
FT                   /note="PFAM: Predicted membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66078"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI2"
FT                   /protein_id="ADQ66078.1"
FT                   /translation="MTTLLERIGRWLSVNARAVWNSPPLTGLVVGLWMVLLSFNSASDP
FT                   VSTFLTVTPTVMLLSYAVHRLTGPSGDEESKTTDSHRAAHRETSRRRTATQGQESASYE
FT                   PTEDETAIARLRERYAAGEIGDEEFERRLDALLQTEDLTGDKSDRARTRVLDHNEAGQ"
FT   gene            complement(449010..449795)
FT                   /locus_tag="Hbor_04760"
FT   CDS_pept        complement(449010..449795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04760"
FT                   /product="predicted kinase, sugar kinase superfamily"
FT                   /note="PFAM: GHMP kinases N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66079"
FT                   /db_xref="GOA:E4NLI3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI3"
FT                   /protein_id="ADQ66079.1"
FT                   /translation="MTTAYAPGSVTTVFVPQSDPEEGSLGVSFAVEDGVHATVKPTDET
FT                   VIRLDGTVTSFEPVAGVLDSIGVTADVSLEADIPVGCGFGASGAATLATALAAADVFDL
FT                   ELSREDVLTAAHRAEVAAGTGLGDVFVQEQGGLVWNTGDGRDRTERDDRIEYTSTGGIA
FT                   TQDVLRDEGAITKVADAGTEALSTFHPGDSLQAWFNASWAFAKRTELPTQSVEQTVERV
FT                   LDNDGAATMAMVGETVLATGVEGVLDESTRITNDGAHVR"
FT   gene            complement(449883..450284)
FT                   /locus_tag="Hbor_04770"
FT   CDS_pept        complement(449883..450284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04770"
FT                   /product="Predicted membrane protein (DUF2078)"
FT                   /note="PFAM: Predicted membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66080"
FT                   /db_xref="GOA:E4NLI4"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI4"
FT                   /protein_id="ADQ66080.1"
FT                   /translation="MSSPSTDGFDFDEFIRTRPWTFSAVVAGVVSLIALINGEHPVAGF
FT                   VGTFIITALLTLPYVRLTDFTRAMTEANQLDSPRRANADQHDDALGRLRERYAEGKIDE
FT                   AEFERRVEQLLRTQDDDTAEAEFVREKSS"
FT   gene            complement(450338..450508)
FT                   /locus_tag="Hbor_04780"
FT   CDS_pept        complement(450338..450508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66081"
FT                   /db_xref="GOA:E4NLI5"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI5"
FT                   /protein_id="ADQ66081.1"
FT                   /translation="MKRTTFVGLTAVAHLTLAAWIRRDAKKRDIDASPWDLLTLLTGVF
FT                   GLLGYRRSRDA"
FT   sig_peptide     complement(450455..450508)
FT                   /locus_tag="Hbor_04780"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(450513..451589)
FT                   /locus_tag="Hbor_04790"
FT   CDS_pept        complement(450513..451589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04790"
FT                   /product="predicted oxidoreductase, aryl-alcohol
FT                   dehydrogenase like protein"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66082"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI6"
FT                   /protein_id="ADQ66082.1"
FT                   /translation="MNYRTLGNSDVEVSEVGFGAWVVGTDWWGDRTKDDSIEMIHHAIE
FT                   EGITYFDTGDVYGHGESEKVIGEAIADYRDEVTLATKVGYDFYNNPQAGHGELPKEMTG
FT                   EWVRSATEKSLERLGVDHVEVLQLHNANVDEVDEDVLEALDELREEGLVDAIGWALGPS
FT                   IGWLAEGDMAIEEEFDSLQLVWNMFEQEVGNHFLDTVERTGSPTSLIPRVPHSSGLLNE
FT                   QVTPETGHDLDDHRGFRPDAWYETGWEKLETLRFLERDGERTMGQAAIAYLLSHDAVAS
FT                   VTPTFHTKEDITEWAAASDVPKLSEEEMTRVSDLYEDNFGIDCDDGMDELRSSVGGDDI
FT                   DAAGIDKKASAGPRNSAD"
FT   gene            451842..452774
FT                   /locus_tag="Hbor_04800"
FT   CDS_pept        451842..452774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04800"
FT                   /product="acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66083"
FT                   /db_xref="GOA:E4NLI7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI7"
FT                   /protein_id="ADQ66083.1"
FT                   /translation="MTKVHVSLPSEAERNVQAFIDEVDERLSSEEDTCEVVTETLVDLH
FT                   GDREAYERWQAGADLSPAERVRLQGYNPCNATLESEYYAEKDESKFTRSKNLQWLWRQF
FT                   DATPMADNIHFALRFRQMLADHLFEECGDNCRFFKGITFTYGHNISIGDNTVVHDGVHL
FT                   DDRGKLTIGDRVSLSDGVHLYSHDHDIVDQTDVRNYHTIVEDNARITYDAMVRAGIRIG
FT                   ANSVVGARSVVQGDVPDHHIVVGTPAKSIRVKPGWESVAAPVEDRLVNRQDEREITYDL
FT                   PDGLDTFDEFGRALTPPDTPDAPNPESHD"
FT   gene            452869..453195
FT                   /locus_tag="Hbor_04810"
FT   CDS_pept        452869..453195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66084"
FT                   /db_xref="GOA:E4NLI8"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI8"
FT                   /protein_id="ADQ66084.1"
FT                   /translation="MEAWGWIVVYAIGLTILQLLVYRYLLNNGGEVGYDGVVGDSDDRP
FT                   DGPVAHGGERGSIGRSPRLVASPNAPANERDDQSTGRYCPHCGSENEPDHTFDRCWNCA
FT                   NRLV"
FT   gene            453305..453493
FT                   /locus_tag="Hbor_04820"
FT   CDS_pept        453305..453493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66085"
FT                   /db_xref="GOA:E4NLI9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLI9"
FT                   /protein_id="ADQ66085.1"
FT                   /translation="MELAGRSIRERVMQTLVVFVVFFAYDYLQNAVDWSYLFAATALFF
FT                   VMMLVIDGLSERLKSRS"
FT   gene            453519..454271
FT                   /locus_tag="Hbor_04830"
FT   CDS_pept        453519..454271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66086"
FT                   /db_xref="InterPro:IPR041135"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLJ0"
FT                   /protein_id="ADQ66086.1"
FT                   /translation="MTRALAINVAANTNLPGVRGPVYPDGTFAYVPIPERKPTRPDATV
FT                   PTYADIDPPVEIPADARDAPVHLDPEFAGYPFCDRYTYGDEHGVKAGPLSDLDAGDWLF
FT                   FYATLDLHEATGNGDTVDADDGTNYLAPDWGTYLIGGFEVDIAVTGSEYESLPAPERAR
FT                   FATNAHVKRESFDAAVLVAGTDRSRLFDRVVPLSTREAGADANRIVTDLSNDSGKGPWW
FT                   RRVLRFDAKATDELLRVIESREFDPYLG"
FT   gene            454339..454809
FT                   /locus_tag="Hbor_04840"
FT   CDS_pept        454339..454809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66087"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLJ1"
FT                   /protein_id="ADQ66087.1"
FT                   /translation="MDSGVLTLSRRRLLAASTAGVAALAGCGGTNARNSDSNDAASLGY
FT                   VRVVNRDDTAHTAHVLVERDDEVVFWSSYDLPAVGDDTPTVTVEGPWADASTPAAYEVY
FT                   FRIDEQNDWKTFSTAESDLDCYGLEARVNDDAGLGLWVEHQPDECGTPTATE"
FT   sig_peptide     454339..454434
FT                   /locus_tag="Hbor_04840"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(455101..455171)
FT                   /locus_tag="Hbor_04850"
FT   tRNA            complement(455101..455171)
FT                   /locus_tag="Hbor_04850"
FT                   /product="tRNA-Gly"
FT   gene            455376..456209
FT                   /locus_tag="Hbor_04860"
FT   CDS_pept        455376..456209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04860"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="PFAM: NAD synthase; TIGRFAM: NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66088"
FT                   /db_xref="GOA:E4NLY9"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLY9"
FT                   /protein_id="ADQ66088.1"
FT                   /translation="MSTEPTILSDTAPLDLRLSDDELEATHNHILQFIRDVVDGAGAEG
FT                   AVLGLSGGIDSTATAYLAAEALGKENLHGLVMPSVVNSDENMSDAERVAQELEIEYDVV
FT                   EIQPIAETFFDTFPEAANDRMAAGNVYVRVRGVLNYFVANHENKIVLGTGNRSEALTGY
FT                   FTKYGDQAVDCNPIGNLYKQQVRQLAAHVGVPQDLVMKTPSAGMWTGQTDEDEMGMHYD
FT                   TLDAILALHVDGPLSKSATMDHIDVTGEQIDRVVELYEQSAHKRQMPPAPEPLDL"
FT   gene            complement(456252..456977)
FT                   /locus_tag="Hbor_04870"
FT   CDS_pept        complement(456252..456977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04870"
FT                   /product="enoyl-CoA hydratase/carnithine racemase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66089"
FT                   /db_xref="GOA:E4NLZ0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ0"
FT                   /protein_id="ADQ66089.1"
FT                   /translation="MIRTTADGPVRVVTIDRPERRNALRPTDLDELAAAVTDADSNETP
FT                   VIYLRGAGGHFCAGADLDSVSELADPEAFAQKGQQVANTIADASAVVVAGIDGAARGGG
FT                   VEMALACDVRVATPDATFAEPGVEFGLFGAWGGTVRLPRIVGEGEAMDIALSGRVVDAA
FT                   EARRIGLVSRVVEDPRTVADEIASNRSDALRVVKRRLRDDADDKARERAEAEAFARLHE
FT                   RYVGDIRQTRGERGGDDSE"
FT   gene            457038..457718
FT                   /locus_tag="Hbor_04880"
FT   CDS_pept        457038..457718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66090"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ1"
FT                   /protein_id="ADQ66090.1"
FT                   /translation="MDDAVRARDAAREALDDIEPDRLREVLFDRLDETSMTPGALTILS
FT                   ARALKPGVDADADGLAERAAGVQLIYEGLRLTRTLTHEEPWLTADGEDIDGDMDVLAAD
FT                   VLVSRGFYVLARTNAAKRAVEVVRSFGRDQTLRQEQDDAETLDRNLEADIFTLAVVAGT
FT                   TAVGGDAPPALLEYAAELARECDADGALPPAAAAFSDATTERIASLSVASATDDRVPSS
FT                   ATDR"
FT   gene            457798..457869
FT                   /locus_tag="Hbor_04890"
FT   tRNA            457798..457869
FT                   /locus_tag="Hbor_04890"
FT                   /product="tRNA-Thr"
FT   gene            complement(457969..458562)
FT                   /locus_tag="Hbor_04900"
FT   CDS_pept        complement(457969..458562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04900"
FT                   /product="Predicted membrane-bound metal-dependent
FT                   hydrolase (DUF457)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66091"
FT                   /db_xref="GOA:E4NLZ2"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ2"
FT                   /protein_id="ADQ66091.1"
FT                   /translation="MLAVVVAVVFPESAAATTPVPVLAAAALGGLFPDFDLYAGHRKTL
FT                   HFPVYFSGLAVPALVAAALSPSTLTLSVALFLAAAALHSVMDAFGGGLELKPWLGTSDR
FT                   AVYSHYHNRWIRPRRWIRYDGAPEDLFAAAMFAVPTLYAYDGTIQLGVYAALGISAVYV
FT                   LVRKPMVVAAQTVVDAMPEHLVDRIPDRFVEDFR"
FT   sig_peptide     complement(458491..458562)
FT                   /locus_tag="Hbor_04900"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            458640..459326
FT                   /locus_tag="Hbor_04910"
FT   CDS_pept        458640..459326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66092"
FT                   /db_xref="GOA:E4NLZ3"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ3"
FT                   /protein_id="ADQ66092.1"
FT                   /translation="MLAHVRRFIARPPRVPCMQWRRPPDAGSLAAGGMRLAIAGILGFG
FT                   IAKLNASITINAAAALAVTYLPALLSRDWGIRLSPSLTLWVTTAVLLHAVGMVGPYSEV
FT                   WWYDHVTHTLSAMLVAAVGYATARAVDKYSDSVFLPPRFMFVYILTFTLAFGVLWEVLE
FT                   FFARLSAEFFGIEAVLVQYGLHDTIVDLMFDTVGAAIVALFGTETLSDLVDTLHERLEE
FT                   ARPERR"
FT   gene            459399..460058
FT                   /locus_tag="Hbor_04920"
FT   CDS_pept        459399..460058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04920"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66093"
FT                   /db_xref="GOA:E4NLZ4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ4"
FT                   /protein_id="ADQ66093.1"
FT                   /translation="MKVVIVGYGRVGARTALVLREEGHEVTVVDNDEQKVERIEKEGFE
FT                   VVEGDGSNETVLRRAGIEDADAIGGLTGDPNVNFAACMIGKEFGCRAVMRVSEDYRKEI
FT                   YERYADDVDEVIYPERLGAAGAKTALLGGNFNAIGELAEGLRISRVVIPEDAPVVGQKV
FT                   SDIDLDSVGRIYAHGRKREPMTIPLPGTKVEAGDQLALLTEKDGLDAVRRTLLGED"
FT   gene            460348..461208
FT                   /locus_tag="Hbor_04930"
FT   CDS_pept        460348..461208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04930"
FT                   /product="dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /note="PFAM: Dihydrodipicolinate synthetase family;
FT                   TIGRFAM: dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66094"
FT                   /db_xref="GOA:E4NLZ5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ5"
FT                   /protein_id="ADQ66094.1"
FT                   /translation="MIGIGPPLVTPFTADGLIDETALRDLVSWVESRGVDFLVPCGSNS
FT                   EAELMTAEGRARVIEVVAAEASVPVLAGTGSPGYEETRQATAAAADAGADAALVVTPFY
FT                   YPHDDTALEAYYRDLADEAEIPIYLYSVPAFTDVKLSVSVVEALATHPNIAGMKDSSGD
FT                   IETFVRERRLTADADFDLLVGSGSMLSHALDIGADGGVLALANVAPEATTAIYDAHREG
FT                   DVTAARERNEALVELNRAVTTTHGIPGLKAAMRARGAPVGHVRRPHQPVSDDTREELER
FT                   LVASL"
FT   gene            complement(461211..461918)
FT                   /locus_tag="Hbor_04940"
FT   CDS_pept        complement(461211..461918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04940"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="PFAM: TOBE domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family; TIGRFAM:
FT                   molybdenum-pterin binding domain; ModE molybdate transport
FT                   repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66095"
FT                   /db_xref="GOA:E4NLZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ6"
FT                   /protein_id="ADQ66095.1"
FT                   /translation="MEDAFDAHLDADGVSFDRSDARLLATIAETGSVSGAAESLGRSRA
FT                   RCLARLRELEDALGPLVERRRGGSDGGGSELTAAARDVLGRFDRLQATLSGTAGVPETV
FT                   LSGIVTHVEGELCSVETDAGTIRAVATESVRTVEKAVTVSVRADAVTLHDPSDTPAESA
FT                   TSARNRLSGTVEGVKRGDAVATVSVNVGLSTPLRAFVTVESVRRLSLEPGTSVVASWKA
FT                   TATRATSTAVEPQ"
FT   gene            complement(461982..462809)
FT                   /locus_tag="Hbor_04950"
FT   CDS_pept        complement(461982..462809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04950"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66096"
FT                   /db_xref="GOA:E4NLZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ7"
FT                   /protein_id="ADQ66096.1"
FT                   /translation="MSEMTGVVDGRTSEDDSTGGLRLAAHGVTHGFDGETVFSDVSLAV
FT                   EPGEVLAVVGPSGSGKTTLLRLLACLESPAEGVVTANGRNVGEMSEEERLHVRRRLGMV
FT                   LQHRCLFSATVASNAAYGLRVRATWNERIRAAIRGFLGTAETPLAAVDALETVGMVDKQ
FT                   DRHAASLSGGEAQRVAIARALAPEPDVLLFDEPTSNLDPRNTAIVEKAICDARDRGMGV
FT                   CLATHDMQQAQRVSDRTAVLLGGEIIECGPTGQVFEEPSDRRTRKFVEGELVY"
FT   gene            complement(462806..463555)
FT                   /locus_tag="Hbor_04960"
FT   CDS_pept        complement(462806..463555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04960"
FT                   /product="ABC-type tungstate transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66097"
FT                   /db_xref="GOA:E4NLZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ8"
FT                   /protein_id="ADQ66097.1"
FT                   /translation="MPLGGLLDALNMQYLVSITLVSLYVSTAAVVISTALSLPIAVTVA
FT                   FSDFRGKSVLTSIISTGMGFPSVVIGLVVLLALSNSGPLGDFELLFTPQAMILAQTILA
FT                   TPVVLSVSLSAVESVGDDLREAAYGAGGTTTDVGLAVLREARYGIVTAILAGYGRAISE
FT                   VGSVLIVGGNIVFPADQTSYTRTLTTAITVEARKGNVETGLALGAILLALVLGVNALGS
FT                   HLRGRTPGRRTAKSGTVGTSLGGGENR"
FT   gene            463753..464223
FT                   /locus_tag="Hbor_04970"
FT   CDS_pept        463753..464223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66098"
FT                   /db_xref="UniProtKB/TrEMBL:E4NLZ9"
FT                   /protein_id="ADQ66098.1"
FT                   /translation="MTEPSPARVVADADVLAADLLVGGDARDALDHLRAHSWTTLVASD
FT                   ALLDDAESVIAELTDPELAADWRARVEVWCELVTHPEGDHPALGSAYRGDAMHVLSFDE
FT                   RLTSARAATTLSDRFPVSVREPKAFASLFNAESLYEEVVGGDYDGPDRDPRE"
FT   gene            complement(464311..464946)
FT                   /locus_tag="Hbor_04980"
FT   CDS_pept        complement(464311..464946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04980"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: Ham1 family; TIGRFAM: non-canonical purine NTP
FT                   pyrophosphatase, rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66099"
FT                   /db_xref="GOA:E4NM00"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM00"
FT                   /protein_id="ADQ66099.1"
FT                   /translation="MLHYVTTNAGKVREALQYLADVEQLDYDYTEVQASDLGPIAAHGA
FT                   REAYRHAGEPVLVDDAGLFIDGFEGFPGPYSSFVEDTLGVETVYRLAESELEEPRRASF
FT                   DCVLAYCDGEGFEATPDPVDRDDRTVAAARGAEQDDEETEALPVKLFRGTVRGRIVPPR
FT                   GEGGFGYDPIFEHEGTTFAEMSSEEKNAISHRGRALAKFGEWFAERTE"
FT   gene            complement(465086..465379)
FT                   /locus_tag="Hbor_04990"
FT   CDS_pept        complement(465086..465379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_04990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_04990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66100"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM01"
FT                   /protein_id="ADQ66100.1"
FT                   /translation="MYLPVMADKPQKGEILGVPYNFERPSLGRMLSSYWKPGEKMLVKK
FT                   PFGIGYTLNLANWRSWVVVLVAGALLWQERSSSSTDLEDEDEDEGPVEVIVD"
FT   gene            complement(465546..467168)
FT                   /locus_tag="Hbor_05000"
FT   CDS_pept        complement(465546..467168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05000"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="PFAM: Glycoprotease family; TIGRFAM: Kae1-associated
FT                   kinase Bud32; metallohydrolase, glycoprotease/Kae1 family;
FT                   universal archaeal protein Kae1"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66101"
FT                   /db_xref="GOA:E4NM02"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR009220"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM02"
FT                   /protein_id="ADQ66101.1"
FT                   /translation="MRIVGIEGTAWAASAALFDTATDEVFIESDPYEPDSGGIHPREAA
FT                   EHMGDAIPAVVSTVLDHAVETAEGDSPEIDGVAFSRGPGLGPCLRIVGTAARSLAQTLD
FT                   VPLVGVNHMVAHLEIGRYQSGFDSPVCLNASGANAHLLGYHNGRYRVLGETMDTGVGNA
FT                   IDKFTRHVGWTHPGGPKVERAAKDGEYHDLPYVVKGMDFSFSGIMSAAKQASDDGVPVE
FT                   DVCCGLQETIFAMLTEVAERALSLTGTDELVLGGGVGQNARLREMLSEMCDQRGADFYA
FT                   PEPRFLRDNAGMIAVLGARMLAAGDVLPISDSAVNPNYRPDQVPVTWRDDEESVARDPT
FT                   AEGKIRGAEATVTFEDDSVVKRRVPKTYRHAELDDKLRKERTRAEARLTSQARREGVPT
FT                   PVIRDVDPTEGVIVFESVGKSDLAGALTTERCRTVGKHLATVHDAGFVHGDPTTRNVRV
FT                   DAEKTYLIDFGLGYYTGHVEDHAMDLHVFGQSVEGTAAEPEPLLQAFEEGYAAVARDGE
FT                   EGGGPDEDVLARLRQVEGRGRYQ"
FT   gene            complement(467203..467520)
FT                   /locus_tag="Hbor_05010"
FT   CDS_pept        complement(467203..467520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05010"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66102"
FT                   /db_xref="GOA:E4NM03"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM03"
FT                   /protein_id="ADQ66102.1"
FT                   /translation="MEIEVISEDENPMLHRTDVRFEIVHDEATPSRLSVRDSLAAKLNK
FT                   DSDEVVIHELDTKFGMRKTAGYAKVYESPEFARDVEQDYMLDRNKIEAEEGDAEAEAEE
FT                   A"
FT   gene            complement(467628..468155)
FT                   /locus_tag="Hbor_05020"
FT   CDS_pept        complement(467628..468155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05020"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF359)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66103"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM04"
FT                   /protein_id="ADQ66103.1"
FT                   /translation="MLRLPTALRGEFKEPFGPLYTDADRLLADAGTPIIAVGDVVTHHL
FT                   RRAGRTPDVAVIDGKTKREAVDEEIRRALSDPETRRDVNNPAGEITEALADTIRDALDA
FT                   DDPVTVVVAGEEDLATLPAVVAAPTGASVVYGQPDEGMVLIDVTDDSKAEMRSLLRRMD
FT                   GDAESLLSLLES"
FT   gene            complement(468159..468356)
FT                   /locus_tag="Hbor_05030"
FT   CDS_pept        complement(468159..468356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05030"
FT                   /product="DNA-directed RNA polymerase, subunit E''"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: Spt4/RpoE2 zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66104"
FT                   /db_xref="GOA:E4NM05"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM05"
FT                   /protein_id="ADQ66104.1"
FT                   /translation="MAKPRLACRECHYINMPDSQACENCGASSLTEDWAGYVVITHPEE
FT                   SDIATEMNVTEPGGYALKVR"
FT   gene            complement(468357..468935)
FT                   /locus_tag="Hbor_05040"
FT   CDS_pept        complement(468357..468935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05040"
FT                   /product="DNA-directed RNA polymerase, subunit E'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: S1 RNA binding domain; RNA polymerase
FT                   Rpb7-like, N-terminal domain; TIGRFAM: DNA-directed RNA
FT                   polymerase (rpoE), archaeal and eukaryotic form"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66105"
FT                   /db_xref="GOA:E4NM06"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM06"
FT                   /protein_id="ADQ66105.1"
FT                   /translation="MYKRVRLKDTVEVPPEHLADVTPQRVKRLLQDKLEGRMDEDVGSV
FT                   VSVVNVHDIGEGTVLPGRAGVYYEAEFDAVTFDPDMQEVIDGEVVEVVEFGAFVGIGPV
FT                   DGLLHVSQISDEYLAYDGENQQLASTESNRTLAVGDSVRVRVVTKSIDERNPRDSKIGL
FT                   TAKQPGLGKHGWLEADRQASEATTEAEGR"
FT   gene            complement(468943..469371)
FT                   /locus_tag="Hbor_05050"
FT   CDS_pept        complement(468943..469371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05050"
FT                   /product="SSU processome protein Utp24"
FT                   /note="PFAM: Fcf1"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66106"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM07"
FT                   /protein_id="ADQ66106.1"
FT                   /translation="MTTETRHRTDSDTDATTTVVLDTNALMMPVELDVRVFDELDRLLA
FT                   ANVDLVVPSAVVGELEKLSAGAGNEGVAASVGADLAADRCRVVDTEATYADDAVVELAE
FT                   RGFDYVVTNDKPLRDRLLERGVRVIGIRGHHKLDITEP"
FT   gene            complement(469368..470600)
FT                   /locus_tag="Hbor_05060"
FT   CDS_pept        complement(469368..470600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05060"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor Tu GTP binding domain; Initiation factor eIF2 gamma,
FT                   C terminal; TIGRFAM: small GTP-binding protein domain;
FT                   translation initiation factor 2 subunit gamma; translation
FT                   elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66107"
FT                   /db_xref="GOA:E4NM08"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM08"
FT                   /protein_id="ADQ66107.1"
FT                   /translation="MVTQNPQQPEVNIGLVGHVDHGKTTLVQALSGSWTDQHSEEMKRG
FT                   ISIRLGYADATFRKIPGADPPECYTVEETDDDGNETDVLRTVSFVDAPGHETLMATMLS
FT                   GAAIMDGAVLVVSATENVPQAQTEEHLMALDIIGIDNIVIAQNKIDLVDRDRAVENYEQ
FT                   IQEFVQGTVAEDAPIVPISAQQEVNIDLLIDAIEREIPTPEHDESEAARMFTARSFDIN
FT                   RPGTTWEDLSGGVIGGSVVEGKLTEGEELELRPGREVDEGGQTEWRPITTDIRSLQAGG
FT                   QMTDEVRPGGLCGVGTGLDPSLTKGDALAGQVAGEPGTLPPTREEFTMDVELLNRVVGE
FT                   DEETVEEISTGEPLMLTVGTATTVGAVTSARTGEAEVSLKRPVCAADGAKIAINRRVGA
FT                   RWRLIGIGTLK"
FT   gene            complement(470743..471555)
FT                   /locus_tag="Hbor_05070"
FT   CDS_pept        complement(470743..471555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66108"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM09"
FT                   /protein_id="ADQ66108.1"
FT                   /translation="MERTTTDTKRHGRRAFLGLAAVTGVSALAGCSGTGGTVSAARRPP
FT                   TVPEEQLKSGGWEQVDDVTQDPAFEQDLGPVTMTAATRTRLYEDTELRAEIADKTLGQA
FT                   ATQFATFFATRVTFDPDLTSLPAGAGQKELLDQVESQSRTQFRNRLKEAGLKPVEQVGT
FT                   GTFDVASGTSARLTEYEASYSFEGFSVNVGTEDITIEGGEISVAGHLAAWIADNSVLVA
FT                   GGAYPAENFARSVTKNPSDAIELSVDIDLGLTPKAYRKELFGLMRQVE"
FT   sig_peptide     complement(471436..471555)
FT                   /locus_tag="Hbor_05070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(471598..471753)
FT                   /locus_tag="Hbor_05080"
FT   CDS_pept        complement(471598..471753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66109"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM10"
FT                   /protein_id="ADQ66109.1"
FT                   /translation="MRAESQLEGKFPRTVSFGDHVSPHRLGTGKNDSENLYFSRQFTEN
FT                   YLSEWE"
FT   gene            471826..472677
FT                   /locus_tag="Hbor_05090"
FT   CDS_pept        471826..472677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66110"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM11"
FT                   /protein_id="ADQ66110.1"
FT                   /translation="MDVCAVHPGPSFDTRADITSRAIPLRAITCDVGTGEAVFWRDAFD
FT                   CHRNTARDVVDSAVEAGFFESEWRGGREYVRQTTRYPADWFGRLVGIENKPDLGDPGDL
FT                   ERQLRTDASLGLFDEIILATESYVTRAHLNRIPESVGVWRFDPESGEREVVRDATPLDP
FT                   ASPGIELVAERPLRTDVELVSGERKRQARLRLAERTYGKGWRTYDLPTCANASVTSDGR
FT                   PYCAHFNRVVEPGRDCGDDCQPFEAADAPSLDADSLRDERTPWVSDPDGVARRQSGLDR
FT                   FW"
FT   gene            complement(472683..472895)
FT                   /locus_tag="Hbor_05100"
FT   CDS_pept        complement(472683..472895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66111"
FT                   /db_xref="GOA:E4NM12"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM12"
FT                   /protein_id="ADQ66111.1"
FT                   /translation="MSLRAIITDNVFRYFLLMGGLVATENLMTTYQNTGRVDLLGSALQ
FT                   FVVVVIFAILLIAYWNYMDRRAEEA"
FT   gene            complement(472909..473733)
FT                   /locus_tag="Hbor_05110"
FT   CDS_pept        complement(472909..473733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05110"
FT                   /product="metal-dependent hydrolase, beta-lactamase
FT                   superfamily I"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66112"
FT                   /db_xref="GOA:E4NM13"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM13"
FT                   /protein_id="ADQ66112.1"
FT                   /translation="MRVTLLGTGDTTGTPTVGCECDTCREARARGVERTRFSVHVENDR
FT                   TGESLLIDFSPDFRQQFLTHEVPLPDAGLITHVHFDHIDGLGNAYRVFDDLPVHAADET
FT                   DPKTGQSVAETVASKFDYLDRISVRAQTPFETFRTCGLDVTLVPVEHPPLLCYGLTIED
FT                   SETGAKLSLSGDTSYGIPEDSRSVLSDPDLLLAEAIVPASLCQHHPLGGKHFDDEGVPR
FT                   TFGTKHMTREGALALADDLNAEQTRLVHTAHYYPVEEAFEEPLAVDGEVYKL"
FT   gene            complement(473831..474421)
FT                   /locus_tag="Hbor_05120"
FT   CDS_pept        complement(473831..474421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66113"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM14"
FT                   /protein_id="ADQ66113.1"
FT                   /translation="MLSLSSGCLSSLTGDANVTVPSGNSTPTAESTPEPTRGEAAALSV
FT                   SETIDDVEYVPENETVKIVTGYRHTNHEAVKNGSKPEREPMYDEIPWKQWATTECASVA
FT                   GTAVHDMLTDKFGDNHGVSVGVTSQYGDDPSLSVAHTILYNRDGEQISETSVGFDRLVE
FT                   VTPREVTATVTLDGRTATRTIPAWVEYSKMHQT"
FT   gene            complement(474533..475903)
FT                   /locus_tag="Hbor_05130"
FT   CDS_pept        complement(474533..475903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05130"
FT                   /product="AAA+ family ATPase"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66114"
FT                   /db_xref="GOA:E4NM15"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM15"
FT                   /protein_id="ADQ66114.1"
FT                   /translation="MSDPALEVVEFLLTAHLYTENRELDENDLPPRYRRVFWTDPPDDE
FT                   DEDDETAPIGIERPLVVTDNTARKATGVERPWEAISDLLFTQREDFSGRISLTQPDMAT
FT                   DWYLERADRDQLETNPTIAAAVEDHDDVDVSHTEARERTRSIQADRVWIDSLLDQYFDE
FT                   EEDAEMLDLVQVRAPEEIEMTLEDLVLTQDQEGEIHKLMKAIEHREYLADIGLREIGKI
FT                   LFVGPPGTGKTTVSRALAHELGLPFVEVKLSMITSQYLGETAKNVEKTFEVAKRLSPCI
FT                   LFIDEFDSVAKTRRSDEHAALKRAVNTLLKSIDDISLIRDEVILIGATNHPDQLDSAAW
FT                   RRFDEIVNFPRPDRQMRADILRIITNRMEVADFDPEAVADRTEGLTGSDLRMVLREAVL
FT                   EALTEERTALTQTDILDAVEDFEERDNLKNMDMMSDGEQLIAGDGGDGHDHDHNHDD"
FT   gene            476099..477232
FT                   /locus_tag="Hbor_05140"
FT   CDS_pept        476099..477232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05140"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /EC_number="2.3.1.16"
FT                   /note="PFAM: Thiolase, C-terminal domain; Thiolase,
FT                   N-terminal domain; TIGRFAM: acetyl-CoA acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66115"
FT                   /db_xref="GOA:E4NM16"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM16"
FT                   /protein_id="ADQ66115.1"
FT                   /translation="MPQPVIAAAHRTPFGKAGGVFEDVRSEDLSVALIDHILDETDLDA
FT                   EDVDDLMWGVAQQRGEQDNNVARVIALLSELGEGTPATTINRWCASSMQAVISASDAVA
FT                   AGNRDCVVAGGVENMSRVPMDGDSYEHLHPELSEEYNIFQLQMGMTAEKVAEEYDVSRE
FT                   EQDEYALQSQQRAAEAAESGRFDDEIVPIETEAGVITEDEGIRPDTTMDALSGLPPAFT
FT                   GDGTVTAGNSSQITDGAAAVLVTSREFAAEHDLDILADVGMNAVAGVDPTVMGIGPVPA
FT                   TRTLLERNGRDVDDYDLVELNEAFASQCVYAMDELGIDHDIFNVNGGAIALGHPLGASG
FT                   ARLPVTLIHEMIKRDAERGLATLCVGFGQGAAIEFSR"
FT   gene            complement(477449..479311)
FT                   /locus_tag="Hbor_05150"
FT   CDS_pept        complement(477449..479311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05150"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="PFAM: TrkA-N domain; TrkA-C domain; Sodium/hydrogen
FT                   exchanger family; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66116"
FT                   /db_xref="GOA:E4NM17"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM17"
FT                   /protein_id="ADQ66116.1"
FT                   /translation="MAAGSNLIYIVAAIIGIGVVSQILSDRFQVPSVLFLITSGIILGP
FT                   EVLNVVHPDSFGSGLSAIVGLSVAIIVFEGAFHLRIEKLREAPAATIRLITVGAGIALI
FT                   GTAAAIHYLLGSPWSVSFLIGALLVATGPTVIAPILEVVPARDRVEAALETEGIVNDVT
FT                   AAILAVVIFEAIIEGATEPGALMTLFAERLGVGVVVGTLVAAAMFYALRYVDLSPGNAP
FT                   QNARLLVLAGALVAYGAADFIATEAGIAAVATAGILLGNADVPYEEDISAFKGDITLIV
FT                   LSFVFIALAALLEFETLLRLGLGGLGVVVVVALVLRPLLVFLSAQGDRFTTGEKWFMSF
FT                   VGPRGIIPASVATLFAIQLRAEGLGQAADTLVGTVFLVILVTVVFEGGLARQIAEYLDV
FT                   IPMRVLVIGGGKVGRTLAERLEDRGENVVLIEQDPEIIETARNEGHTVHQGDGTDTDVL
FT                   RSAGADNAKIVVAATGDDDVNLLVAQLANSKFDPETIIARANNPDNVDAFEELGVRTIS
FT                   SVLATAQAIDNYIERPAMMNWMSEIGRSGDVQEIEVTSEEIVGKTVRDIGPELPNGCLI
FT                   TLISRDGESSVPSADFTVQHGDHITIIGGHDAVREAMQFIHPDE"
FT   gene            complement(479447..481480)
FT                   /locus_tag="Hbor_05160"
FT   CDS_pept        complement(479447..481480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05160"
FT                   /product="AMP-forming long-chain acyl-CoA synthetase"
FT                   /note="PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66117"
FT                   /db_xref="GOA:E4NM18"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM18"
FT                   /protein_id="ADQ66117.1"
FT                   /translation="MDWRDSEETFEDEVVGDTTLARMFENSAARNTGEPAQQYKGGIYD
FT                   RSLVSSGVVPAAPSGDFSELTYGEMREIVRNLAAGFRELGVEAGSRVGIFSHTRMEWAQ
FT                   SDFGILAAGGAVTTVYTSSSERQVRYLLSDPGATGVVVENAELLQRVLAVEDELDLSFI
FT                   VLIDDPADGSGMGGAVRDRDDIYTLGDVHEIGATAFDEEAYQSWINERDPSSLASLIYT
FT                   SGTTGQPKGVKLTHNNFRSNVNQCYKRFGPRPDKEDVPTLTNGMVTLSFLPLAHVLERL
FT                   AGHFLMFASGACVAYAESPDTLREDFQLVRPTVGTSVPRVYEKLYDAIRSEASKSPTKK
FT                   RIFEWAVDVGREYHESDSPGVILSAKHALADKLVFDQVREALGGRIEFFISGGGSLSAE
FT                   LCALYHGMGLPILEGYGLTETSPVIAVNPPEEPKIGTIGTPVVDVEVKLDKTVVGDVTG
FT                   DAGGDVGELLVKGPNVTEGYWNRPEETAAAFTDDVPSDANGESESEGDSGGWFRTGDVV
FT                   ELRPDGYIAFRERAKQILVLSTGKNVAPGPIEDSFASSDVVEQCMVLGDGRKFVSALIV
FT                   PSFEEIREWADREGYDLPDDARGICRDDRVKERIQSEIDQVNENFEPYEQIKQFRLVPE
FT                   EFTENNDLMTPTMKKKRRNILDRYADQVDLLYTEDAAAATQN"
FT   gene            complement(481619..482533)
FT                   /locus_tag="Hbor_05170"
FT   CDS_pept        complement(481619..482533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05170"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66118"
FT                   /db_xref="GOA:E4NM19"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM19"
FT                   /protein_id="ADQ66118.1"
FT                   /translation="MAIGDVTAVPGTDDVYYVDTGMYETEMYGSVYIIDAERPAFVDTG
FT                   IGTNHEHLLDALDELDIAREDVEYLLPTHIHLDHAGGAGYLADACPNATVMTHEIGVSH
FT                   LIDPEKLIAGTKAAVGDQWEFYVEPKPVPEDRIEPLTDGNEIDLGDRTLSVFHAPGHAP
FT                   HQTMFLDSKDDLLFTGDAAGIYVPERGQVRQTSPPSQFDLEACLDDVRTIEEIAPERIC
FT                   FGHFGSCEYSEELMESYKRTLVEWVEAVRQKREELGDDDAVIEHFAEHTQMTDLWGERK
FT                   ASEEEKLNVRGVLGYLDWQAEQE"
FT   gene            complement(482636..483625)
FT                   /locus_tag="Hbor_05180"
FT   CDS_pept        complement(482636..483625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66119"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM20"
FT                   /protein_id="ADQ66119.1"
FT                   /translation="MERRAFLGTVGIALSAAVGGCTARGGEENGSEQTGTGTMTDEDDN
FT                   QTSGESPTQVSGSGTVSRTVSDGSLSEPGLRKPHRLQFKNATDDSQVGTLQIRGSDDET
FT                   RFEEQFELASDASVSVILTALDRYEATISLASGTSKTVELGPELFDCNTTTTTAAIQSD
FT                   GTVDVMTASTRMACPGVVTDTVPAGESRAERIGEDTTEDTSRKPHAVLLGNPTDETWTA
FT                   RLRVADDERVRFDGVYTVEPEANVRVVLAEPADYQLDASVLETGAEATESVGADQFDCN
FT                   SSSTSVSVTDGGELKIASISTLMACVPPEEAGNETTDADNETVTDADN"
FT   sig_peptide     complement(483551..483625)
FT                   /locus_tag="Hbor_05180"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(483702..484319)
FT                   /locus_tag="Hbor_05190"
FT   CDS_pept        complement(483702..484319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05190"
FT                   /product="Bacterial regulatory protein, arsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66120"
FT                   /db_xref="GOA:E4NM21"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM21"
FT                   /protein_id="ADQ66120.1"
FT                   /translation="MSSLLPLKPPVDGDGTDPRLVSFDDSDAEEIVSVVTSETAREILA
FT                   AVYEEPQTTSDLASSVDTSVQNVSYHLDRLKEAGVVEAVGTWYSAQGREMNVYGPKHDP
FT                   LVLYAETDQARSSVSDTLRRSLAGVAGVLVASLLVHVAWPTPVPVRPTRGAPLSPEPTL
FT                   FEAVRGFALGPGGAVLAVGLIAVFFMVGFRYLQSSQRGTDAE"
FT   gene            484518..485900
FT                   /locus_tag="Hbor_05200"
FT   CDS_pept        484518..485900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05200"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: Seryl-tRNA synthetase N-terminal domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66121"
FT                   /db_xref="GOA:E4NM22"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM22"
FT                   /protein_id="ADQ66121.1"
FT                   /translation="MISRQFLRENPETVREALRSKGVDDVDLDHILEVDEEWRSLKKRG
FT                   DDLRHERNETSSKIGELKAEGKDEEAQEAIERSQELKSELAEVEDRADELEAELEERLL
FT                   ELPQIPHDDVPVGEDESENVERRREGFDDLRELPDEVIPHYDLGEELDILDFERGAKVT
FT                   GGGFYFAKGDGARLEHALIQFMMDVHREQGYVDLFPPIPVNSQSMTGTGQFPKFTEDAY
FT                   RIGKANGKERDDDDLWLCPTAEVPVTNMYRDEILLDDDLPVKHQAYTPNFRREAGEHGT
FT                   ETRGIVRVHQFNKVEMVNFVRPENSYEQFEELLDEAEEVLRRLELPYRILEMCTGDLGF
FT                   TQAKKYDIEVWAPGDDMEDGPEEGGRWLEVSSVSNFEDFQARRAGLRYRPERHESAEYL
FT                   HTLNGSGLAIPRVVVAIMEYYQNDDGTVTVPEALRPYMGGTEVIEGHDPVGESAVGAGK
FT                   KD"
FT   gene            486071..486340
FT                   /locus_tag="Hbor_05210"
FT   CDS_pept        486071..486340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66122"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM23"
FT                   /protein_id="ADQ66122.1"
FT                   /translation="MINPHDDTPWREVGQHQFDTTDELDVTLTTTLRPDETSAPRLRGI
FT                   DPEEAERLLRSAREAGVDLEVRFCVDGRPVKIDTKGVVSVKDDC"
FT   gene            complement(486451..486858)
FT                   /locus_tag="Hbor_05220"
FT   CDS_pept        complement(486451..486858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05220"
FT                   /product="NTF2 domain-containing protein"
FT                   /note="PFAM: Nuclear transport factor 2 (NTF2) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66123"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM24"
FT                   /protein_id="ADQ66123.1"
FT                   /translation="MHSEDAAASGRQLVEAYYDAIDAGDYDRLASLLSPAFVHDRPDQT
FT                   LSGRETFVSFMRDDRPETDTRHDVTATYRQTEGDGWVVRGRLLGADGDVRFTFVDVFTV
FT                   GAGQSDSDASSDEARAGNGRVRRIETFAREK"
FT   gene            486999..487514
FT                   /locus_tag="Hbor_05230"
FT   CDS_pept        486999..487514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05230"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Possible metal-binding domain in RNase L
FT                   inhibitor, RLI; Domain of unknown function (DUF367)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66124"
FT                   /db_xref="GOA:E4NM25"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM25"
FT                   /protein_id="ADQ66124.1"
FT                   /translation="MSDSPSPSLHVRYEGDDDPAKCTARKLAKFDLAELHHSDRATPYG
FT                   VVLNPHAERALSPEDSDTGTLVALDCSWESAGEAMFSLPGDHRALPYLVAANPVNFGRP
FT                   MQLTTVEALAAALCIFGRDDHAERILSKFTWGHTFLELNEEPLRRYANCEDSTAIVEVQ
FT                   QEYLDRGD"
FT   gene            487667..488641
FT                   /locus_tag="Hbor_05240"
FT   CDS_pept        487667..488641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05240"
FT                   /product="predicted GTPase"
FT                   /note="PFAM: Nucleolar GTP-binding protein 1 (NOG1);
FT                   TIGRFAM: small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66125"
FT                   /db_xref="GOA:E4NM26"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM26"
FT                   /protein_id="ADQ66125.1"
FT                   /translation="MIFESLPTTPRSEELLDKAFSRAARSGRAKSGHEAQESMLQTASS
FT                   ILSDNLENVVTEWPDFGTVDPFYYELADAIVDVDELRQSLSEVTWASRQIAEIRSEYLS
FT                   KMRKTDKDTARKHRKQAFARMADIMDEIEDDLLQIGEARDSLKGLPDIRPDEPAIVVAG
FT                   YPNVGKSSFVNHVTRASNEIARYPFTTKGVQIGHFERDRIRYQIIDTPGLLDRPEEDRN
FT                   DIEKQAVSALEHLADAALFVVDASGDCGYPLDAQLELRDAVEARFAERNVPVLTVCNKS
FT                   DRSTDVEADYYMSVENEEGVEEVLTASVDAVAWSPDIPPSRQE"
FT   gene            complement(488862..489608)
FT                   /locus_tag="Hbor_05250"
FT   CDS_pept        complement(488862..489608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05250"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66126"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM27"
FT                   /protein_id="ADQ66126.1"
FT                   /translation="MQRRFKTFALPIALVTLVILSGCLAPLQSGGGTNAAQQAADAQSR
FT                   TITVSGNGEVKAESDLAVLSVAVTATASSADEARAQVADRSETMRQALREAGVADDAVT
FT                   TSHFRVRAQYNHNGKERNVTGYEAVHTYSIEVSPDRAGEVLDVAVGNGANEVQHVSFTL
FT                   SEEARADLRNDALNAAMDSARTDADTLASAANLSITGVQSVSTSGGYHPVEPRMEYDTP
FT                   AANSGTSFEPGPVTVSATVTVTYEAE"
FT   sig_peptide     complement(489504..489608)
FT                   /locus_tag="Hbor_05250"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(489685..490971)
FT                   /locus_tag="Hbor_05260"
FT   CDS_pept        complement(489685..490971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05260"
FT                   /product="conserved hypothetical protein TIGR00341"
FT                   /note="PFAM: Domain of unknown function (DUF389); TIGRFAM:
FT                   conserved hypothetical protein TIGR00341; uncharacterized
FT                   hydrophobic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66127"
FT                   /db_xref="GOA:E4NM28"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM28"
FT                   /protein_id="ADQ66127.1"
FT                   /translation="MIPTGKRNTVLELLDEEGIDYAVSDETSGRDYTAVVSFPLPTAAV
FT                   EPVLERLREVGIERDAYTVVVDAETVVSERFEALEEQYEETKENGDRIAREELVATASE
FT                   LAPQLPSFVLLAVVSAVVATAGVLLDSPAVVVGSMVIAPLVGPAMATSIGTVVDDRELA
FT                   IRGVKLQVLGGILAISSASLFAAALRFSGIVPLTAEEVFAIGEVRERLAPDVLSLVIAL
FT                   GAGAAGAMSISSGVSTALVGVMIAAALVPPIAVVGISIAWGQPLTMIGPLVLVLVNVLS
FT                   INFVALIVLWQMGYRPQLWFREEEARSATLSRLAGLGAILLILSSVLVGVTYGTHRTST
FT                   FEAEAQNVVVTELPEETALISMDVEYEGFPFQTPSRVVVTVGYPPDETPPNVGDDIRPR
FT                   INELAPKPFGPLGSADVRVEVRYVAVDQP"
FT   gene            complement(491173..491886)
FT                   /locus_tag="Hbor_05270"
FT   CDS_pept        complement(491173..491886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05270"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66128"
FT                   /db_xref="GOA:E4NM29"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM29"
FT                   /protein_id="ADQ66128.1"
FT                   /translation="MVKQDLRERIWDRMEAEGIARFPFPPHDRVPNFVGAEDAAERLAE
FT                   TDAYTEASVLKCNPDSPQLPLRRRALHDGKTVYLAAPRLRDKKPFLALDPAEIPPEEYD
FT                   RAPTVSHAAEYARPVGPKDVPHVDLVVSGSVAVTETGTRVGKGEGYSDLEFAVLSELEA
FT                   VDSETTVATTVHEVQVVGDDAVTPADHDVPMDIVCTPERTIRTETDQSRPDGVNWSALS
FT                   AARIEEIPVLDRLRE"
FT   gene            491972..492592
FT                   /locus_tag="Hbor_05280"
FT   CDS_pept        491972..492592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05280"
FT                   /product="small GTP-binding protein domain"
FT                   /note="PFAM: GTPase of unknown function; TIGRFAM: small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66129"
FT                   /db_xref="GOA:E4NM30"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM30"
FT                   /protein_id="ADQ66129.1"
FT                   /translation="MFEDRPNCQEVVLVGRSNVGKSTLMRELTGHSKFTTGKKPGVTRQ
FT                   PNHFDWSGEKFMFTDLPGFGFMSGVEEHRREEIKTDIVRYLESNADDILAGVLVVDGKS
FT                   VVDIIDRHSGPDEIPHDVEMFHFLRELGVPVVVAVNKMDKVDDKDERLDELCDRLGLMP
FT                   PWKQWSDVIAPICAKRGSIDPLYESLQTYFHEQKRDDLLKFVS"
FT   gene            complement(492615..493289)
FT                   /locus_tag="Hbor_05290"
FT   CDS_pept        complement(492615..493289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05290"
FT                   /product="Protein of unknown function (DUF3179)"
FT                   /note="PFAM: Protein of unknown function (DUF3179)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66130"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM31"
FT                   /protein_id="ADQ66130.1"
FT                   /translation="MVENGFPRTLCDRPPVKNVGIRAVVGPAYARSWDEISVPEKYRLG
FT                   AEVGDGLTAQSQVVGVERDGAARAYPLSVLWWHEVVNDDLNGPVLVTYCPLCQSGMVAK
FT                   RVVDEQAATFRVSGHLWQPPRIYTEASVLDGRAFGASATESDAEVRNSGNLVLVDDATE
FT                   SYWSQLLARAVCGSASGTRLDILPSTVTTWDAWRDDHPKTDVLLPPPHSAVAREAERRQ
FT                   PR"
FT   sig_peptide     complement(493200..493289)
FT                   /locus_tag="Hbor_05290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(493729..495000)
FT                   /locus_tag="Hbor_05300"
FT   CDS_pept        complement(493729..495000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05300"
FT                   /product="translation initiation factor 2B subunit, eIF-2B
FT                   alpha/beta/delta family"
FT                   /note="PFAM: NUDIX domain; Initiation factor 2 subunit
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66131"
FT                   /db_xref="GOA:E4NM32"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM32"
FT                   /protein_id="ADQ66131.1"
FT                   /translation="MAHVVTCFVRNCGAVLLTLRSEETGTYSGRWAGISGYIEGDPDDA
FT                   EADAWRELREETGLGEDDLELVRAGETVEVEDEEGSFVVHPFLFESDTRTVTTNEELAE
FT                   IAWTDPTAIRNRPTVPRLWETWRRVAPTVETVRTDRTHGSAWISARALEALRDAAIEAD
FT                   DWAAVAKIGRELRDARPSMAAVCNRVNHVLSTSERTPESVATVAIRELDAAFESDEKAA
FT                   RTLVRRLRDAEVSGVATLSRSGTVSAALRKLDPTSLLAAESRPEREGVTVAETVAEETD
FT                   AAVTVTTEAALPAALSRCETAVDAVVVGADAVHPDGSVVNKTGTSVLASAAQSAGVPVY
FT                   VVAASDKVRPAGTASRDAADEMCAESPHEAVYDGDADVDVFAPTFERVSADLVDGLATE
FT                   KGLLDAAAVRRVAVEHAEHAAWTD"
FT   gene            495058..495564
FT                   /locus_tag="Hbor_05310"
FT   CDS_pept        495058..495564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05310"
FT                   /product="phosphoesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66132"
FT                   /db_xref="GOA:E4NM33"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM33"
FT                   /protein_id="ADQ66132.1"
FT                   /translation="MPAELAVVSDTHIPSRAERIPDWVAERIRAADHVVHAGDFDSLDA
FT                   YDRVVELAGGAANLTAVAGNIDPRSFDLPEVTTFDVEAVRFVVTHGSGPRAGYRDRVAA
FT                   TVHEVADSDAISISGHTHEVMDDVVDGVRLLNPGSATGAAPADETTMYTITVEGSDVSV
FT                   TLHRE"
FT   gene            495650..496402
FT                   /locus_tag="Hbor_05320"
FT   CDS_pept        495650..496402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05320"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="PFAM: F420-0:Gamma-glutamyl ligase; TIGRFAM:
FT                   F420-0:gamma-glutamyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66133"
FT                   /db_xref="GOA:E4NM34"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR023659"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM34"
FT                   /protein_id="ADQ66133.1"
FT                   /translation="MELFAVPDVPEIRPGDDLAAVIRDRADLREDDVVCVASTVVSKAE
FT                   GRLFDLADFPAGPRAREIASNLEAVTGDEKDPRFAQAVLEESVELLMESPFLLTETRFG
FT                   HVGVNAGIDRSNVPDNDLLLLPKRPAESAERIRAEIPADRVIVTDTCGRPFRHGQRGVA
FT                   LGWAGMSASRDWRGETDRDGRELGVTVESVVDELAAAANLVSGEGDDGTPVVVVRDFDW
FT                   GDHDGSDKHFREIEGDFVRQALRGWEHE"
FT   gene            496395..497468
FT                   /locus_tag="Hbor_05330"
FT   CDS_pept        496395..497468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05330"
FT                   /product="methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.98.2"
FT                   /note="PFAM: Luciferase-like monooxygenase; TIGRFAM:
FT                   5,10-methylenetetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66134"
FT                   /db_xref="GOA:E4NM35"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019946"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM35"
FT                   /protein_id="ADQ66134.1"
FT                   /translation="MSDDPTLGIELTPEHPIPAVVERGVRAEKAGYDTAFVSCHYNNRD
FT                   PFAALSRLADETEELRLGPGVANPYEMHPVTLAAKTATVAELSEGRAVFGIGPGDPSTL
FT                   RNLGLEDERGLRSVLEAFKVAQRVWDGERVSHDGTFEAQNAGVNFDVPGEIPVYVGGEG
FT                   PHMCRMAGKHADGLLFNGSHPDDVAWARARVEEGIAERPDGGDAGNDGDSGDDGDSGDD
FT                   GNTDTADFELLAYASVSIDSDREAAREAARPPVAFIASGAAPPVLDRHGIDASLADDIG
FT                   KKISAGAFSEAFDLVTPAMIDAFSMAGTPDTVADRMAAVFEHADGVVVGSPLGPNPDEA
FT                   ITLAADATRRARSHRSR"
FT   gene            complement(497416..497658)
FT                   /locus_tag="Hbor_05340"
FT   CDS_pept        complement(497416..497658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66135"
FT                   /db_xref="GOA:E4NM36"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM36"
FT                   /protein_id="ADQ66135.1"
FT                   /translation="MVTLIDFVIELVTSIVRLVLTFIFDVFLGVGPISALSFLFGAAFV
FT                   TAASLALGYFVLGAALNSVSGFGASAPDASRRRRA"
FT   gene            497795..498091
FT                   /locus_tag="Hbor_05350"
FT   CDS_pept        497795..498091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66136"
FT                   /db_xref="GOA:E4NM37"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM37"
FT                   /protein_id="ADQ66136.1"
FT                   /translation="MTTDRSLDEFVGGDSSAESETDTAQSAETNDEADENAPDSSVQTD
FT                   TLEDGDSGTVSPAVGTYRWDPDGVECPTCGEMVERLWLDEDTDAQVCADCKAW"
FT   gene            complement(498114..499874)
FT                   /locus_tag="Hbor_05360"
FT   CDS_pept        complement(498114..499874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05360"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; MutL C terminal dimerisation domain; DNA
FT                   mismatch repair protein, C-terminal domain; TIGRFAM: DNA
FT                   mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66137"
FT                   /db_xref="GOA:E4NM38"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM38"
FT                   /protein_id="ADQ66137.1"
FT                   /translation="MTTETDRRVRKLDEETVASIAAGEVITRPEDAVVELVENALDAEA
FT                   TRVEVTVVGDGTDLLRVRDNGRGMSETDAALAVERHTTSKLGDVAEGTSEGHRTSSGDA
FT                   ADLQTVSTLGFRGEALPSIAAAGTLELVTNDGGTRGTRVVVAEDEKHVKPIGRARGTTV
FT                   EVRDLFAEIPARRQSLASSRAEFARVSDAVSRYALTRPDVAFSLVHETGGESPDGGGRE
FT                   VFSTSGSGDYADAILGVYDRDVAGRSSTFESEREITDNGETVTVSVEGLLAHPSVTRSR
FT                   RDHIYTAVNGRAFPSEPLRRAVVAGYGDVLPDGRAPVAVVSVSLPPPWCDHNVHPAKRE
FT                   VRLRAQRAVERTVREAVHDALSTADLRRSEDVAMDLDSTLEPVDGEESRFDGVRVIGQF
FT                   RDLYLLCEADDDLLVIDHHAAHERVNYERLRAAVGAGEVNAVESIPIDPAATVSLSPAQ
FT                   AAATAEWRDELAHLGYELDSFGGDTVRVRGVPAPMGRAAAPESVRDALDALRGGETPGD
FT                   ATDRLLKDLACHPSLKAGDALNTEEATRLVERLGSCEQPYACPHGRPTVLSIEEETFVR
FT                   GFERRSTRMG"
FT   gene            complement(499899..502724)
FT                   /locus_tag="Hbor_05370"
FT   CDS_pept        complement(499899..502724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05370"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="PFAM: MutS family domain IV; MutS domain II; MutS
FT                   domain V; MutS domain I; MutS domain III; TIGRFAM: DNA
FT                   mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66138"
FT                   /db_xref="GOA:E4NM39"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM39"
FT                   /protein_id="ADQ66138.1"
FT                   /translation="MNHADGTAVPEAASQADDAPRPEGPPQKMVAAREELTPMLSQYLD
FT                   LCESHPDAIVMFQVGDFYEAFCEAAEEVARVCEVTLTKREDSTGTYPMAGIPIDNAASY
FT                   LEALLDAGYRVAVADQVEDASEASGLVDRAVTQVITPGTVVDDELLSGATATYLGAVAG
FT                   SGDETALATVDVSTGECQVTSGSAYEIGEELDRLAPAELLSAADAPDFELGFETLVSNP
FT                   DPEAFDVDGASETLSAYVSAPESVVENESEMRAVGGLLDYAEYTQGDDGPLEYVSRVRR
FT                   YDPERSLQLDATAIRSLELFESRSPSGGRTLVGVLDETACALGRRRLTAWLRRPSVDER
FT                   EIRRRHDAVGELIDRPLARETVRDHLSEVYDLERLVSRVSRERANARDLRALKTTLDAV
FT                   PEVKSALSEMETDPLQRLCDSLDELADVRDLIGEAIRPDPPQEITEGGVIREGFDDELD
FT                   EIRATEREGREWVSNLEEQEQERTGIDSLEVGYNQVHGYYIEVTNPNLDSVPDDYTRRQ
FT                   TLKNSERFYTPELKRREDEILSASEKADALEYEVFTNVRADVAEEVERLQSLADSLATL
FT                   DVLATFAAVAAANDYVRPEMGTDTVEIEAGRHPVVERTQGEFVPNPADFSDGHVAVITG
FT                   PNMSGKSTYMRQVALIAILAQAGSFVPARAARLPILDRIFTRVGASDDIAGGQSTFMRE
FT                   MAELTDILHNATEDSLVLLDEVGRGTSTTDGLAIARATTEFVHDEVGATTLFATHYHDL
FT                   TALSERLPEAFNLHFTVEKTERESGEPDVTFLHRVADGPSSSSYGVEVAKLAGVPSTVV
FT                   ERAREYIREADGADNGQADRAVETAEAAESDSPTATQATTNGQDGRRAGNEDGTETGNK
FT                   PVEQEGTTSAPKDGTLAAYVDGIEATETDGRVTSDAEDDVLDEIRSLDVAGTTPLEALN
FT                   TLDRLKQRLDD"
FT   gene            502970..503944
FT                   /locus_tag="Hbor_05380"
FT   CDS_pept        502970..503944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05380"
FT                   /product="MoxR-like ATPase"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66139"
FT                   /db_xref="GOA:E4NM40"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM40"
FT                   /protein_id="ADQ66139.1"
FT                   /translation="MTDADAVPDATPKASTVSPLPVEDAADLTTRITDNVERVIVGHRD
FT                   AIENILIAVLARGHLLLEDVPGVGKTMLARAVAISLGGSFKRVQFTPDLLPSDVTGVNV
FT                   FNQQTREFEFQPGPVFANVVLGDEINRAPPKTQAALLEVMEEQQVTVDGESHRVPDPFT
FT                   VIATQNDVEPNRTYELPIAEIDRFMKKLRLGYPSETQETELLGRVTGDHPIDSLDPVAS
FT                   VEDVLQARRTVSQVTVREPVRSYVSRLAGYTREHAQLGVSPRGGIALVRASQARAVFDG
FT                   RDYVIPDDVQTEAQSVWAHRIRTDGDDTGAAIVARALDRVAVE"
FT   gene            503949..504968
FT                   /locus_tag="Hbor_05390"
FT   CDS_pept        503949..504968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05390"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66140"
FT                   /db_xref="GOA:E4NM41"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM41"
FT                   /protein_id="ADQ66140.1"
FT                   /translation="MRLTRRGYAVCGVVATAIALSIGFGPRSLNAIVIPAVVALAAAIL
FT                   QVRRAPVPAVERTVPNDDVPDTTGTVTLSFDTERSYPATVLDALPLGLDGDAEGETLVG
FT                   DDPFAYEVTYRKRGEYELGPATIVATDVLGLVERELLAPGTDSVLVFPRVRRLSTAARH
FT                   DLWSLYDAQISPRREEFDGLREYVRGDSLRDVHWKSTAKRDDLIVKEFVAETDASSVHI
FT                   AAGAARTASDRMAEAAATICLTFVTSGIPVTLSTPSGVVEATAGDDRQLLEHLARADGG
FT                   AVPDDAADVVITASEAATRVRYGDSETTFEMLVAETGRANGHFAGGQTGREPTGVTTS"
FT   sig_peptide     503949..504041
FT                   /locus_tag="Hbor_05390"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            504965..507202
FT                   /locus_tag="Hbor_05400"
FT   CDS_pept        504965..507202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05400"
FT                   /product="transglutaminase-like enzyme, predicted cysteine
FT                   protease"
FT                   /note="PFAM: Transglutaminase-like superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66141"
FT                   /db_xref="GOA:E4NM42"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM42"
FT                   /protein_id="ADQ66141.1"
FT                   /translation="MSSETRDTNASFSIDAISVPRAVALVGVLVLTWSYVSVLYYVTNV
FT                   VGGSSQLLFVVVGSLALATLVGSFVSVRTALGVTAVLLVGGFTVYVFTLPQSQLELLTP
FT                   ARLLSDTVALLTGLSILRLTGAGVWAMAVAPGPVFLSWYLAVRRQYVWGVAVGGVALGL
FT                   FVLTSDAGQLTTLVGVAGGTVTVAASTFERYGAGIAQLDVMSMVLAAMIVLAATISVVP
FT                   GAEGSPLLPDRGSPTVEGSLVNSPDRLNIVGSIRLSPNVRFTVNSPQSSYWETAAYDRY
FT                   TGDGWIRTGSTDPYNGRLRGPVGASQTVQQQVTAKGTISILPAAWKPVRIDGPLASEAE
FT                   VTAQGNLRPTTSLREGESYRVTSEVPIYTTAQLRRSGTNYPDDIEAAYLQLPDSTSDRV
FT                   RARAAAVTADADNPYDKAVAIEQTLEAEKRYSLSVPQPSGDIADSFLFEMDAGYCTYYA
FT                   TTMVVMLRSQGVPARFVTGYTPGQQVSENEYVVRGLDSHAWVEVYFEDVGWVRFDPTPS
FT                   GPRQTAENARVAEARQNGEPNVDVGGSEETATPTPTPTTTTAANGTEDDTNNTPTPSDA
FT                   LEPSGSGVNATPPPGSVPGLGSSVTSAGGGLSGPDLPPQRTFALGLVALIGLVAGARRT
FT                   GVTERAYRALWLRYQGTRRTPEDDTIRAYRRLEYVLERRYRPRRTGETPRTYLQSLSRV
FT                   GLDADVARVGEAYERARYGDGVARETADDAIATVDRLVRETTPLLGRLSQR"
FT   gene            507321..507614
FT                   /locus_tag="Hbor_05410"
FT   CDS_pept        507321..507614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05410"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="PFAM: Translation initiation factor SUI1; TIGRFAM:
FT                   translation initation factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66142"
FT                   /db_xref="GOA:E4NM43"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM43"
FT                   /protein_id="ADQ66142.1"
FT                   /translation="MSEVCSTCGLPEELCVCEDVAKESQEITIRIDERRYGKEVTVIEG
FT                   FDPKDVDMDSLSSDLKSKFACGGTVEDGSIELQGNHTGRVEDFLRNKGFNVA"
FT   gene            complement(507745..508104)
FT                   /locus_tag="Hbor_05420"
FT   CDS_pept        complement(507745..508104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05420"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66143"
FT                   /db_xref="GOA:E4NM44"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM44"
FT                   /protein_id="ADQ66143.1"
FT                   /translation="MDDEIDPSEVESLLDSEDPPRVVDIRSPGSFARFHIPGSENVPFA
FT                   ELPDRVASLEGADRIVTVCPHGKASIQAARLIKSYEGTADARVESMRGGLEAWEGPLEE
FT                   QKTAAEPDEGPEAPF"
FT   gene            complement(508167..508730)
FT                   /locus_tag="Hbor_05430"
FT   CDS_pept        complement(508167..508730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05430"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66144"
FT                   /db_xref="GOA:E4NM45"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM45"
FT                   /protein_id="ADQ66144.1"
FT                   /translation="MNGDGRRHESLPDPEWPVLESAVEYETGWFTGGYDLVEQPNGSTK
FT                   RYYWAELATAVVVIAVEDGQVIFVEQYRPTIRQTQLELPAGIVEGGESYTQAAERELRE
FT                   ETGFDATSSSVLEECWCSTGVLRHRRGFVFAEGLTPVERDLDDNEFLSVHTVPVEEAVK
FT                   VSREQPTNDATLEGVLLAREEGLL"
FT   gene            complement(508771..509235)
FT                   /locus_tag="Hbor_05440"
FT   CDS_pept        complement(508771..509235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66145"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM46"
FT                   /protein_id="ADQ66145.1"
FT                   /translation="MEILGTLAPESEREAREAFEASGPTAQQIVRETARAMSFDREEYQ
FT                   ERVTGEVVETARNVLFAERLAVHVGAHEEFDAWTDDHPAYEVTQLGSPNVERVVWHAAP
FT                   FADVAVAATFQNERDAAVGTLRRQAFSRIYRPRFEDGDSKTEHGETKHED"
FT   gene            complement(509400..509825)
FT                   /locus_tag="Hbor_05450"
FT   CDS_pept        complement(509400..509825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66146"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM47"
FT                   /protein_id="ADQ66146.1"
FT                   /translation="MGYACPVCDVPQQDGEHLANHLAFTAMTHGAEHESWLDEHVPEWS
FT                   SSSPDELAARVTELAEEAEYEAVFEDTVHDHAGHDHDSLFGDDTGTPEQMDIPRSGRRD
FT                   SLDADAQAVIEEAQALTREMLEDSDGDADDADEGDEA"
FT   gene            complement(509870..510241)
FT                   /locus_tag="Hbor_05460"
FT   CDS_pept        complement(509870..510241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66147"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM48"
FT                   /protein_id="ADQ66147.1"
FT                   /translation="MDDTTTEGTGRDVKERSRVVVQHDWNGEDCLAVTIARAAAEAWTG
FT                   NPDDAMTLPPVGSIVDPDALESLFEPARSRGRPATDGGYPSTDGAAQSRVRFTYVGYNV
FT                   TISEDGVVVVEDPSTLANL"
FT   gene            complement(510367..513576)
FT                   /locus_tag="Hbor_05470"
FT   CDS_pept        complement(510367..513576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05470"
FT                   /product="PAS domain S-box"
FT                   /note="PFAM: HTH DNA binding domain; GAF domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66148"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM49"
FT                   /protein_id="ADQ66148.1"
FT                   /translation="MTDSYTVLVVGTLPSRFHTERFEAAFDDATLRWVEQPEGNSTVFE
FT                   ATDCILATMEVVSSGDFDPEAAAVPVLLIGDREDSIAEIALSTDVVDYLAVRGVDAEAT
FT                   WLANRMEAAADSYRTDKKRAQLDRQQRALSDLGAFALSGPAREEVFAETVEIVTETLDA
FT                   GRAALLQSRPEHGDLSIVAAKGWPQVYVGGVAVGLDSGPGRALTNREPVVENDLSSETT
FT                   ELTAHLDAGSELSVVVGGGTEPWGVLTVHSSESGAFDETDARFTENVAALIAAVIERET
FT                   LRTTLEEMFSRMDQGLIGLDNDWRVTYMNPEAERLLDTAASEVVGTNYWDLFDSDAVKP
FT                   FRERYEKAVKTGEKVSFESYFPPHDRWYEVEAYPSQAGLSVYFADITDRTEREMELLRY
FT                   ERMVEAADDGVYALDSDQHIVQVNQAFAEMFSREQESLIGMHTTELIDEDTAAESALIQ
FT                   AEAARTGEPKRMEFKAELPDGTEVWIETHFSAIVDEETDQFVGTVGVARDVTERRHRER
FT                   SLTMLHERTREMAQADNADAVVTRTIEGCHSLFDPCRAAFFDYDATTRTLERHPQSDEV
FT                   DRGRYQSDGVNRDAPVESENDPCWVAFTEERMVRVEEGTTVQFVPVGQYGVLAVERLSG
FT                   ATIRETDAEMLGLLAATMGELLGSVETKQALRSRDQQLEQQNERLTQLNRINRTVREVT
FT                   RSVVHATTTEEATARACERLVEAEPYQFAWLCEAPEEANSDDRVVPMTTTGVEDSYAAR
FT                   LTEAAQTSPFPELLSRVASTGRRAVVNDVLDDPAWEPHRRDALAQGFRSIAVVPAGNDR
FT                   LLVVHGTRPDTFAGEDGDVLVELGETLGAVIDRLGRTQPILDERQTEVELEIRDDQHFL
FT                   VRLSTATGETATVTGVVPTAEGDYRTFVRTAAPKNAVRDALPPGTLARELTDEDDDEHL
FT                   YEVQPADTTPFETVYAGRGRLREMVAENGVCTVSLTIPSDVSVRSVVDAFAATYSRTTL
FT                   AARRTLTEPTDSVGSFRARLDEVWTERQREAISAALHGGLYDWPRKTSVSTLSEAFDVS
FT                   SPTFQYHLRAAERKLIELILD"
FT   gene            complement(513619..514164)
FT                   /locus_tag="Hbor_05480"
FT   CDS_pept        complement(513619..514164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05480"
FT                   /product="(SSU ribosomal protein S18P)-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="PFAM: Acetyltransferase (GNAT) family; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66149"
FT                   /db_xref="GOA:E4NM50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM50"
FT                   /protein_id="ADQ66149.1"
FT                   /translation="MTSPGPEREVNTDDETSESEPGSESGDSLSDVTIRRAERADLLEV
FT                   LGIEKTCFTEPWPYTAFESFLDEPGFLVAVNEGNVVGYIVADVMPNHGRDLGHIKDIAV
FT                   TPEARGIGLGRRLLQRGLVSLSFSGAALVKLEVRVGNEPALSLYRKMGFEPARRVPSYY
FT                   ADGEDALLMVLDVDAWQD"
FT   gene            complement(514314..516293)
FT                   /locus_tag="Hbor_05490"
FT   CDS_pept        complement(514314..516293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05490"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: Aconitase C-terminal domain; Aconitase family
FT                   (aconitate hydratase); TIGRFAM: aconitate hydratase,
FT                   putative, Aquifex type"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66150"
FT                   /db_xref="GOA:E4NM51"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM51"
FT                   /protein_id="ADQ66150.1"
FT                   /translation="MGQTLTEKILDDHLVEGELEPGEEIGIEIDQVLTQDTTGTMVWLQ
FT                   FEALELDEVQTELAAQYCDHQTYQFDFKNTDDHRFLRSAAGTYGAHFSRPGNGICHNVH
FT                   KENFAAPGKTLLGSDSHTPTPGGLGQLAIGAGGLDISVAMGGGAYYVEMPEVVNIRLEG
FT                   ELPEWATAKDVILELLRRLSVKGGVGKVFEYTGPGVETLTVPERTTITNMGTELGATSS
FT                   IFPTDEETKDYLARQGREDEYVELSPDEDAEYADEIVVDLSDLEPLIACPSMPDKVVPV
FT                   REVAGESVEQVIVGSCTNGGYEDILPAAKMLEDREVNKKTEMIVAPGSKQASEILARQG
FT                   WAAEMMAAGVNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDNVYLCSPEV
FT                   AAAAALKGEIVDPRDLADELDDLEAPGVELPDKYDGSKADLISPDEAVDDELIKGPNIG
FT                   NAPIGEPLEADIQGEALLKMDDNITTDHIIPATSDILKFRSNIEKLSEFTLSRVDDTFA
FT                   QRSMDADGGVLVAGENYGQGSSREHAAMCPQYLGIEAVLAQSFARIHKANLFNFGILPL
FT                   AIDEETYEKIEQGDDVEVVTDVAAAVESGQEEFTIRVNDDWEATAQLDASERERRILSA
FT                   GGKLRLTKEQYEQEGSSGATPADD"
FT   gene            516604..517002
FT                   /locus_tag="Hbor_05500"
FT   CDS_pept        516604..517002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66151"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM52"
FT                   /protein_id="ADQ66151.1"
FT                   /translation="MDDSLVARVWGDVTERVGDDLRAVTQYEATSFATRMREDLRDVYD
FT                   ADDNQTIVDDTIVTLLSGRDSERTLETGEFRAFVRVFDDAWILTWVDGLPKKSGFLISI
FT                   ERDGETATMNDVEWCIQYLDEEIEPLIE"
FT   gene            517056..517538
FT                   /locus_tag="Hbor_05510"
FT   CDS_pept        517056..517538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05510"
FT                   /product="deoxycytidine deaminase"
FT                   /note="PFAM: dUTPase; TIGRFAM: deoxycytidine triphosphate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66152"
FT                   /db_xref="GOA:E4NM53"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM53"
FT                   /protein_id="ADQ66152.1"
FT                   /translation="MFRSGSFVADHVEPIADSQVQPNGVDLTLDSLYEQVSPGRLGVDG
FT                   KEIGDREPVSADSDDGSYVLPPGGYILQYAETIHIPEGHVGFLYPRSSLMRNSCMLNTA
FT                   VWDAGYEGKGEGLLQVHHDIELEPGARIAQLVLARGNHDDVYDGSYQGERVNSPER"
FT   gene            517593..518609
FT                   /locus_tag="Hbor_05520"
FT   CDS_pept        517593..518609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05520"
FT                   /product="PAS domain S-box"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66153"
FT                   /db_xref="GOA:E4NM54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM54"
FT                   /protein_id="ADQ66153.1"
FT                   /translation="MTETPTEIYRSIFHETPNPTVITDESFSIVDVNEACLEFTGYTRE
FT                   EILGSPPLFLVNDSQTYEEMVDTLAAGEPWEGEIEAVTKYGERVFGYGATFPLITDGEL
FT                   VGYAGIFIDLSERRRSEQTVSVLNRVLRHNIRNDANVIGGVLSTIKHAVSGVERELVEK
FT                   ALERIERLLDRAETARDLHQLLERSSTALVPRDLCNVVETTAPKLVDERTTLHLDVPDD
FT                   PVWILADDALSRGVAAVVENAVEYNQDASPMIWIHVETTPDEVVLTVEDNGPGIEPEQA
FT                   EFLFGQCEDSQLRHGQGLSLFFVDRLLDFYGGSVTYRPRSPTGSIFELRFRHVSRPT"
FT   gene            518777..520006
FT                   /locus_tag="Hbor_05530"
FT   CDS_pept        518777..520006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05530"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: 26S proteasome subunit P45
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66154"
FT                   /db_xref="GOA:E4NM55"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM55"
FT                   /protein_id="ADQ66154.1"
FT                   /translation="MSRSPSLPERPRLDLDPEMSDAERLSALRQHFERLREVNRELDDR
FT                   LTEATDRRDDLQSEVDQLKRRNETLKTSSLYIATVEEVTDDGVVIKQHGNNQEVLTDTS
FT                   PHLESQVEAGDRVAINDSFAIQTVLDDETDARAQAMEVDASPDVTYDDIGGIDDQVREV
FT                   REAVEDPLSNPEMFAKVGVEPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELV
FT                   RKFIGEGARLVRDLFELAADREPAVIFIDEIDAVASKRTDSKTSGDAEVQRTMMQLLSE
FT                   MDGFDDRGEIRIMAATNRFDMLDEAILRPGRFDRLIEVPNPDPEGIVKILEIHTREMNI
FT                   ADDVDFEELAEELDGQSGADIASLTTEAGMFAIRDDRTEVRRVDFDDAIEKMRDAEDSR
FT                   SIPGHTDYQY"
FT   gene            520081..520551
FT                   /locus_tag="Hbor_05540"
FT   CDS_pept        520081..520551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05540"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Pyruvoyl-dependent arginine decarboxylase
FT                   (PvlArgDC); TIGRFAM: arginine decarboxylase,
FT                   pyruvoyl-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66155"
FT                   /db_xref="GOA:E4NM56"
FT                   /db_xref="InterPro:IPR002724"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM56"
FT                   /protein_id="ADQ66155.1"
FT                   /translation="MNTIYVVRGVGTAPTEMASYDAALAAANIHNYNLVAVSSVIPADT
FT                   TVEEVDTAPDLGPAGNRLTVVEARATTSDAGTVSAGLGWTVGPGPGLFYEASGADAEEV
FT                   RHAIEAGLSSGRNLRDWQFDNERVTTTTADADGEGYTTAITVAAYGQSEPIF"
FT   gene            520683..521063
FT                   /locus_tag="Hbor_05550"
FT   CDS_pept        520683..521063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66156"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM57"
FT                   /protein_id="ADQ66156.1"
FT                   /translation="MNGNNPYAGAPGVVDAGRPEESELSTAQVRRLREAVAGIVTRTQT
FT                   YLPEGYAVGSELSYGSNGPQATVAVHPPVGRPISAGFTPDEEDLDSGLTESDRDEVAQG
FT                   LAASAAFQVMNAVGDELTPTAR"
FT   gene            complement(521112..521375)
FT                   /locus_tag="Hbor_05560"
FT   CDS_pept        complement(521112..521375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66157"
FT                   /db_xref="GOA:E4NM58"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM58"
FT                   /protein_id="ADQ66157.1"
FT                   /translation="MSVSKRPTGETIVPAVESRYDWLLALLPLPMLLGILVAVITDIRV
FT                   AFGVSLGGLPSVAMLVYGLFVDPPLSGSSVCESSHTRLHDAD"
FT   gene            521485..521769
FT                   /locus_tag="Hbor_05570"
FT   CDS_pept        521485..521769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66158"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM59"
FT                   /protein_id="ADQ66158.1"
FT                   /translation="MDATLRSADSLRYCHRAVLATVHPVRRSGVRLVHLAHALSRLAFL
FT                   HSDGDFVFPFAATPVALSDDRFGDACVGVVTLVRYGDVAYTDMRAIRYR"
FT   gene            522072..523430
FT                   /locus_tag="Hbor_05580"
FT   CDS_pept        522072..523430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05580"
FT                   /product="divergent AAA domain-containing protein"
FT                   /note="PFAM: Divergent AAA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66159"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM60"
FT                   /protein_id="ADQ66159.1"
FT                   /translation="MSSSDTAHWSETLRVMLNASSTTDSEVTAFIDETIPDGENKLYDN
FT                   KRQAFIHADSSDQGKERNFRLLKHICALANTRGEQRYRYLFIGFGDSGGFIGASDWDAN
FT                   GGEHVVEVDEARVQDLLSDSLDPVPEVERTVLTQDDNTAAVLSVRRSDSPPVLFDTSIT
FT                   TSGGATTLVKSGVGYVRKGSQSRPMRNSDYRVIIERREDLVNEKIEEALGGLQRMVGIS
FT                   SDQLENLEISATSSDEGVPIDEIVTTEGYSDLNKRLSLSVKEWNSSGELYSSRGAVYTM
FT                   LKRRDELELDNERCEFLAWSTLNNNFPPTEWIIHHENDLEDSLLSFYQAQLNGRMISVF
FT                   EAVNYMLENERVLRAISDDGSMDFQSSKADTYLDSITDPPVEKIEDLTARRNLNITGHD
FT                   YPITDIVTSGGPVETGLEEVVDRLISDDESNDRSILRDIEYTRLAQYVSSDPE"
FT   gene            complement(524401..526218)
FT                   /locus_tag="Hbor_05590"
FT   CDS_pept        complement(524401..526218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05590"
FT                   /product="translation initiation factor eaIF-5B"
FT                   /note="PFAM: Elongation factor Tu domain 2;
FT                   Translation-initiation factor 2; Elongation factor Tu GTP
FT                   binding domain; TIGRFAM: translation initiation factor
FT                   aIF-2/yIF-2; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66160"
FT                   /db_xref="GOA:E4NM61"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM61"
FT                   /protein_id="ADQ66160.1"
FT                   /translation="MSDTDADAPSTTESNALRTPIVAVLGHVDHGKTTLLDKIRGSAVS
FT                   EGEAGAITQHIGATAVPLDTVSQMAGSLVNPDDFDLPGLLFIDTPGHHSFSTLRSRGGA
FT                   LADIAIVVVDVNDGFQPQTIEALDILKRTGTPFVVAANKIDTTPGWNPNDGSPIQETYE
FT                   NQSDNARQRLDQNLYEIIGNLSDEGFSADLYWRVQNFQKNVGVVPLSAMTGEGIPDLLA
FT                   VLMGLSQRYMKEEMAVDVGGPGAGTVLEVKEERGFGATVDVVLYDGSVRESDTIVVGGV
FT                   NGPIVTEVRALLQPRPNAEIRTEKRFDKVEEVRAAAGIKIAAPDLDDAMAGAPIRVVRD
FT                   QPVDDVIAEVESELAEIEVDTEEEGVVVKADTLGSLEAMANALREAEVPILRAEVGDVA
FT                   PRDVAVASTAREMENKVILGFNVDVLANAEDELEKTGDVRLFKDDVIYQLIEEYEEFVE
FT                   ERKRAQQETVLDKIMRPCRFRILEDHVFRQSSPAVVGVEVLSGTLKNNANVVKWEGNET
FT                   TRVGQLSGIQEQGEDVSEARAGNRVSVAIDGPTVGRQIEEGDELWTELPEKHAKILEQE
FT                   LSDEIPADELEALTGYLDKHRQRDPFWGK"
FT   gene            526723..526968
FT                   /locus_tag="Hbor_05600"
FT   CDS_pept        526723..526968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05600"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66161"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM62"
FT                   /protein_id="ADQ66161.1"
FT                   /translation="MADVLAENLSGKAVMGSDGTELGMLYNITMNLKTGKLHDLLVSPH
FT                   EEIHPDQFSFQQDEQGRFCVPVSRVQAVKDYIVVQR"
FT   gene            526987..527445
FT                   /locus_tag="Hbor_05610"
FT   CDS_pept        526987..527445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05610"
FT                   /product="predicted nucleic acid-binding protein with PIN
FT                   domain and Zn ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66162"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM63"
FT                   /protein_id="ADQ66162.1"
FT                   /translation="MQVLDSSAFIHEYHTDDQTASIPLVSDELEGEASFRFDAMEGAGM
FT                   HIHIPASGTVEKIRRAAGETGDRETLSDTDIRLLAAAFELDATLVTDDYAMQNVAERVN
FT                   VHVNVIAQDGIEEQRDWRFQCQGCGREFDEHKDRCPICGMELARKNPA"
FT   gene            complement(527512..528261)
FT                   /locus_tag="Hbor_05620"
FT   CDS_pept        complement(527512..528261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05620"
FT                   /product="predicted metal-dependent membrane protease"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66163"
FT                   /db_xref="GOA:E4NM64"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E4NM64"
FT                   /protein_id="ADQ66163.1"
FT                   /translation="MASDVSSQTSDLPAPVRAFGSVALVVVLVLLCASIFVSFGTAIFR
FT                   TVGIDRGSALYIALRSGSQFVGFGVAAVGYLTVTDQWELVYRRVPSLRDLKWITAGFGV
FT                   LLVLYLAINVGLTALGIDSGDSAVAATAEGQPVLLLYYIPVTLLLVAPTEELVFRGVVQ
FT                   GLFRREYGVPFAIAGSSLTFASIHATSFTGEGAVVSLIVVLILGGVLGIVYEKSESLVV
FT                   PVVAHGLYNTVQFAATYAMAVGLVGSV"
FT   gene            complement(528351..529643)
FT                   /locus_tag="Hbor_05630"
FT   CDS_pept        complement(528351..529643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05630"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66164"
FT                   /db_xref="GOA:E4NMK9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMK9"
FT                   /protein_id="ADQ66164.1"
FT                   /translation="MRVDLGNILSTTPGVSEASLERLDEQVAAAHETIEAGRADAEHGY
FT                   AALNLPETADPDAIRAAVEPFESPEAVVTVGIGGSALGAATLSAGLSGPDDPEAYYLDN
FT                   VDPEHVTRLLDSLSLSETVVNVVSRSGTTAETLSNFLVVRDAMESAGVDWTERTFVTTG
FT                   EEGNLRNLAAKHDLPSLPVPDGVPGRFSALSTVGLAVAAIQGHDLEALLAGAQAEADRL
FT                   SGSLFESPAYAYGAASYALANRGALTNAMMPYSEDLEYFAEWFAQLWAESLGKDGLGQT
FT                   PARALGATDQHSQLQLYRAGPRDKLVTLVRPTERDDRAIPETDLEGLSYLGGSSLGDLL
FT                   DAEFEATEASLAAAGVPNIRVEIDDVDERGLGELLYGMEAACVLYGELAGVSTFTQPAV
FT                   EWGKRAARGLLGGGDFEEADAVSEKTQLVVE"
FT   gene            529770..530303
FT                   /locus_tag="Hbor_05640"
FT   CDS_pept        529770..530303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66165"
FT                   /db_xref="GOA:E4NML0"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML0"
FT                   /protein_id="ADQ66165.1"
FT                   /translation="MASGYNGVFGAFPYAFRQSRSRLFKSYVVCSALAVAFISLFIVIA
FT                   LIVLVGQTAAIQGGQLTLSRAFYIVVGLLVILPAVAPTLVVARRHRRGIESSPRYEVAL
FT                   AIAGYLFLLSLYLGAVASMPETFVLDGETVARPAPTGLFAPVISLLYAIPQAFSWSVPL
FT                   VGALLVAAAHKLFG"
FT   gene            complement(530331..531014)
FT                   /locus_tag="Hbor_05650"
FT   CDS_pept        complement(530331..531014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05650"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66166"
FT                   /db_xref="GOA:E4NML1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML1"
FT                   /protein_id="ADQ66166.1"
FT                   /translation="MRTRLFASSAARRTTVRRLGLCCLLLFIGAVSVRRYASFIFDPAW
FT                   IRATVVGLGPYAAPGFIIVQTAQVVFAPIPGQTLGIVGGYLFGTVAGTAYSMLGVVIGS
FT                   TVVFCLARRYGRPFVERVIAADVLDRFDSFAAEHGVIGLFAVFLLPTFPDDAICALAGI
FT                   TTLRYRTFIALVAVGRLPTFALVALVGDEFAAGQTTTALAILSVIALLSVSIYAARERF
FT                   TAVGS"
FT   sig_peptide     complement(530904..531014)
FT                   /locus_tag="Hbor_05650"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531011..531616)
FT                   /locus_tag="Hbor_05660"
FT   CDS_pept        complement(531011..531616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05660"
FT                   /product="phosphatidylserine synthase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66167"
FT                   /db_xref="GOA:E4NML2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML2"
FT                   /protein_id="ADQ66167.1"
FT                   /translation="MIQRLTVADWLSLAALFWAWVGAVLFVQGEVNWGIVAVLGGFVFD
FT                   KLDGYYAREHGTPSSFGRQIDSFIDIFTYLVSAALVYHVAMRPHWIASAVVGFVVLMFG
FT                   GLRLIRHNDEGFVGDGDTSYYHGTTVVHTHLVVLVNYFLLQFVPFWNGWVAGLTIVAVC
FT                   PLMTSEYKAPKTDNAHFLVAVGGAVTVALCLGLELGIV"
FT   gene            complement(531781..532389)
FT                   /locus_tag="Hbor_05670"
FT   CDS_pept        complement(531781..532389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05670"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66168"
FT                   /db_xref="GOA:E4NML3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML3"
FT                   /protein_id="ADQ66168.1"
FT                   /translation="MPALWRLTRTDHARRVYETLKRVGITGTRMYQYIADPTDGRGAGN
FT                   DADGVRFETRTREDVGNEYGAFAELLPEERVICALDDETIVGYLFVSLDTRHRIHPLEE
FT                   TLRFDGGYVRRVFVQPDYRNRGIATALVSRAREWAADRDATAAHALVARDNKPSRWLFE
FT                   ANGFEAVHEHVYYRVGPLSHRSIEQLGAEGSSQYPYIRI"
FT   gene            532472..532948
FT                   /locus_tag="Hbor_05680"
FT   CDS_pept        532472..532948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66169"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML4"
FT                   /protein_id="ADQ66169.1"
FT                   /translation="MTEDERVEGTFLVTAADEDSAVLKNVESGQVHTLSSNPGVERHDA
FT                   VEGVVAPDPPMNVTYQLIEVESKWGLSIEVSEESPTADSRDIAADQPVGDLTRKERAGI
FT                   GEIHVITVPEGETEQAVSDVAEDEENTLSRAARLGVNRVEIRSDSGVVAVRYMP"
FT   gene            complement(532961..533875)
FT                   /locus_tag="Hbor_05690"
FT   CDS_pept        complement(532961..533875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05690"
FT                   /product="glycosyl transferase"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66170"
FT                   /db_xref="GOA:E4NML5"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML5"
FT                   /protein_id="ADQ66170.1"
FT                   /translation="MGTPPTSVLLPTVRWTDACDDVASQLGPDDELLIVCDNDADPVAA
FT                   RADDLPEGVRLVIAGDPEGCSGKANAIAVGMGAARHDRIVWTDDDFVHPPDWLDSLHAD
FT                   YERHGPVSEVPFFVGRDPLSTLTEPLYAIGGTLGTYQDNKAWGGAVMFERDDIGETAFL
FT                   AALCQTVSDDGLLSEHLDLTTLRRARLVPVGGSIRESAERHVRFSQIVYRHEPRGMGVI
FT                   LGLAALFTVMGALSPVLVFVLSTLLSVAVYAFFGVRRWTALLGYPAMMLQLPLFLYGLV
FT                   RRTFVWGGRRYRWRSKYDVEVVE"
FT   gene            complement(533934..534320)
FT                   /locus_tag="Hbor_05700"
FT   CDS_pept        complement(533934..534320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66171"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML6"
FT                   /protein_id="ADQ66171.1"
FT                   /translation="MTDGQADTTAAPNKREQAQRVVISYPDELSAWARDQLDTDRFRKY
FT                   LRRVLDDLTLGHTWEEFVDVGCCGNSLDVPLRIESVDGPGEMGSDTEIEYTTRETEPGE
FT                   MAGGWQVQSEGGPNATTGKTREER"
FT   gene            534468..535358
FT                   /locus_tag="Hbor_05710"
FT   CDS_pept        534468..535358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05710"
FT                   /product="protein translocase subunit secF"
FT                   /note="PFAM: Protein export membrane protein; SecD/SecF GG
FT                   Motif"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66172"
FT                   /db_xref="GOA:E4NML7"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024921"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML7"
FT                   /protein_id="ADQ66172.1"
FT                   /translation="MVEFTVPEVDYTRYTNRQLAAVPLAVLAVALLVVAGWYVATGAPV
FT                   NQGIEFTGGTEIQVVVDDASNPHAQINDAFTAEPESIQSVPAEGSLYIVTFQSEDGSSG
FT                   AVNSNTLEQQAESAGFEVRSISSVSANFGSDTQWLALGGVAAAFLGMSILVFAMFRSFV
FT                   PSIAVVISAFSDIVIPVALMNILGIELSLGTVAALLMLIGYSVDSDILLNNHILRRSGD
FT                   FYESTYRAMRTGVTMTLTSIAAMIVMTITATIFGIQLLAAIGTVLVFGLAADLMNTYML
FT                   NLSLLRWYKFEGVSR"
FT   gene            535358..536929
FT                   /locus_tag="Hbor_05720"
FT   CDS_pept        535358..536929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05720"
FT                   /product="preprotein translocase subunit SecD"
FT                   /note="PFAM: Protein export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66173"
FT                   /db_xref="GOA:E4NML8"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024912"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML8"
FT                   /protein_id="ADQ66173.1"
FT                   /translation="MGRLRDNWRVLLLVVFLLVSTFALFSPTLASEPANAAPGNATATG
FT                   PTNLKFGLELSGGTRITAPLVGLTAENVQFNDDEPRVVEQNVAAELEGATSSDVTARLS
FT                   ANASTVEVTAENITEQEFRSALDASGYQYETVREGVTAATREEVVGVLNDKINEAGLSG
FT                   GSAQQVTTATGQHFIRVEAPNRDTSEVQKLVSERGTVVVKAYYPVEQNGSTTYKSKIVL
FT                   EREDFQDIGTAQETQSGPAVPVTVKESVAPEFQQTMVDTRVARPGGSRCEYDQNPNSTE
FT                   SCLLVVVDGEVVNSFGMAGRLAGSMQRGEWAKDPGFQLQTLSMSEAQQVAINLRAGALP
FT                   AKLDLSGEDGGTTSYISSGQGASFKIDSLITGIIAVLAVSGVVFVRYSDVKVAAPMIVT
FT                   ALSEVVILLGFAAAIGYPLDLSVIAGFIAVIGTGVDDLIIIADEVMAEGEVSSRRVFQS
FT                   RFRKAFWVIGAAAATTIIAMSPLAVLSLGDLQGFAIFTILGVLVGVLITRPAYGDILRA
FT                   LTTNDR"
FT   sig_peptide     535358..535465
FT                   /locus_tag="Hbor_05720"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            537102..537311
FT                   /locus_tag="Hbor_05730"
FT   CDS_pept        537102..537311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66174"
FT                   /db_xref="UniProtKB/TrEMBL:E4NML9"
FT                   /protein_id="ADQ66174.1"
FT                   /translation="MSADCPLTSNAGTAPFADPPTEALVATVVEYDDEPDECTIYPLHA
FT                   DEDERVTSWISAKRGSYVQLDEMR"
FT   gene            537447..537815
FT                   /locus_tag="Hbor_05740"
FT   CDS_pept        537447..537815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05740"
FT                   /product="molecular chaperone (small heat shock protein)"
FT                   /note="PFAM: Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66175"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM0"
FT                   /protein_id="ADQ66175.1"
FT                   /translation="MLPERPTNAWTQGLDLPSRLFSTGRNDYELYEEDGEFVLSVEMPG
FT                   FDPEEITVTWDDAVLNVAAEHEDEARGRRKTYHRRFRFPKNVDDEGIAATYNNGILQVT
FT                   LPVATGTTAAGKQIEIES"
FT   gene            complement(537863..538537)
FT                   /locus_tag="Hbor_05750"
FT   CDS_pept        complement(537863..538537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05750"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: Ribonuclease HII; TIGRFAM: ribonuclease H,
FT                   mammalian HI/archaeal HII subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66176"
FT                   /db_xref="GOA:E4NMM1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM1"
FT                   /protein_id="ADQ66176.1"
FT                   /translation="MTDQSPVRIGSDEAGKGPVLGPMVAAAVRAPADALPDGIDDSKRL
FT                   TSAQREEIDQTLRGRDDVTVGVATIDPVRIDDPTTDMNSLTVAAHVAAVAAVAQDADEV
FT                   VTDAGDVDESRFGRRVRTGVGDEGTDVTVVSEHRADETYPHVGAASVVAKVRRDTLMET
FT                   IGERYEDYGPVGSGYPSDPTTREFLRTYVSETGELPDCARASWATCDDVLNAAAQSSLA
FT                   DF"
FT   gene            complement(538639..538803)
FT                   /locus_tag="Hbor_05760"
FT   CDS_pept        complement(538639..538803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66177"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM2"
FT                   /protein_id="ADQ66177.1"
FT                   /translation="MCHHRESSPEWEALVEKELRTEEEEMDDEEAEPHELAEEESPDPE
FT                   PAEPHVADD"
FT   gene            complement(538876..540159)
FT                   /locus_tag="Hbor_05770"
FT   CDS_pept        complement(538876..540159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05770"
FT                   /product="conserved hypothetical protein TIGR01213"
FT                   /note="PFAM: THUMP domain; TIGRFAM: conserved hypothetical
FT                   protein TIGR01213"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66178"
FT                   /db_xref="GOA:E4NMM3"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM3"
FT                   /protein_id="ADQ66178.1"
FT                   /translation="MSILEDARELAAQGPICDPCLGRVFADKSYGLTNAERGRSLRVAA
FT                   ALEDDEEPEDVAREDCWVCEGECARFDDWAERCAESVEDVEFDTYQVGTRAPPLVEENE
FT                   VLLREGAGLPDDAGELFKSEFNREVGKRFGRLTETDVEFGRPDVQFLLDIDADTVEVEV
FT                   NSTFVYGRYRKLERDIPQTEWPCNKCHGSGYLGKQPCDKCDGTGYMYQDSVEGLSAPVV
FT                   MDVMDGTDAKFHGAGREDVDALMVGTGRPFVIEVMEPRRRNVDVERLEGDINAFAEGKI
FT                   EVEGLRLAEYDMVERVKELNASKRYRAEVEFGDDVSETELTDALEELDGATIEQYTPNR
FT                   VDHRRAALTRTREVFEATGEWENERHATVEIHGAGGLYIKELVSGDDGRTNPSLAGILG
FT                   VDAEVTALDVTGVYGVDEEFEDEAFFRD"
FT   gene            complement(540343..540654)
FT                   /locus_tag="Hbor_05780"
FT   CDS_pept        complement(540343..540654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66179"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM4"
FT                   /protein_id="ADQ66179.1"
FT                   /translation="MAITQPSQNAQQDDYPVAASLTVLVTRDADGDLQEGVRARLDAVE
FT                   CVASVDRVDVSGLRPALNDMRVDLDAALRVSGPPDAESVADALEAGFGVKEVREVSMA"
FT   gene            complement(541201..542244)
FT                   /locus_tag="Hbor_05790"
FT   CDS_pept        complement(541201..542244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05790"
FT                   /product="PEP phosphonomutase-like enzyme"
FT                   /note="PFAM: Isocitrate lyase family; TIGRFAM: isocitrate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66180"
FT                   /db_xref="GOA:E4NMM5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM5"
FT                   /protein_id="ADQ66180.1"
FT                   /translation="MSEDPYERTTGADVFTRDVDNPSAREFRRMLDEQNFVFAPGIYHA
FT                   LDARLAELADLDAAYMSGYSTVLGQFGFPDLEMVTMTEMVENAKRIVEATNLPVIADCD
FT                   TGYGGVHNVRRAVREYEKAGVAAIHIEDQTTPKRCGHIAGKQIISRDKARARFEAAVDA
FT                   KQSEDTFIIARTDAYGSSNGDWEEHLERGRIYADAGVDMVWPEMPDPSREDAVNYAETI
FT                   HETHPDLKLAFNYSSSFAWSKEEDPLTFEELGDLGYEYIFITLFGLHSGAHSVYEDFRA
FT                   LAETDEEAQFDLEGRYLDHPTESHHELSFVSDYQETEMQFDGEARNRIENSEGFSEEES
FT                   TPIESDD"
FT   gene            complement(542241..542588)
FT                   /locus_tag="Hbor_05800"
FT   CDS_pept        complement(542241..542588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05800"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM6"
FT                   /protein_id="ADQ66181.1"
FT                   /translation="MFIYESLNSGDEVTPDGSTRRSTRPSTHVPYAESLDRHPRSTDTT
FT                   QMTKHMTRRTTRPMTRDRPNDEENMEAPLVPFIIDPTEQTSDNEIRNLRRDIAALRTQL
FT                   DRIETRMEENQ"
FT   gene            542768..543721
FT                   /locus_tag="Hbor_05810"
FT   CDS_pept        542768..543721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05810"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66182"
FT                   /db_xref="GOA:E4NMM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM7"
FT                   /protein_id="ADQ66182.1"
FT                   /translation="MSSAITIRDLRKSYGGVQALDGVDLDVPEGSFFGLLGPNGAGKTT
FT                   FINILVGLVRKSGGEARVFGYDVEDDYREARDRIGLAPQEFNVDRFFPIREVLEHKAGY
FT                   HGIPADEARERADEVLKRVGIYDKRDTRFDWLSGGMKRRFVLARALITDPDLLILDEPT
FT                   AGVDVQLRHELWETITELNDSGTTILLTTHYIEEAERLCDEVAILDSGRVLEVASPDEL
FT                   MDRGTDDIVVTLRDQPTAVPDFTVDDERVEAVELDGTRLVVTAREGGLVAPEVVRRLDA
FT                   AGHEIVDLEISRTSLEEVFVEMTRQDEGRATMEVEQ"
FT   gene            543718..544485
FT                   /locus_tag="Hbor_05820"
FT   CDS_pept        543718..544485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05820"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   system, permease component"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66183"
FT                   /db_xref="GOA:E4NMM8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM8"
FT                   /protein_id="ADQ66183.1"
FT                   /translation="MSVERTGFLALLKREVLRFVRRPRNTFVPPFITNVLYFSVFGVIL
FT                   GERINEIAGVPYILFILPGLIVLGAVSNAFENASFSIFHGRWNRYIEEVLTSPLSYRSM
FT                   VGAYVLSSATRGIFVGALVAVIGVFFTTVGVVRPFYLIAFMLVITLLFASLGVVGGLWA
FT                   EDFDDLTMMNQFILRPLVFFGGVFYSLNELPATLQQVSLLNPMIYMVNGVRYGFLGVSE
FT                   VDPNMSLAVLVALTVAVSAVNVALFRRGYGLTD"
FT   gene            complement(544467..544787)
FT                   /locus_tag="Hbor_05830"
FT   CDS_pept        complement(544467..544787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66184"
FT                   /db_xref="GOA:E4NMM9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMM9"
FT                   /protein_id="ADQ66184.1"
FT                   /translation="MEDDTTKFAGSPWTWRITFSSAALALASHLVGGVSTELLTGALTT
FT                   VALSGAVLILYRHGQRRESPSGDGNDDESRREKEMKAEAADSAVTADIDRARGRFGQSV
FT                   SP"
FT   gene            544926..546611
FT                   /locus_tag="Hbor_05840"
FT   CDS_pept        544926..546611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05840"
FT                   /product="gamma-glutamyltransferase 2"
FT                   /note="PFAM: Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66185"
FT                   /db_xref="GOA:E4NMN0"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN0"
FT                   /protein_id="ADQ66185.1"
FT                   /translation="MNIDENADIDRFTSRRSTVYGQRGVVATSQPLASAAGIQMLREGG
FT                   NAFDAAVATAAALNVVEPTSTGLGGDVFALYRTADGDVGAMRACGGAPAEATIENVRES
FT                   VAEENDVDSEDAEMPDTGAHTVTVPGTARGWEATVDAFGRLTLADALQPAIRYATDGYP
FT                   VSEVIADAWTHGEEVFETDNAREAFLFDDEAPDVGQTVTFPKLGATMEQIAEKGADVVY
FT                   EGDIAEQIADEVQSQGGFMTVDDLADFEVEFPDPISTTYNGVEVFELPPNNQGLIALEA
FT                   LNIAEEIGAHESELGSADRIHYFGEAMKLAFHDGHRYITDPAYEEIPPLASKEWAEKRA
FT                   TAIGEEANDDVSFGVPDASNEAPGRQRPPNPQEPPEPPEDSDTVLLTVADDEGNVVSYI
FT                   NSRFAGFGSGLVAGDTGIALQNRGSSFSLDPSHPNRLEPGKRPFHTLIPGLLKFDEDDW
FT                   AAFGVMGGYMQPQGHLQVVSNIVDYGMPLQAALDFPRWRYREDGSLAIEERTGDSVGTK
FT                   LTRRGHDVRLLSPSLFGGAQIARSDHGTLSAATEPRKDGNAQGY"
FT   sig_peptide     544926..545030
FT                   /locus_tag="Hbor_05840"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(546641..546847)
FT                   /locus_tag="Hbor_05850"
FT   CDS_pept        complement(546641..546847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66186"
FT                   /db_xref="GOA:E4NMN1"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN1"
FT                   /protein_id="ADQ66186.1"
FT                   /translation="MVSLKAVGRVLTSLLGTMFGTLLIGLGLVHVLGSNEPPWQLAFGI
FT                   VLLSGAALLVKSASVTRRAFTSA"
FT   gene            546989..547492
FT                   /locus_tag="Hbor_05860"
FT   CDS_pept        546989..547492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66187"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN2"
FT                   /protein_id="ADQ66187.1"
FT                   /translation="MSPADGPTGKREDRHGFDDTKSPITDALGKFVPQAIVKRSLSLSV
FT                   RTDKETYAPGEPVELTVEIENRLPLPVAVHTPTHRLWGWTVDGELEASDEQIYLPESPS
FT                   KLSFRAGERKVLTQTWNGLLKRVGDDDTPTRWVEPTCGVHEIGAYLALDGTRPEDTTEI
FT                   RIAD"
FT   gene            complement(547579..548871)
FT                   /locus_tag="Hbor_05870"
FT   CDS_pept        complement(547579..548871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05870"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66188"
FT                   /db_xref="GOA:E4NMN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN3"
FT                   /protein_id="ADQ66188.1"
FT                   /translation="MSKGMVTESSEEVNFGETLLRVEGLTKYFSQGSGFIGNLLNDDEV
FT                   KAVDDVTFNIAKGETLGLVGESGCGKSTLARTVLRLLEPTDGAVWFKDDNLAEMSGEEL
FT                   RTMREDMQMIFQDPQSSLDPRMKVGPIVEEPMKAHGLYKGQREERARMLLEKVGLDPQH
FT                   YNRYPHQFSGGQRQRVNLARALAVNPDFIVCDEPTSALDASIQAQVLNTMRDLQDEFGL
FT                   TYLFISHDLSVIRHISDRVAVMYLGQLVELAETEELFENPQHPYTNALLQSIPVPDPRH
FT                   GGQRGVLEGDVPSPIDPPSGCRFRTRCPRLIAPEKYDLTLEEWDDIKAFMRETERRTFE
FT                   LDGEASLRQEFFPNGTPDGEAGSLVETSIDDVLNDDWDAAEERLTESFAEQSICAQEIP
FT                   EYEVESEHGNDIHIAACHLHHDDISGSANAD"
FT   gene            complement(548868..549983)
FT                   /locus_tag="Hbor_05880"
FT   CDS_pept        complement(548868..549983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05880"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66189"
FT                   /db_xref="GOA:E4NMN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN4"
FT                   /protein_id="ADQ66189.1"
FT                   /translation="MSEPILKVENLKTQFFTEEGTVRAVDGISFEVNEGELVGLVGESG
FT                   AGKSVATSSIMRLVEDPGEVVGGTVTYKGKKLIDIEEGSDGELRQSSEMLSNEEMRKQI
FT                   RGREIAIIFQDPMEALNPVFTVGGQLREFIEINRDVSSEQAKEIAIDMLREVGIPEPEK
FT                   RYDSYPHQFSGGMRQRVIIAMALACEPDLIIADEPTTALDVTVEGQILDLVKELQEKYN
FT                   TSFVWVTHDLGVVAEICDRVNVMYLGEIIEQADVDDLFHKTRHPYTDALLDSIPRPDQS
FT                   VDELNPIKGVMPEAINPPSGCRFHTRCPEARTVCKEVRPTYQDVSDPNESSHYVSCVKY
FT                   ENVGYDDAEPLETEATDAFSGGLVEARGDGE"
FT   gene            complement(549983..551002)
FT                   /locus_tag="Hbor_05890"
FT   CDS_pept        complement(549983..551002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05890"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66190"
FT                   /db_xref="GOA:E4NMN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN5"
FT                   /protein_id="ADQ66190.1"
FT                   /translation="MSNATTRTDADESGPEQPEARVGLRYTLSQVRRDPTALVGLGVIA
FT                   LMTTVALIAFIDGVLFGFLAEFKTFANMGIHQYMLADMFWINPVNDPSNAQILRPPVYQ
FT                   TNELYPNDPGTWAHPLGTDHRGRDILARLFYGTRIAITVAIVSTGIAMIFGMLVGAVAG
FT                   YYGGWIDDALMRASETLYAIPFLILVIAFMTAFGKNLTYAMIGVGIATIPTFARLIRSR
FT                   VLSVREEDYIEAAQAAGVRDRDIILRHVIPNSFAPVLVQATLQVGVNILIIAGLSFLGY
FT                   GAQPPTPSWGQMLSNSREYMLPNPWFSIWPGIAILITVVGFNLIGDGLRDALDPRINN"
FT   gene            complement(551005..552003)
FT                   /locus_tag="Hbor_05900"
FT   CDS_pept        complement(551005..552003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05900"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66191"
FT                   /db_xref="GOA:E4NMN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN6"
FT                   /protein_id="ADQ66191.1"
FT                   /translation="MGRLRYTISRLLQSIPVIVGVITITFFLTDAIPGDPVQIMLGPSP
FT                   SAQQAAAIRAKFGLDQPVHVRYFKYLLDVVQLKLGTSIYYGVPVTQKIAERLPITLYLL
FT                   LSSFTFALITAVPLGIISAKRRNKPTDHVSRIVALLGVSTPSFWIGLMLIIIFSFWLDI
FT                   FPATNIVLPWAAPAAVDGAANQIDVILTSIHHLILPTITLGTLQMAAFTRIERSSMLEV
FT                   LGEEYVKLARAYGVSESKIVRKHAFRNAQLPLITLVGLQLTSALGGAVLTETVFSINGM
FT                   GRLIITAIQNQDFQLVMGTTLVFGLVFVIGVILTDLSYAYVDPRVSFEGEE"
FT   gene            complement(552103..553755)
FT                   /locus_tag="Hbor_05910"
FT   CDS_pept        complement(552103..553755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05910"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66192"
FT                   /db_xref="GOA:E4NMN7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN7"
FT                   /protein_id="ADQ66192.1"
FT                   /translation="MSDKNNTTHSKLNRRRVLQGLGGAGIAGLAGCAGGSDTGTDSGNT
FT                   DGGNEESNNKLKMALVKSPIEFDPIIANDVPSSQVIDRIVEGLYTYDESTGIVPALAKG
FT                   EPEVSKEGKRYVVKLNSDATYSNGDKVTAEDVKYSYTAPVTEETENASELNMIDTITVV
FT                   DEETVQFDLKYAYAPFMTTLTWYVVPKSVREEDKNAFKSGDSLIGSGPFVFDSWQEGQY
FT                   ARIKANENYWGEPKPKVPEIEFVPVTEATTRVTTLKNSENDVIEEIPPKQYPTVRSISD
FT                   ASIQEVPGIGYFYAAFNCKEGPTADPKVREAIDYAFDMDQAVSSYVEPTGIRQYSPYPK
FT                   SISEDWGFPLDEWKSIPHSKDIDKTKSLFDEAGVSDDYSFQVIVPPDDKREQIGISISN
FT                   GIKEAGWDASVQRLDWGAFLDKYVSGSEDDYNIYTLGWSGSPDPDAFSYFLFGRDEDTL
FT                   GVTNGTYYGNNSESGKEVSEKFIKARQMLDRDKRKQLYTEATTTLLEDRAHLPAYNLKN
FT                   SFGVKDYVKDFHAHPVDSFTVATDYNNLSVGTK"
FT   sig_peptide     complement(553651..553755)
FT                   /locus_tag="Hbor_05910"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            554133..554729
FT                   /locus_tag="Hbor_05920"
FT   CDS_pept        554133..554729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05920"
FT                   /product="uncharacterized conserved protein"
FT                   /note="PFAM: Protein of unknown function (DUF358)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66193"
FT                   /db_xref="GOA:E4NMN8"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN8"
FT                   /protein_id="ADQ66193.1"
FT                   /translation="MRQFVIIGHDAPTTPEFSLDDLAGGAGRLDVLCRCVNSAFFLSHA
FT                   IRESVRVHLVLGDEFTVRFEGAELRRLNPDERSTAALIRGALDVREEAIGHMPAEASPG
FT                   VSIRRMGFDATLDAVATDGTVIELHENGDPVADVEPPEDPVFVLSDHHDFTDDEAAALA
FT                   DAADERVRLGPEVLHADHSITVAHNYLDTDGFSSY"
FT   gene            554795..554867
FT                   /locus_tag="Hbor_05930"
FT   tRNA            554795..554867
FT                   /locus_tag="Hbor_05930"
FT                   /product="tRNA-Pro"
FT   gene            555000..555722
FT                   /locus_tag="Hbor_05940"
FT   CDS_pept        555000..555722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66194"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMN9"
FT                   /protein_id="ADQ66194.1"
FT                   /translation="MTEAIDFDFADTAAVAERRDEVVAAVESHAGRIARELALLQGGDY
FT                   GQEAFNTPRGTWTVKYEGGALQYLRYEGNGGSETYVVSTKRQPDPTELATAMQDYESFV
FT                   ESYNDYVESRSGVLDDVSTDFPEPHETSGVVAERDRIVDRIREVCDEIAVQLHRYDGTD
FT                   YGTFATTVSGTRWELKRELDRTSYLRVGGEGGVYLLSQYEPPAAPDVRQLVGGFEGFVE
FT                   SYNDYVAELESDLDGISL"
FT   gene            complement(555740..556759)
FT                   /locus_tag="Hbor_05950"
FT   CDS_pept        complement(555740..556759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05950"
FT                   /product="Predicted membrane-bound metal-dependent
FT                   hydrolase (DUF457)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66195"
FT                   /db_xref="GOA:E4NMP0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP0"
FT                   /protein_id="ADQ66195.1"
FT                   /translation="MFVGHEFLAFALAGTLTRLTGRDARTALFAGGVAALCALLPDLDV
FT                   AYGFATYLLAVADGTTLSWDAFWGVTNGVHRVVTHPLPVGAAATLCFAAAVAIVPARGR
FT                   GKETRMQNRTPHGLLIHTTLAVVASVVAAAVIWAMARVSSESAAVVAATYLGTVCVVGA
FT                   AVSRRFGKESRLGIGTPTLAFAAGVGFLTHPFGDVLMAAPPPLFAPAAPSPLTDRVVFS
FT                   ADETVNLLNILFVEVATVWAGLFTYLRLTGHRLRDAFAGRAVVGVGYAAAAFVLPRPTM
FT                   VDAHYLGFTVVPLAVVVGATAFGRGATSRRMRAVRALTIGLATLTIAAVAYLVAYLLI"
FT   gene            556984..558246
FT                   /locus_tag="Hbor_05960"
FT   CDS_pept        556984..558246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66196"
FT                   /db_xref="GOA:E4NMP1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP1"
FT                   /protein_id="ADQ66196.1"
FT                   /translation="MTGLRPDTGRQAGTMLIVFGVVLLVSSLVVSAALAPSVGAAGNDG
FT                   TPQTLVGSQGGGPGLHESGSVYLLDGKETKWKAAETDSYFDVTMLDNGSVATGFMDSGY
FT                   EDCEPYESPCTHTGFRILEPTDDGGAEIVYEYSFPVRTRSNSEVHDVELLDSGEFLVSD
FT                   MEYERIFTVKNGEVTWQWNASSMYDAPADPTTTDWLHINDVDALSEDRYLVSVRNANQL
FT                   VVIERGEGVVEVINKDENGDGTGDPEVLLQQHNPQWLNNGSVLVADSHNDRIVELHRNN
FT                   TTDEWEVAWAVYEAEGVPFSWPRDADRLANGNTLITDSLNQRVVEVNESGMTVWSYKTP
FT                   YVPYEAERLPEGETVGATTYAVNEDATVYGNGDVPVLSLLLILFQTGIQVPFWFTELHV
FT                   GVTLVSLTMTIAGTVLIVRDR"
FT   sig_peptide     556984..557079
FT                   /locus_tag="Hbor_05960"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            558328..558903
FT                   /locus_tag="Hbor_05970"
FT   CDS_pept        558328..558903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05970"
FT                   /product="NUDIX family protein"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66197"
FT                   /db_xref="GOA:E4NMP2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP2"
FT                   /protein_id="ADQ66197.1"
FT                   /translation="MVDDDDTAQADELAWETTASAVEYTCPGFDVQMDDVVLPDGTETE
FT                   FHYVDEPEAVVVLPFTPDDDVVLVEEWRQAVGRVNRGLPAGSLESDDDDIAAAARRELT
FT                   EETGYEAGSLEYVGSVEPANGLLNSVHHHFVARDCEPTGEQELDFNESIRVAVEPYDDV
FT                   LTAALDGEMRDGRALHGVLRYELAERWR"
FT   gene            558967..559749
FT                   /locus_tag="Hbor_05980"
FT   CDS_pept        558967..559749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05980"
FT                   /product="CAAX amino terminal protease family"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05980"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66198"
FT                   /db_xref="GOA:E4NMP3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP3"
FT                   /protein_id="ADQ66198.1"
FT                   /translation="MQTVSSEPDASSPSSQLRALAVAILLAIAGPALGIAFVFLVSVPL
FT                   VLTGIEITPILNISISLVFLTWGGIGGMAFLYLRYRNEDLSYFGIHLPGPRDILAAGIG
FT                   YVAALGLGYSSVILVSQLNVETGTNQAAQLGMENPEVLLLLIPASFLFIGVGEELLFRG
FT                   VVQSRLRESFSPAVGILLASVIFAAIHFFAIGGTPMARLTSISILLLPSVVFGIVYEYT
FT                   DNLLVPIFIHGAYDATIFFFLYLAVKFGTVPQESFLFF"
FT   gene            complement(559765..560346)
FT                   /locus_tag="Hbor_05990"
FT   CDS_pept        complement(559765..560346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_05990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66199"
FT                   /db_xref="GOA:E4NMP4"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP4"
FT                   /protein_id="ADQ66199.1"
FT                   /translation="MTEEAEPAQQNAPPEPATSADERGDSVRSFRTKRGRCLVDDTYLH
FT                   VEESFVGTYRNMYDYWSSGWVGRFVFLAAMFAPLYGLGTALWVTREDPLGTPALIFLSA
FT                   IGVFVIISAFRRIVQGYTSASRIPLADVRTVKSNRGTKGLTSPRLLVEYDADGATRKRV
FT                   LMLPSLYTSDGEERFEEAQRTLSAAGLDVK"
FT   gene            complement(560534..562081)
FT                   /locus_tag="Hbor_06000"
FT   CDS_pept        complement(560534..562081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06000"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66200"
FT                   /db_xref="GOA:E4NMP5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP5"
FT                   /protein_id="ADQ66200.1"
FT                   /translation="MVAIAPIFDAIGALGFVGAAALGYLNYRDSDAESPFWMTFTFASV
FT                   LGVAWTIALMLEKAGIYAEVFDLATGPLMASTVAVFAIGGTATLAIVEDMKVLVSDAEE
FT                   KSEELNALTETLEQQAESYSEKMEAASDGDLTVRVDPDSESDAMTRIGQAFNSMVADIE
FT                   SVTLQIQSFAQRVDEESTEVTTSANAVKQTSTDVASSVEEISAATETQHRNLDNASGEL
FT                   SNLSATIEEIASSADEVAAESQRTVEQAKESRKAANKGTEKMEQLESRASETVAEVEEL
FT                   QSSVEQIGEVVELIDDIADKTNILALNASIEAASAGDAGEGFAVVASEVKSLAEETAKA
FT                   TEEVESLIDGVETSTENVTDDIYETQNEIQRSRDTVGEAIEKLGDVVGRIEESNESIQS
FT                   ISDATDEQSKSTQGVVSMVDEVTDLSDQTATEAQNVSAAAEEQTAATQEIASASNELSE
FT                   QAQQLQAIVSGFEVSQTPMELNEGESDETDEPTQTDDTLSANQQAVPNNAAGMGQSD"
FT   gene            complement(562088..562357)
FT                   /locus_tag="Hbor_06010"
FT   CDS_pept        complement(562088..562357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66201"
FT                   /db_xref="GOA:E4NMP6"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP6"
FT                   /protein_id="ADQ66201.1"
FT                   /translation="MLGSLSPLEVTGLVVSLIGLVPVLTQYRDETKLFTAGYVLLVVGM
FT                   VATNLETFALEPVLNVVEHAIGIGAAGVVFLAAAYVRRESVVKG"
FT   gene            562565..564067
FT                   /locus_tag="Hbor_06020"
FT   CDS_pept        562565..564067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06020"
FT                   /product="archaeosine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /note="PFAM: Queuine tRNA-ribosyltransferase; TIGRFAM:
FT                   tRNA-guanine transglycosylases, various specificities;
FT                   tRNA-guanine transglycosylase, archaeosine-15-forming"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66202"
FT                   /db_xref="GOA:E4NMP7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004804"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP7"
FT                   /protein_id="ADQ66202.1"
FT                   /translation="MRDHFEIRDGDVAGRIGELTVPRAGVTVETPALLPVINPNIVTVS
FT                   PARLESEFGAQILITNSYIIHKNDDLHEEALDVGLHEMLDFDGAIMTDSGSFQLAEYGD
FT                   ITVTTREILQFQYDIGTDIGTPVDIPTPPDVPREQAERELAVTEEALQDAEDVDTGEML
FT                   VNAPVQGSTYPDLREEAGRAAYETDLDVFPIGAVVPLMNSYRYDDMVDVVAGAKRGLGR
FT                   DAPIHLFGAGHPMMFALAVAMGCDLFDSAAYALYARDGRYLTVRGTEHLEDLDYLPCSC
FT                   PICTSHSPDELRAADETEQERLLAEHNLHVSFEELHRVKQAIRSGNLLELVEERARSHP
FT                   AMLDGYRALLEHTDQLEREDPVSKGSFFYLSEESAFRPEVRRHHDRLARLDATGTVLLT
FT                   QGGTPKGDQFDATWRVVPPFGPFPRALSETYPLTAEVPDRTDRAAYEMAAEGVARLAAE
FT                   NPETAFVLAHDGWPESALERVPDDVTTESIHSVSPENGEETV"
FT   gene            564147..564422
FT                   /locus_tag="Hbor_06030"
FT   CDS_pept        564147..564422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06030"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66203"
FT                   /db_xref="GOA:E4NMP8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP8"
FT                   /protein_id="ADQ66203.1"
FT                   /translation="MEAVLWYVLTGTRGGANRARILRALDSRPRNANQLAEDLDLDYKT
FT                   VRHHLDVLMENSVVQSSGDDYGAVYLPTDRARANWDTIEEILDGMD"
FT   gene            564477..564782
FT                   /locus_tag="Hbor_06040"
FT   CDS_pept        564477..564782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66204"
FT                   /db_xref="GOA:E4NMP9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMP9"
FT                   /protein_id="ADQ66204.1"
FT                   /translation="MSIWFDVARVASALNVLLLLGLASVWARNYLEIRSKYPLGLLVFA
FT                   VLLLAENALALYIYLVDPTLRDWFTTDVPAIAWRAMMLLHVLETLGLLFLAWITFD"
FT   sig_peptide     564477..564557
FT                   /locus_tag="Hbor_06040"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564971..567004
FT                   /locus_tag="Hbor_06050"
FT   CDS_pept        564971..567004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66205"
FT                   /db_xref="GOA:E4NMQ0"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ0"
FT                   /protein_id="ADQ66205.1"
FT                   /translation="MQRALTVFVTLVVLVGTAPAGAAATPAAQQSSGASVSFAAQSSGG
FT                   STVVVENVTLPDGGFVTIHDASVADGNVLGSVVGSSAYLDAGTHENVTVHLDEPLSESG
FT                   AFVAMPHMDTDGDRVYDFVADNGETDGPYTADGSAVISQANVTVSATVSMSDQPTDGTS
FT                   VVVDRVELSDGGFVTVHDASVTEGEVFESIRGTSAYLEAGVHENVRITLDTPVEKNTTL
FT                   VPMAHMDTDGDQMYTFPESEGETDGPYTANGSAVVDTAAVTLSETANVTFSAQSSGGQS
FT                   VVVDSAYLPEGGFVTVHDATLNDGAVFESIRGTSAYLAPGLHKNVRVSLDAPLNNSTTL
FT                   VPMAHMDTDDNQEYTFPESEGEADGPYTADGGAVVAQANVTLSASVDMSMQASDGHSVV
FT                   VDRVELSEGGFVVVHDSSLFAGEVEGSILGTSDYLEPGVHENVTVTFAEPIRASQTLVP
FT                   MAHMDTNGNEAYDFPEADGPYTAGGNAVVDTARTSVNAVVTAADQTTDGQTVTIDSVTL
FT                   HDGGFVTVHDATVSEGAVFESVRGTSAYLSPGTHENVTVELSKPLTETTTIVPMAHMDT
FT                   NGNEAYDFVTSDGAEDGPYVALGGAVVATAEASVEDGEMTETEMNAETMTETEMADEET
FT                   EMETGTEMNEATDGTDTGTPGFGVVVAIIALVAAALIAVRRD"
FT   sig_peptide     564971..565036
FT                   /locus_tag="Hbor_06050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(567130..567633)
FT                   /locus_tag="Hbor_06060"
FT   CDS_pept        complement(567130..567633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66206"
FT                   /db_xref="GOA:E4NMQ1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ1"
FT                   /protein_id="ADQ66206.1"
FT                   /translation="MKRTDHWPADEAETFLRESTVPVRLACRTPSDDLWMLSLWYEWVG
FT                   GEDSSELCCATSADADVVRFLRANDDVAFEISTNDPPYRGVRGRGTASIEPDEEKTLLR
FT                   SLLERYLGGTENELGSFLLDDDREEVRIRITPTRLHSWDYSGRMRDVVADEANNESNGD
FT                   ANDN"
FT   gene            567838..569595
FT                   /locus_tag="Hbor_06070"
FT   CDS_pept        567838..569595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06070"
FT                   /product="tRNA-archaeosine synthase"
FT                   /note="PFAM: PUA domain; Queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylases, various
FT                   specificities; uncharacterized domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66207"
FT                   /db_xref="GOA:E4NMQ2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ2"
FT                   /protein_id="ADQ66207.1"
FT                   /translation="MTDYFEIHGRDGAARLGELRLADPVTTPALADEVVEDTGSLWAAE
FT                   RDVPEGADDVLTVLPHRSFPAGTDDKVQSSFAVDSPDVDYPSAAVVTAETATDAGSDAY
FT                   ILSNAQGFVGHASAFRDAIVAAKDALPADTALYLSGVATPRNVATLVYAGVDLVDAKLA
FT                   RVKGRQGMYLTSENEYFLEDLDELPCTCAACQTPREEFTHEDCAAHNVNALRAELATVR
FT                   QRIRDGRLRDYIEGQARHNQWLTAAFREFDQQYGYLEERTPLIRNSEIAAASSDSIRRV
FT                   EIQRFAERVTSRYKNRFDNPLVLVPCSATKPYSESQSHSQFHDAVQFRAHLASMTSPIG
FT                   VVPSELELTYPAQHYDTVVTGRWSEDEKQFVASVLTQYLERNDYPRVVAHVPEHGYRDI
FT                   CERVEQEVDVPFEYTVEDHPTTTDSIANLMSTLQGELKYSKRERQHNTVKAIADYQFGD
FT                   GAGDALFADVDVQMTSRYPKLQVRNGDGDQLAAMVPQYGVLSFTLAGARVWSDSDAPTK
FT                   RVEIDNFAPHGSVLAPGVVDADDDIRVGDEVIVEGPKAFAVGRAEMFGAEMTESTRGVA
FT                   VEVRHVEEK"
FT   gene            569681..570085
FT                   /locus_tag="Hbor_06080"
FT   CDS_pept        569681..570085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66208"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ3"
FT                   /protein_id="ADQ66208.1"
FT                   /translation="MTDDTSDRRISLGVPQQILDSLPEDGGNAAADLKRAVEGIETSLN
FT                   DAFERAESDSEAASYAVDAIEHLEDRMETYDAFVPELRAWGQSPIYAIAWRNLQADLIA
FT                   QIRAYDWLDTHIERERNYRLVEDGIRFDKR"
FT   gene            570144..570416
FT                   /locus_tag="Hbor_06090"
FT   CDS_pept        570144..570416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06090"
FT                   /product="MoaD family protein"
FT                   /note="PFAM: ThiS family; TIGRFAM: MoaD family protein,
FT                   archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66209"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ4"
FT                   /protein_id="ADQ66209.1"
FT                   /translation="MRFFANFREAVGTKTIERDYEVTTVGDALRELEAEYSGLAGELLE
FT                   DGHVRPQVNVLLNGRDVQHEQGIETELGDEDTLSIFPPVAGGMRD"
FT   gene            570409..570687
FT                   /locus_tag="Hbor_06100"
FT   CDS_pept        570409..570687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66210"
FT                   /db_xref="InterPro:IPR036473"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ5"
FT                   /protein_id="ADQ66210.1"
FT                   /translation="MIDDDEGTVTREKSFRGISMRLAGQYLENLGGERVAEDRVEGDGW
FT                   TASLSAQKVPIGPTIELTEVTVTFEGDPSILDDLIDRFSQKAMRAGG"
FT   gene            570693..571052
FT                   /locus_tag="Hbor_06110"
FT   CDS_pept        570693..571052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66211"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ6"
FT                   /protein_id="ADQ66211.1"
FT                   /translation="MTTTVPLDGDVLLLAGARASVTPNQLPDLVHRAQSYLVQRTAEYD
FT                   RRFECIYDDADRSVFLVPKDHWAELGSELELENREADALRRAHEQQLLRIGTKHGRRDE
FT                   FESAMEIREAVVVGR"
FT   gene            complement(571075..571371)
FT                   /locus_tag="Hbor_06120"
FT   CDS_pept        complement(571075..571371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66212"
FT                   /db_xref="GOA:E4NMQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ7"
FT                   /protein_id="ADQ66212.1"
FT                   /translation="MPAIETSDLTKRDDGTPAVTDLSLSVREGEVYGFLGPNGAGKSTT
FT                   IDMLMDYTRPTSGNATVLGIDAQTNASAIHARTGILPDRFGVYSSLTRREHVE"
FT   gene            complement(571507..571971)
FT                   /locus_tag="Hbor_06130"
FT   CDS_pept        complement(571507..571971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06130"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /note="PFAM: 6-O-methylguanine DNA methyltransferase, DNA
FT                   binding domain; TIGRFAM: O-6-methylguanine DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66213"
FT                   /db_xref="GOA:E4NMQ8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ8"
FT                   /protein_id="ADQ66213.1"
FT                   /translation="MQVTVFDIDVELDESITDSEPTSIRNQIAAYERGERSTFDVDIRF
FT                   PEGLTGAVMRCMRQIPYGETRTYGEIATELQTAPVAVGQACGRNPVPILVPCHRIVGTE
FT                   SLGGFSAGGEHGETLKHRLLALERADAVTDGVQATLDDITTARNQAQPEK"
FT   gene            complement(572350..572523)
FT                   /locus_tag="Hbor_06140"
FT   CDS_pept        complement(572350..572523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66214"
FT                   /db_xref="GOA:E4NMQ9"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMQ9"
FT                   /protein_id="ADQ66214.1"
FT                   /translation="MSSPFESPAIRYGIGFANAAILVFLAFFMLDEMMRWIVLGIAVIE
FT                   ILVVPQVLKQAT"
FT   gene            complement(572618..573670)
FT                   /locus_tag="Hbor_06150"
FT   CDS_pept        complement(572618..573670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06150"
FT                   /product="O-methyltransferase"
FT                   /note="PFAM: O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66215"
FT                   /db_xref="GOA:E4NMR0"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR0"
FT                   /protein_id="ADQ66215.1"
FT                   /translation="MPVNPSFLERLVLLRLNKGPAPMLDLFGASSFRSVTLALEIGLFE
FT                   TIADVDRPLTAEDLADRLDAHPDGIAVFCNFLVSEGYLEAVGDRYRLTGMTEKWLLAES
FT                   ETNMGPWLTYWNDLVFPFWEQELETAIREGEPSQSIYEWFDEDPARWETAQEGFRATAS
FT                   LLVDDVVDSMTVPAGQSRLLDVGGGHGLYAMELCRRHPKLSATVFDYPGAIDAMEDDIP
FT                   DELAGRLGTRTGDYWTDDLGEGYDMALLFNVVHAHSPAENTALFERVRDALAPGGRIVV
FT                   LDQWEGSGRTPVSRAGLRFVALTYHTTLGANVYEHDEVSSWLQAAGFTGIQRQSVGPIS
FT                   GMAIVEATKQ"
FT   gene            complement(574061..574717)
FT                   /locus_tag="Hbor_06160"
FT   CDS_pept        complement(574061..574717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06160"
FT                   /product="predicted DNA binding protein"
FT                   /note="PFAM: HTH DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66216"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR1"
FT                   /protein_id="ADQ66216.1"
FT                   /translation="MRYLTVLVKPNGENAFHPLGGELTDEPSIKRRAIHHIELLADDTV
FT                   LLFAEASGSQKRYREIMDDSPHVIDYLVSGDERWMAVSQFEPTEEVRRNLELQRESHLV
FT                   IDTPIYFTSNGSLKVTCLGTDATFKNLFENVDEADSITFEILEMGDFDPDQSSFSRMFT
FT                   PRQEEVLETAVDLGYYNEPRQATLEDIGEVVGIAPATVGEHLRKVEECVFSEIVC"
FT   gene            complement(574818..576143)
FT                   /locus_tag="Hbor_06170"
FT   CDS_pept        complement(574818..576143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06170"
FT                   /product="transposase, IS605 OrfB family, central region"
FT                   /note="PFAM: Putative transposase DNA-binding domain;
FT                   Probable transposase; TIGRFAM: transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66217"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR2"
FT                   /protein_id="ADQ66217.1"
FT                   /translation="MLEVHRTHRAKILNHSQVAEMLDRHGWSASKLWNVANYHSRNVWE
FT                   DTGEIPDHGDLKDELKTHPKYKGLHSQSSQRVLEELAEAFNSWYGKRKSDSRANPPGYR
FT                   KKNYYDQHGRRVHEEHPRSTVTWKQNGIKHDAKNNRVRLSKGANHKEHPRAWEYILVEY
FT                   ETRPGVTVENLQQVRAVYDQSKERWELHLVCKDEIEAPTAPGTETAGIDLGICNFAAVA
FT                   YSTEEADLYPGNRLKQDGYYFPKEIAKCDDSGGDRATRLHHKWSERRTHFFHSLAKHIV
FT                   EKCIERGVGRINVGKLAGVREDENGESKNWGKHGNLDLHGWAFDRFTKILTYKAKVEGI
FT                   DVVEVSERDTSKTCCVCGRKDDSQRVERGLYVCDECDAAFNADVNGAENIRLNINEAES
FT                   NSESPPGLDGNRSTGWLAQPGVYLHDLSSGFQPQEQVVDCKP"
FT   gene            576362..577126
FT                   /locus_tag="Hbor_06180"
FT   CDS_pept        576362..577126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06180"
FT                   /product="predicted hydrolase or acyltransferase of
FT                   alpha/beta superfamily"
FT                   /note="PFAM: Thioesterase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66218"
FT                   /db_xref="GOA:E4NMR3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR3"
FT                   /protein_id="ADQ66218.1"
FT                   /translation="MKTVTSADGTSIGYERHGEGPSLILLHGGSGTRQHWDALRPHLTD
FT                   DFTLSIPDRRGRGESGDGDKYDLSREVADLRALVEAVDGPTTVFGHSFGGLVALAAASE
FT                   ISLDRLVLYEPALLVGDHRGDDLASRMESRLNAGQRQDAMRLFLEEAGGIPDVEQLPWW
FT                   PEEAGLSLAETVVRENYEVEAYELPAEPDIDVPTLLLTGEYGPAHLRDAVFELDERLSD
FT                   SRVVEFDGVGHVATQSEPELVADAVRRFAYGD"
FT   gene            577328..578572
FT                   /locus_tag="Hbor_06190"
FT   CDS_pept        577328..578572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06190"
FT                   /product="Respiratory-chain NADH dehydrogenase 51 Kd
FT                   subunit"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase 51 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66219"
FT                   /db_xref="GOA:E4NMR4"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR4"
FT                   /protein_id="ADQ66219.1"
FT                   /translation="MSVNLQRLGQAEVPEIATTLRNAGISGAGGAGFPTYAKWERLDEV
FT                   PFLLVNHQESEPIYYIDKWLGKSHTADFASLFDALLEETFEVIVICAKETDRAQWMGEL
FT                   EAALDGTVYTAAQLPIDPADESGIVFAYTDDRYEYGMESVLLRLVADVVLQNELPMDHG
FT                   WIVQNTETMFNVLHALDEGEAVTQKYVHVDGNVPRHRFLSAPVGTPATTLLEAAGREST
FT                   ELDDGETLADGGPGWCFEVEVSPTEFGVSKRTNCVLALDEDMVADNTLGDGRVNVLNAY
FT                   DWSGDHETEPTTVEPDVVRIPLITNPDFGDVVAKSRPIVEAGAEVTEGEMIAVPAQDGI
FT                   SNSQHASIDGTVAAVTETHIEIRRESSEENAAGDLLAHDRMVYWTWCTECGAYIARPEW
FT                   EHLGAGTEYVCKDCR"
FT   gene            complement(578678..578848)
FT                   /locus_tag="Hbor_06200"
FT   CDS_pept        complement(578678..578848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66220"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR5"
FT                   /protein_id="ADQ66220.1"
FT                   /translation="MRTDTESHEKIAESTESKAPDLDDFTGYEDGASYVVCDKTNANAW
FT                   IRSDITHSLNN"
FT   gene            579078..580184
FT                   /locus_tag="Hbor_06210"
FT   CDS_pept        579078..580184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06210"
FT                   /product="sulfate permease-like transporter, MFS
FT                   superfamily"
FT                   /note="PFAM: Sulfate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66221"
FT                   /db_xref="GOA:E4NMR6"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR6"
FT                   /protein_id="ADQ66221.1"
FT                   /translation="MSLSAGVFGSESPKFSVGAFTGAIGDSVTVLPVVVAIAALTELSL
FT                   SHLLLGFAVFQVVWGVRYGLPVSVEPMKALAALVIAGSLTTDELVVAGLLAGVILFTAG
FT                   STRTLRRVSHYVGEPVVRGVQLAVALLLLETGIRLSLGSPAFATLAVGVAAIVSVAGYR
FT                   RASALVVLAVGFGVVIPQTGLPTPHVPNVTFVLPSLSALSSSALEGTAAQLAMTVGNAA
FT                   VATSLLLSDYYDADVSPDELATSMGVMNLLAVPLGAVPMCHGSGGVAGKYAFGARTAWS
FT                   NIVLGTLYALAAVFAVGIVAAFPLSMLGVVLALVAVELGRAGFDTDARWFAVGVGLLGV
FT                   VANVGVAFVVGVVCYILWNRRSDATTPV"
FT   gene            580280..581038
FT                   /locus_tag="Hbor_06220"
FT   CDS_pept        580280..581038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06220"
FT                   /product="predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /note="PFAM: AzlC protein; TIGRFAM: 4-azaleucine resistance
FT                   probable transporter AzlC"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66222"
FT                   /db_xref="GOA:E4NMR7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR7"
FT                   /protein_id="ADQ66222.1"
FT                   /translation="MSFIPPEVRRGVRDVSPILVGIIPFGLVAGVAAVNAGLSPLQAVG
FT                   LSVVVFAGASQLAIIDLLGQNAELVVVFVTAVVINLRMMMYSASIAPHFRRVRSRWKAV
FT                   SSYLLTDQAYALSIARYNEGAPAERPNSNERRNYYLAVAASLWIVWQVCTVLGILLGTG
FT                   VPDAWGLEFAVPLVFLALLVPSVSNRPRLVAAVVGGGVAVAGEVVVVGGSPGLPFNLGL
FT                   LLGALAGVLAGVAAAAIGDEAVETEEEVSH"
FT   gene            581038..581412
FT                   /locus_tag="Hbor_06230"
FT   CDS_pept        581038..581412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06230"
FT                   /product="predicted membrane protein"
FT                   /note="PFAM: Branched-chain amino acid transport protein
FT                   (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66223"
FT                   /db_xref="GOA:E4NMR8"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR8"
FT                   /protein_id="ADQ66223.1"
FT                   /translation="MPTEYGPLSIWGVVIAVGITTFAIRASFIYLFGRIDTVPPRLKHA
FT                   LRYVPPAVFAALVVPALVVSEGSAHFAPISVSLSDLSVAVGNERLLAGIVAAIVAWLAE
FT                   DVFATIAAGMVTLWVLRFVV"
FT   gene            complement(581480..583417)
FT                   /locus_tag="Hbor_06240"
FT   CDS_pept        complement(581480..583417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06240"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /note="PFAM: Aldehyde ferredoxin oxidoreductase, N-terminal
FT                   domain; Aldehyde ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66224"
FT                   /db_xref="GOA:E4NMR9"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMR9"
FT                   /protein_id="ADQ66224.1"
FT                   /translation="MTDQGGFNDHVARVDLSSGEVQYEGIDDEDARKYIGGRGLGVKYV
FT                   FDQGPDVDPMGPDNLLAFVNGPLTGTQAPMSGRIAVCTKSPLTGTVTDSHHGGWSGARL
FT                   KWSGFDGLLFEGKSEDPVYAYVEDGELELRDASHLWGKGVHETMETLESEIEGAFGKNL
FT                   SVMAVGPAGENEVRYACIINEDDRASGRGGTGCVMGSKGLKAVVVKSGTKMPKPAEPET
FT                   FTKGYQQAMELIRESDVTGPNEGGLSLYGTNVLMNLTEEMDGLPTRNARYTSTHSEAEG
FT                   SPDDPNIEAEKVSGENVRENILVDEPTCHSCPVACKKEVEVTYERKGEELNVRGESYEY
FT                   ESAFALGPNSMNDDRDSIAVMIDMCNDLGMDTIESGNMIAMAMEMTEQGKLDDVDEDIE
FT                   WGDVEHMMDVLEDIAHQESELGELLGNGAERVAEEKGAHDNKLSVKGQTIPAYDPRAMK
FT                   GMGIGYATSNRGACHLRGYTPSAEIMGIPEKVDPREWEGKGELCALFQDMHAISDSFDI
FT                   CKFNAFAEGIEEYVLQYNGMTGRDVTEDELMETGDRIYTLERYYNNLAGFDGSDDTLPG
FT                   RFLEGDEAIPGQGASDGQLCELDEMKEEYYARRQWVDGVVPDERLEELGIDIGPGTGVS
FT                   SGDSPAPADD"
FT   gene            583648..584724
FT                   /locus_tag="Hbor_06250"
FT   CDS_pept        583648..584724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06250"
FT                   /product="conserved hypothetical protein TIGR01210"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR01210"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66225"
FT                   /db_xref="GOA:E4NMS0"
FT                   /db_xref="InterPro:IPR005909"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS0"
FT                   /protein_id="ADQ66225.1"
FT                   /translation="MSQPSPEVYERGKGMDAHNQVMREIRSRKDRTYDPHEPTRVWLDE
FT                   DNTPDGVKQSLTIILNTGGCRWARAGGCTMCGYVAESVEGGSVAHEALMDQIQVCLDHE
FT                   AENADDPADLIKIYTSGSFLDEREVDAETRAAIAETFGDRERIVVESLPDFVEREKLED
FT                   FTSQGLETDVAIGLETATDRVRHDCVNKYFDFADFEDACAEAGAVDAGVKAYLLMKPPF
FT                   LSESEALEDMKSSIRRCAGVDHCHTISMNPTNVQRYTMVDELYFNGGYRPPWLWSVADV
FT                   LESTADVDAIVVSDPVGHGSDRGPHNCGECDDLVQKAIKDFDLRQDPSVFSQVSCECEG
FT                   AWEVVLEEETSYSMPLAR"
FT   gene            584938..585042
FT                   /locus_tag="Hbor_06260"
FT   CDS_pept        584938..585042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66226"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS1"
FT                   /protein_id="ADQ66226.1"
FT                   /translation="MYKTVYYADGWVEIRESDNADGWIATSSPCEVTQ"
FT   gene            complement(585124..585912)
FT                   /locus_tag="Hbor_06270"
FT   CDS_pept        complement(585124..585912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06270"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66227"
FT                   /db_xref="GOA:E4NMS2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS2"
FT                   /protein_id="ADQ66227.1"
FT                   /translation="MGDTLEYDEKEARQEAAIYRTQAAADRRELVRETLDLQRGDRVLS
FT                   IGCGPGFEPAELAGAVGESGYVHGIDRSEAMLTLANQRCDDLPQAALSKGNALDLPVAD
FT                   ESFDAAVAVQVFEYLDRVDAAVNELARVLRPGGRAVVCDADFDSLVWRSPNPARMERVL
FT                   DAFDDHCPWPHLGSRLAPLLRDAGLTIERVEPNTMLETRLNDESFAYHLMEFIKDYAAN
FT                   HDSIGSDEASAWVADLREHEENGATFFNFTQYLYRVRKSK"
FT   gene            complement(586010..586693)
FT                   /locus_tag="Hbor_06280"
FT   CDS_pept        complement(586010..586693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06280"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: Glutamine amidotransferase class-I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66228"
FT                   /db_xref="GOA:E4NMS3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS3"
FT                   /protein_id="ADQ66228.1"
FT                   /translation="MTVSVIQFGGSNCDRDAVRALEHLGIDAERVWHEDELPEDVTGIM
FT                   LPGGFSYGDYLRAGSMAAQSPILDDVREAAADGTPVLGVCNGAQVGCESSLTEGAFTTN
FT                   ESARFQCEHVYLRVENAETPWTAAYEEGDVIEIPIAHGEGRFEISEDRYEQLVEEDRIL
FT                   FRYCDADGNVTEEANPNGSRGNVAGIRGDDENVGVLMPHPERATLPDLNGSTDGSGVLR
FT                   GFETA"
FT   gene            complement(586694..586966)
FT                   /locus_tag="Hbor_06290"
FT   CDS_pept        complement(586694..586966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06290"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="PFAM: Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66229"
FT                   /db_xref="GOA:E4NMS4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS4"
FT                   /protein_id="ADQ66229.1"
FT                   /translation="MTTHYEAMTTYTATVTVRLKQGVLDPEAETTKRALERLGFELESL
FT                   RSADRFEVEMDAESVAAAEDRADEMAERLLANPTIHDYDVEVTEA"
FT   gene            587166..588257
FT                   /locus_tag="Hbor_06300"
FT   CDS_pept        587166..588257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06300"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="PFAM: ACT domain; Formyl transferase; TIGRFAM:
FT                   formyltetrahydrofolate deformylase;
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66230"
FT                   /db_xref="GOA:E4NMS5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS5"
FT                   /protein_id="ADQ66230.1"
FT                   /translation="MTDLTEITVIGGDKTGLIANVTTLLFERGINVEDLDQAVRDGIFR
FT                   MTLHADTSEMVCTEETLRDALHDLGDDLGVDVQVRFPSDRDTQQIAVLATKESHCLEAL
FT                   FEAWANGDLDADISVVIGNRDHLRPLAERYDVPFYNVGDEKGSPDEDELLDLLDEYDAD
FT                   LVVLARYMRILSPNVVFRYEDRIINIHPSLLPAFPGAAAYRQAKEEGVRIAGVTAHYVT
FT                   TDLDQGPIITQRAFDVPDDASLEEIKSLGQPLEADALLEAVQLHLDDAVSVHRGRTSLR
FT                   PGADDADYQLGMTDEATAANPDRPIDGLADALQADVGVADGGTVDDGASTDEEEQREAE
FT                   AADSDTPESNEDEAEAAPNPSDD"
FT   gene            complement(588300..589331)
FT                   /locus_tag="Hbor_06310"
FT   CDS_pept        complement(588300..589331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06310"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /note="PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66231"
FT                   /db_xref="GOA:E4NMS6"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS6"
FT                   /protein_id="ADQ66231.1"
FT                   /translation="MTSVKEFRVETDPTADELGRGRFVFTNQYSVFDWGEMPDHVPKKG
FT                   ASLCTMGAFNFELLEVNDIPTHYVGVIEDGETTDLKECESPPTEMVIELTQVPDLPYVG
FT                   GSGADAYDYDAYHEAADENYLIPLEIVFRNTVPVGSSLRTRGEPADYGLDADAWPDEAV
FT                   SLPEPVVEFSTKYEEQDRYLDREEAESIAGRAELDRLEELALSVNHILNERAERAGFTH
FT                   EDGKIECLYHDGTIKVADVVGTFDENRFSYDGQEVSKEVVRQYYKRTDPEWVEAVSEAK
FT                   DRSREEGVADWRTLCEKSPDNLPASVLTAVSEMYAAGTNGYTDSEWFDAPTIEDAVERV
FT                   RGL"
FT   gene            589496..590308
FT                   /locus_tag="Hbor_06320"
FT   CDS_pept        589496..590308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06320"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /note="PFAM: Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66232"
FT                   /db_xref="GOA:E4NMS7"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS7"
FT                   /protein_id="ADQ66232.1"
FT                   /translation="MDEQMAALADEISAADGVTVLTGAGVSNASGVPTFRGEEGIWNNE
FT                   FDPADFRMDRFERDPAGFWTDRLELHERMFGDVTGPNDAHRALARLEDLGVVDVVVTQN
FT                   TDGLHAEAGTNRLIELHGNNARSVCVECGESVPTETALDDVRAGNSPPSCPVVGCTGHL
FT                   KPDVVLFGERLPGGAYDSARRMAWESDVFIVVGSSLTVVPASTLPEEAAERGQLAIFDT
FT                   GETEKDHLAHYLVRGDATETLPALVEAVQARLGREADTRGVENVTQEG"
FT   gene            complement(590327..590821)
FT                   /locus_tag="Hbor_06330"
FT   CDS_pept        complement(590327..590821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06330"
FT                   /product="acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66233"
FT                   /db_xref="GOA:E4NMS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS8"
FT                   /protein_id="ADQ66233.1"
FT                   /translation="MDVAIRAAAPTDVASIRDVAKRAWKAAHEPIVGTDAMESFLSEYY
FT                   DAESFQARIDCDETILDVAVEGGTVVGYILASPNADDETTFDLSSIYVTRMRWGEGIGQ
FT                   QLLDHVERRVREHGGERIQLGVMAENDRAVRFYEAADYRQDGEFHDEHLGVPGYTYVKT
FT                   V"
FT   gene            590984..592696
FT                   /locus_tag="Hbor_06340"
FT   CDS_pept        590984..592696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06340"
FT                   /product="PAS domain S-box"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66234"
FT                   /db_xref="GOA:E4NMS9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMS9"
FT                   /protein_id="ADQ66234.1"
FT                   /translation="MVVVTDVYPALLLVAAAISVTLCVMTWRRSVTGSVAFSLNMLAVT
FT                   LWLVGHTAEVMATSEALIRYWANVQWVAAIVVAPTWFLFVMAYLGKDQWLDPKRLAVLA
FT                   VEPVVMLLLLATNNQFHLLWNEPHIDTVTLGWLFGETVTLAAAEPAVGTLAHVAFSYTL
FT                   LFVGSLYLVRLALASASVYRWQSAAVLLGVSVPWVASAAALSDATSIDLTPVAFSVTGV
FT                   ALSFGLIRYRLLDLVPVARDAVVENLNDSVIVFDRHGRIVDVNDAALAFTDLDEPDVIG
FT                   ASAAEVFTEYTDLIERYRGVADMREEIAIEHEGVERHYEVDLTPITGRDGSRVGTLTVC
FT                   RDITERRRRERELERKNNQLERFASVVSHDLRNPLQVATGNVELARETGSDDRLDRVED
FT                   ALDRMDQIIDDMLELTRVDGDSIETSAVNIDSVSNAAWRNVATGDAALTVEAEAVVEAD
FT                   RDRLVQLLENLFRNAVEHGSSGETSEPAVEADGGGSLRVWVGTTENGFFVADNGPGIPV
FT                   TERDTVFEAGHTTGSDGTGLGLSIVSQIANVHGWDVSVDESRAGGARFELTER"
FT   gene            592750..594138
FT                   /locus_tag="Hbor_06350"
FT   CDS_pept        592750..594138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06350"
FT                   /product="FO synthase subunit 2"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM superfamily; TIGRFAM: radical SAM
FT                   domain protein, CofH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66235"
FT                   /db_xref="GOA:E4NMT0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMT0"
FT                   /protein_id="ADQ66235.1"
FT                   /translation="MSDRSATGLDRSFEHVPDTDQSFENALAKARAGDRLTVADGVELM
FT                   TTGTDCDGIDPVRKEQVLEAADRRRAEMVGDDVTFVANLNNNVTTACNTGCLFCNFKNT
FT                   AHQFESEYEGDHTGFTKTPAESRAVVEDALDTGIYEVTSVSGLHPAFVLNEDHREILES
FT                   YENPYAEVDYKPPEAYDKDPGTYVEQMRAMSVGGVHLHSMTPEEAYHARRGTDWSYEEV
FT                   YRELKDAGLDSAPGTAAEILVPEVREVICPGKISTAEWVEGMEGAIAAGLDVTATIMYG
FT                   HVENAAHRVMHLKVIRDLQDRTDGITEFVPLSFVYQNTPLYERGLVTEGAADAEDELMI
FT                   AVSRLFLDNIDNIQSSWVKFGNAKSLKLLNCGANDFMGTILSEEITKRAGGGYGEYRSF
FT                   DDYVEMISAIGRPAVERSTDYRQRRRIAPDDAPHGPMLGPRADGTPMLAGCESDGGEPA
FT                   PADD"
FT   gene            594220..594768
FT                   /locus_tag="Hbor_06360"
FT   CDS_pept        594220..594768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66236"
FT                   /db_xref="GOA:E4NMT1"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMT1"
FT                   /protein_id="ADQ66236.1"
FT                   /translation="MMVTTHAAAALLFFATPVALFAPEFTAAAIIGALLGGIVPDVDLF
FT                   VGTHRKSLHFPVYASLAGVGAGIVALVAPSTASVAAAAFLLGAGLHAASDWFGGSDELR
FT                   PWERTSRRAVYLHPRRRWLRPRHIIRYDGAPEDFFLTVVLAIPVAYAVPSVRLVVAAGL
FT                   VVGAVYTLFRRRVPDVFGV"
FT   sig_peptide     594220..594303
FT                   /locus_tag="Hbor_06360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            594869..595480
FT                   /locus_tag="Hbor_06370"
FT   CDS_pept        594869..595480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66237"
FT                   /db_xref="GOA:E4NMT2"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMT2"
FT                   /protein_id="ADQ66237.1"
FT                   /translation="MMAPTHVAAGIALAVPIAFLVPELAPLVVAAAVAGSVFPDFDMVA
FT                   GEHRRTLHAVEAYAVLTALVTFAAIVAPSPPVIAAAVFFAAAAVHPLLDLAGGSSEARP
FT                   WEAATDRGVYLRSRESWVAPKRWVRYDGAPEDLALAAVLVTPGFVVFGTSVRIFAVGTL
FT                   IVGLGYTFYRKRIPQLSGRVNLPVPPVLTVVAALFSLFRR"
FT   gene            complement(595485..596069)
FT                   /locus_tag="Hbor_06380"
FT   CDS_pept        complement(595485..596069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06380"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66238"
FT                   /db_xref="GOA:E4NMT3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4NMT3"
FT                   /protein_id="ADQ66238.1"
FT                   /translation="MFQNTRQPDWDWWEALWPEPKAVLKTVGIDSGQSVADVGSGNGYF
FT                   TLPLAELVDGEPVYAIDINDELLGELAEAAAERQCQNIDCIHGDARNLPELLPEPVDTV
FT                   LVANTFHGVEKQVEFARQARELLRPDGQFVVVNWHDMPKSETTVANEPRGPPESLRMAA
FT                   EETRDVLRKVFGSVEQRDVPPYHYAVIGTRS"
FT   gene            complement(596117..597274)
FT                   /locus_tag="Hbor_06390"
FT   CDS_pept        complement(596117..597274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06390"
FT                   /product="FO synthase subunit 1"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM superfamily; TIGRFAM:
FT                   7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66239"
FT                   /db_xref="GOA:E4NN09"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN09"
FT                   /protein_id="ADQ66239.1"
FT                   /translation="MFPAADEYDVRITPDDDAVERLLAVTPDDVSPASELTFSRNVFLP
FT                   LTTACRYTCTYCTYYDVPGEATLMSPEDVRETLRVGADAGCTEALFTFGDEPDDRYTAI
FT                   HEQLSEWGYDDILAYLRDCCEMAMEEGLLAHSNPGDLTESAFERLAPVNASMGVMLETT
FT                   ADVRAHSGGRRKTPGQRLNTIRAAGKVGVPFTTGLLIGIGETWRDRAESLLAIRELHER
FT                   YDHIQEVIIQNVVPNERSSFDQPSVETMRRAVAMARVALPDEVSVQVPPNLSPTRELLD
FT                   CGVDDLGGVSPVTDDYVNPDYKWPALQELRDIADKGDVPLYERLPVYERYLPERYRRDD
FT                   FDGVETDREWLSDRVRAAIDADNVHGKRYRGVARRDGPLTVGSAD"
FT   gene            complement(597754..598377)
FT                   /locus_tag="Hbor_06400"
FT   CDS_pept        complement(597754..598377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06400"
FT                   /product="phospholactate guanylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="PFAM: Guanylyl transferase CofC like; TIGRFAM:
FT                   2-phospho-L-lactate guanylyltransferase CofC"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66240"
FT                   /db_xref="GOA:E4NN10"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN10"
FT                   /protein_id="ADQ66240.1"
FT                   /translation="MQVVIPYTTRDPKSRLAGVLDEDERRAFARAMRTDVVRAVRAAGG
FT                   APTILTTDADDIDDVDAPVIGDDRALTPAVNAVLDDATSDVSVVMADLALVTPDALRRL
FT                   FESEGEVVIAPGRGGGTNALVVRHPDFRVDYHGASYRDHQAIADDAGLSVTVIDSMRLA
FT                   TDVDEPADLAEVLLHGAGNARTWLEDAGFELEVTDGRVGVTRSD"
FT   gene            complement(598402..599187)
FT                   /locus_tag="Hbor_06410"
FT   CDS_pept        complement(598402..599187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66241"
FT                   /db_xref="GOA:E4NN11"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN11"
FT                   /protein_id="ADQ66241.1"
FT                   /translation="MTKTSWSRFSKLALACLVVLTALAAPVAAVSVGEEDVPSDAQVES
FT                   KVTTSVTLNELYKNPQLESWTLAGSTELTDVTWTVTYYDQTGAKINQESFDGQNFSGAT
FT                   VAADDGTSKVEIRVAGTAPSVDSYKYDPAQTFDVIHLQQTREGGSSNDIETWTTHHYTE
FT                   ESQSARDALDESKAAVEGVNSDEAQASFDNAVSAFENGNFELATELANEAQTKAQQAEQ
FT                   SSQTQQMLIYAAGGLLAIAVVVGGVFYWRSQQSGYDKLG"
FT   sig_peptide     complement(599101..599187)
FT                   /locus_tag="Hbor_06410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(599156..600337)
FT                   /locus_tag="Hbor_06420"
FT   CDS_pept        complement(599156..600337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06420"
FT                   /product="cell division GTPase"
FT                   /note="PFAM: Tubulin/FtsZ family, GTPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66242"
FT                   /db_xref="GOA:E4NN12"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN12"
FT                   /protein_id="ADQ66242.1"
FT                   /translation="MKLAMIGFGQAGGKIVDKFVEYDQRHGSGIVRAAVAVNSAKADLM
FT                   GLEHIPQDQRVLIGQSRVKGHGVGADNELGAEIAEEDIDEVQGAIDSIPVHEVDAFLVV
FT                   SGLGGGTGSGGAPVLAKHLKRIYTEPVYGLGVLPGGDEGGIYTLNAARSFQTFVREVDN
FT                   LMVFDNDAWRKTGESVQGGYDEINEEIVTRFGVLFGAGEVEQGGEVAESVVDSSEIINT
FT                   LAGGGVSTVGYASETVEEKSSSGGLLSRITGGDEDDQIDTAHTTNRITSLVRKAALGRL
FT                   TLPCEIEGTERALLVLAGPPEHLNRKGIERGRKWIEEQTGSMEVRGGDYPIRNSGKVAS
FT                   VILLSGVTNVPRIKELQQVAIEAQENIDEIQQESEQNLENLVNDDEDELESLF"
FT   gene            complement(600564..601466)
FT                   /locus_tag="Hbor_06430"
FT   CDS_pept        complement(600564..601466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06430"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66243"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN13"
FT                   /protein_id="ADQ66243.1"
FT                   /translation="MKVLVVGGSGFVGTNLCRELKERGHEVTALSRSPSSDELPKGVNK
FT                   TMGNVTVYDSIKDAFEGMDAVYNLVALSPLFKPSGGNEMHDKVHRHGTENVVRAAEKHE
FT                   VDRFVQMSALGADPDGPTAYIRAKGEAEQIVTESVLDWTIFRPSVIFGDGGEFVSFTKL
FT                   LAPPYVSALPGGGKTRFQPLYVDDVVGMMADAIEDDAHIGERYEIGGPDKLTLAEIAKM
FT                   IHKSNGRSTTIVPIPMGLAKVGLTIGGAIPGVPMGTDQYRSLKFDNVTDDNDIEAFGYG
FT                   TGELTTLRAYLNNSHIRDK"
FT   gene            601626..602225
FT                   /locus_tag="Hbor_06440"
FT   CDS_pept        601626..602225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06440"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: Thymidylate kinase; TIGRFAM: thymidylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66244"
FT                   /db_xref="GOA:E4NN14"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN14"
FT                   /protein_id="ADQ66244.1"
FT                   /translation="MLITLEGLDGSGKTTAWEALHDVYPDAVFTREPTESWYGDAVYRS
FT                   MSDEDADSLAELFLFTADHADHLSRVVRPALADDKLVISDRYSDSRFAYQAATLEDADL
FT                   RRPLDYIRGIHAAFSRPPDATIFLDVDPETAAARAGATNKFERASYLREVKANYERLID
FT                   AEPERFVRIDATQPPEDVVEMVERSVERLLSEHERR"
FT   gene            complement(602222..602542)
FT                   /locus_tag="Hbor_06450"
FT   CDS_pept        complement(602222..602542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66245"
FT                   /db_xref="GOA:E4NN15"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN15"
FT                   /protein_id="ADQ66245.1"
FT                   /translation="MASVLNLVLFGVVLVVHTLIAAVMTRFFRIRLKTQWGYVIYSLLL
FT                   IPVVLFVTTLVFSGILQIGPDLGDTTTAFGVMIGMPLALGFTIDTLYVPPPEEYELPET
FT                   QN"
FT   sig_peptide     complement(602480..602542)
FT                   /locus_tag="Hbor_06450"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            602640..603713
FT                   /locus_tag="Hbor_06460"
FT   CDS_pept        602640..603713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06460"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component alpha subunit"
FT                   /note="PFAM: Dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66246"
FT                   /db_xref="GOA:E4NN16"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN16"
FT                   /protein_id="ADQ66246.1"
FT                   /translation="MMDPIEKADMHRLIGERSLDDSWLDEEDARAVFRDMIRTRRFDER
FT                   ALALQRRGWMSGYPPFLGQEASQVGAAHAMREDDMLFPTYRSNALQIARGVPMSDILAF
FT                   RRGRAEYLSDHDIPVFPQAVPIATQIPLATGAGMAANYSDDDHAILVCFGDGATSEGDF
FT                   HEGLNFAGVFDAPVVFFCENNAWAISLPRDRQTASDSIAVKAEAYGFEGVQVDGNDPLA
FT                   VRETVSEALSDARDGNPILVESLTYRQGAHTTADDPSAYRDGDPDLPEWRVRDPVERYE
FT                   EYLREEGIIDDAFVESVREDVEDELKEAVERVEELPDADTDDVFEHAYETLPPELVEQR
FT                   EEMRDFLTRHDPNEVEY"
FT   gene            complement(603738..604145)
FT                   /locus_tag="Hbor_06470"
FT   CDS_pept        complement(603738..604145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66247"
FT                   /db_xref="GOA:E4NN17"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN17"
FT                   /protein_id="ADQ66247.1"
FT                   /translation="MPSVSQPLRPSLKAESWTGLLGAVAFFIFGNLPAELPLMTARTLV
FT                   AASLVPVPFGAYFALGKSSRRATEALTHRGVRFTFSLSFSLSLLWLTLAGSPGVRLGVV
FT                   SFLLGLAAGDWYLYSVADIEYGGDEGSVFPS"
FT   gene            complement(604192..604425)
FT                   /locus_tag="Hbor_06480"
FT   CDS_pept        complement(604192..604425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06480"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66248"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN18"
FT                   /protein_id="ADQ66248.1"
FT                   /translation="MVHAFVMVKTGAGESERLLAPIRELETVTEAHIVAGAYDVIAEVD
FT                   AEEVYNVLQTASSKIQGLEGVTDTKTYISMDD"
FT   gene            604511..605194
FT                   /locus_tag="Hbor_06490"
FT   CDS_pept        604511..605194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06490"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /note="PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66249"
FT                   /db_xref="GOA:E4NN19"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN19"
FT                   /protein_id="ADQ66249.1"
FT                   /translation="MRFVIIGGGRVGLRTARVLRDEEHEVTIVELDTDRIERAREAGFE
FT                   VIDGDGSREETLERAGVADADAIGALTGDLNVNFAACSIGKHHGLRTVLRVDEDYRDEV
FT                   YKKYAEEVDEVVYPERLGAIGAKNALLGGSIRAIADIAQNLQVVLMTVTDESPMRGYSI
FT                   EEVALPGQARILAFGKAGEQMGIPMRDDSLETGDRLAVLADFDVLGNVRQLIVGDEVTA
FT                   TAGGV"
FT   gene            605196..605426
FT                   /locus_tag="Hbor_06500"
FT   CDS_pept        605196..605426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06500"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66250"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN20"
FT                   /protein_id="ADQ66250.1"
FT                   /translation="MVTAYVMVKASTGDVDRLKESMLNLDDGVKSVSIVAGDVDFIVKA
FT                   DVESPAEVKTIAASIHEMSGIERTQTYIAMD"
FT   gene            complement(605434..605934)
FT                   /locus_tag="Hbor_06510"
FT   CDS_pept        complement(605434..605934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66251"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN21"
FT                   /protein_id="ADQ66251.1"
FT                   /translation="MSDVPERARRAFRDHDSFEQRDDSTFEWTTTVFDGRVTAAEDDGE
FT                   ITFEVTVRVPMLNAAVEDDVAPVVEDGWYETFELRVEDIGSVTKAEHDFDVEVSRDENA
FT                   VVVSTSFADINERRGVEDAGAIIDYVEGTYVQGVIPGYEYTKPVSTLLQRATDTANSEG
FT                   PPL"
FT   gene            complement(606326..608848)
FT                   /locus_tag="Hbor_06520"
FT   CDS_pept        complement(606326..608848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06520"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66252"
FT                   /db_xref="GOA:E4NN22"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN22"
FT                   /protein_id="ADQ66252.1"
FT                   /translation="MKRLGVFPTFFRKSYFRKYVLVLAVLLASMVGVGLYTEEQVSGEL
FT                   ASEKHDELRTIAELEAENLNEWVDTNEQRARMLSEHRGLQSDDPDSVDQSLLREHGQLP
FT                   SDVYAIHYVDLETGDVVRSTAGEMETKSLDDVDITWQSGELDFSQSTDVAVSEVYRNGG
FT                   LQLVAFASPVPGTDRAVLLITDATQHAKAFREPVERSHTQVVREDGTVLFDRYGKNVLT
FT                   AYRDGDDTPGLDAAVAATDDKSGVVERAADEQVVAYAPVKGTDWYVLVQAPRENVFTLL
FT                   TQVQNHLTVLIGTAVAGFILMGLTLGRSTVVSLRRLRKRAERLADGDMDVDLSSRRVDE
FT                   FGTLYNSFAEMRDTLQRRIEESEETAATLERAADEYGETMDQAAAGDLTARMDPDAAGD
FT                   AEAMAEIGRRFNRMMDEWEETVAEVGAFAERAAAASERVGVGTDEVSNASQQVSRSTQE
FT                   ITSGAADQLDTLQAVSDQTADLSATVEEIAAQADELSTLSKRAAERGDEGREAAMAVGQ
FT                   EMAEIADQAETVTARVSRLDEEVSDIASVVDLIDDIAEQTNILALNASIEASRAGEAGE
FT                   GFAVVANEVKQLAEETAAATDDIGDSIESVRRATTEAVEEMDEMQSSVESGAETIDGGV
FT                   DAIREAVDIVEDVDHGVHSIDEATDSQATATQQAAERIDDAASIAAQTHSESEQVAAAA
FT                   QQQTASLETVADEVDELAEQTQVLAERVETFTVSDDVLSADGDHGSETDAVDTSAAETT
FT                   PETDDSERQTDENGGSETDEAESETNAIDEETGGTTPETDPRDEATDDSESKTEAVDEA
FT                   DRADESADSEAANATTDGGNQEGDEHHD"
FT   sig_peptide     complement(608738..608848)
FT                   /locus_tag="Hbor_06520"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(608936..609121)
FT                   /locus_tag="Hbor_06530"
FT   CDS_pept        complement(608936..609121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66253"
FT                   /db_xref="GOA:E4NN23"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN23"
FT                   /protein_id="ADQ66253.1"
FT                   /translation="MPVMPTDEPTRFDYLLGVMGVSLLSAALLGAISAVPLHLAAGVGS
FT                   LIAAGVLVGGTLGEFS"
FT   gene            609201..610070
FT                   /locus_tag="Hbor_06540"
FT   CDS_pept        609201..610070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66254"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN24"
FT                   /protein_id="ADQ66254.1"
FT                   /translation="MPKHLIGFEQMPSRRDVLGFGSVTLALLAGCTSGSPFGGDTQQSP
FT                   SGTEPAETTTPTSAPHVQVGSVSVAPSLVSMNSPDSIGTYGDRDKQFVIARIEMDEQTK
FT                   RDREAVSVATDGETYDSTPVRDVVRHRSLWGVDSSADQSIDDFVLFRVPKPLDAESATI
FT                   QWSNGEHRLNDEQVSRLNRPPTTFEVREFSAPDTVTSGTESTLTLTVENVGSADGTFVA
FT                   GLNRSGPQTAYMPTTAISIEVDAGATATWTHSYTPPVVSRDGDISFQFVMNWRDGDERA
FT                   SVGLEPNE"
FT   sig_peptide     609201..609314
FT                   /locus_tag="Hbor_06540"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(610226..610310)
FT                   /locus_tag="Hbor_06550"
FT   tRNA            complement(610226..610310)
FT                   /locus_tag="Hbor_06550"
FT                   /product="tRNA-Leu"
FT   gene            610454..612085
FT                   /locus_tag="Hbor_06560"
FT   CDS_pept        610454..612085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06560"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66255"
FT                   /db_xref="GOA:E4NN25"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN25"
FT                   /protein_id="ADQ66255.1"
FT                   /translation="MTAEKRSPSRRRVLQAIGATGVAGLAGCTASSGGDGTDAVDEGDA
FT                   AASNSSGKTFYFAQAKSPLNFDPLKANDIPSLQVVERLFDSLYTYEQGTTLTPQLANGD
FT                   PEVSKSGQRYVVSLKDGITFHNGDPITAEDVKYSYLAPAREETENGSEFTMIDTISIVD
FT                   DKTVQFDLKYPFGPFKHSLAWSPVPKSVREADKKAFNTSNPVGSGPFEFDEWQQGSFVR
FT                   MQRHDDYWGENGSNIETLVFTPVKEPTTRITTLRNGENHAVQTVPPKLYSTVEGIEEAS
FT                   VTEQTGLGYFYLAFNCNEGPTTDKKVREAIDYAISLDEAVNRYVEPAGTRMTSPLPQTL
FT                   IDSWGFPGEKWDQIPHEKDQEMARQLLDEAGVSKDYDWTIIVPPDKKREQIGISVSNAL
FT                   KSLGFSNASVQRLDWGAFLDKYATGKESDYNMYALGWLDEVDPDGYLYYLFHESEEAST
FT                   NGCYYRNDEVMSQLDAARRSPDREERKRLYTEAITTLLEDRAHLPVYNLKNSFGVRTEV
FT                   EGFRPHTVSGINPRMTGPLGSVTLNN"
FT   sig_peptide     610454..610552
FT                   /locus_tag="Hbor_06560"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(612092..612445)
FT                   /locus_tag="Hbor_06570"
FT   CDS_pept        complement(612092..612445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66256"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN26"
FT                   /protein_id="ADQ66256.1"
FT                   /translation="MSESEESDGPLRPSEVGDEANAPPVDEKPYKIIFEANKCFGAGKC
FT                   AEVADNWEMDIASGLARPKSYYFDEDELEENVRAAEVCPAKKDRGVIHVIDRRADEEIS
FT                   PDPNGDGTLSVDW"
FT   gene            complement(612541..613053)
FT                   /locus_tag="Hbor_06580"
FT   CDS_pept        complement(612541..613053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06580"
FT                   /product="peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66257"
FT                   /db_xref="GOA:E4NN27"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN27"
FT                   /protein_id="ADQ66257.1"
FT                   /translation="MSNPTATLHTTRGDITVELFEERAPRTVENFIDLATGEKEWEDPE
FT                   TGETRTDSLYEGTIFHRIIDDFMIQGGDPEGTGRGGPGYTFDDEFHDELRHDSAGKLSM
FT                   ANRGPDTNGSQFFITLGAQPHLDDRHAVFGEVVEGMDVVEEIGSLPTDRNDKPMKDVEI
FT                   ESIDIDR"
FT   gene            613208..614182
FT                   /locus_tag="Hbor_06590"
FT   CDS_pept        613208..614182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06590"
FT                   /product="predicted deacylase"
FT                   /note="PFAM: Succinylglutamate desuccinylase /
FT                   Aspartoacylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66258"
FT                   /db_xref="GOA:E4NN28"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN28"
FT                   /protein_id="ADQ66258.1"
FT                   /translation="MHTAKTLTLARLPSGMPVETTVHTYGDGTGPTVYVQAAQHGREIN
FT                   GTEVIRRIHERLDSDDLSGTLVTVPVADPLTFDRVSYTTPESLDAVHSNMNRVWPGDEE
FT                   GSLHERMAAALWEYAGEADYIVDLHTGSPEMLTHTVYLDGDDDCRRLAEAFGTELLLAE
FT                   AAGDDADTEWSERNFGGKLRVAATRAGIPSITPELAHNKQLVEPAIETGVRGVFNVLRE
FT                   VEMLSGDPEIPAEQTTARNHLGRVSAAESGLFHPGPDAELGRQVEEGDHLGRVYHPTTY
FT                   EVLQEATADRAGVIYSVCREATVTAGQTLVGVAMPADDEEPDH"
FT   gene            complement(614195..615466)
FT                   /locus_tag="Hbor_06600"
FT   CDS_pept        complement(614195..615466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06600"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66259"
FT                   /db_xref="GOA:E4NN29"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033845"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN29"
FT                   /protein_id="ADQ66259.1"
FT                   /translation="MTKFADETLTEIRRDLHRHPEEGWKEFRTTALVAEELDERGFDLA
FT                   LGSDAVTVEERLGVPAADEIAAARERAKREGAPEEYLDRIGDVTGLVAEKRYGDGPTIG
FT                   VRVDMDALARSEASDDDHRPAREGFASTHPNEMHACGHDGHTAVGIGIARAFDAEGFDG
FT                   TLKLFFQPAEEGGRGGKPMSETTHVDDVDALLALHLGLDEETGTVVGGYDRPLSNAKLD
FT                   VTFEGEPAHAGGAPNEGRNALQAMTTAIQNLYAIPRHADGKTRINVGQVHADNAQNVIC
FT                   EEAQMRVEVRGEDADLNDYMMQKAERVVEHAAGMHDVAYETSLYGMTTTFENDGFVVET
FT                   VMDAAETVEGVTQICGRSPFGGSEDASFLIRRVQENGGVASYIGIGASNPAGHHTAYFD
FT                   IDEAALDIAVGVVEEAVRRLAVRL"
FT   gene            complement(615530..616603)
FT                   /locus_tag="Hbor_06610"
FT   CDS_pept        complement(615530..616603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06610"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="PFAM: Glycosyl transferase family, a/b domain;
FT                   Glycosyl transferase family, helical bundle domain;
FT                   TIGRFAM: anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66260"
FT                   /db_xref="GOA:E4NN30"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN30"
FT                   /protein_id="ADQ66260.1"
FT                   /translation="MAQAPESPEFGEWPLKRLMTEVVGTGVKSAEDMTREQATEAMQRI
FT                   LAGEPDHTTLGAFWLANRWKHNNAEELAAYTDVMCEHVEYAEPDADPVDCGANYDGKGK
FT                   TAILGAAAGIVAAGAGTPVVAHSGDRVPTQKQDAYKHVLDELGIRTELSPEESADQVDE
FT                   TGFGFYYQPAFNPVIHDLWERRDQMGVRTFVNTIETIANPAKADVHLGSFYHLAFAKKV
FT                   VDTFEQSEQLSPRRVVMFQGMEGYDDIRPGYTKVGESTDGEFTDFEIETAEYGMDFETE
FT                   DLEVDPDDVADDSAEITESVITGDRDDHFADAIELNAAFRIYAREDAETLEEGLEMARE
FT                   SIESGAAEAVLEDLREF"
FT   gene            616750..617793
FT                   /locus_tag="Hbor_06620"
FT   CDS_pept        616750..617793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06620"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06620"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66261"
FT                   /db_xref="GOA:E4NN31"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN31"
FT                   /protein_id="ADQ66261.1"
FT                   /translation="MSALADDWRADLDEVDATLIDEYQSGFPVVERPFDVLGEVLGVSE
FT                   DEALARVRSLREKGIFRRFGAVLNPPVIGSSTLAAVSAPEDRFEEVAEVINGYRQVNHN
FT                   YRRDHEWNMWFVVTAASRKKRDEILAEIEEQTGLTVLNLPMLTDYYIDLEFPVMNDDRF
FT                   ARESLSETAVNATRISEEATGNLSSLDAAVLVEIQDGFPLSATPYRDVADAVDADVDDV
FT                   LAAIQRLLDDGCIKRIGCIVNHVITGFDANCMVVWDVPDDELDVRGEDVGRLPYVTLCY
FT                   HRPRRPEQDWQYSLFTMIHGREADAVDEKIDELAAEHLPFDHERLYSTETLKQTGAQYE
FT                   ELVGSEE"
FT   gene            617873..618190
FT                   /locus_tag="Hbor_06630"
FT   CDS_pept        617873..618190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06630"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66262"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN32"
FT                   /protein_id="ADQ66262.1"
FT                   /translation="MPSDADESSHQSDRNDGQELLDALDAIGIDRMNELILDAWGQVDW
FT                   DDMDGTDEPMPRADDSDTDIRAETDTDSASVTDSASVTDSASVTDTEQGANSDTNTESD
FT                   V"
FT   gene            618187..618546
FT                   /locus_tag="Hbor_06640"
FT   CDS_pept        618187..618546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06640"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66263"
FT                   /db_xref="GOA:E4NN33"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN33"
FT                   /protein_id="ADQ66263.1"
FT                   /translation="MNTDSVKSEWLFAVAIVALGFVFLDMPVRPFEYATCGIVFAGTLL
FT                   SVFDSIREHWVFRVVVASAFLGVAGVKFGYAIWLAYSLEQHFVMTAVGLDGMFASVFLA
FT                   SYLGQLYRDRRERTG"
FT   gene            complement(618612..618902)
FT                   /locus_tag="Hbor_06650"
FT   CDS_pept        complement(618612..618902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06650"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66264"
FT                   /db_xref="GOA:E4NN34"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN34"
FT                   /protein_id="ADQ66264.1"
FT                   /translation="MNSISPALVAAGFAVTVLALGPVASTEPGRRFGAWFRNLGGAYRL
FT                   VLVLGFTALVFGTSFAYDVSPVTIQTVIFGSVVGLTVHVVSRILSDRLSND"
FT   sig_peptide     complement(618831..618902)
FT                   /locus_tag="Hbor_06650"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(619062..619841)
FT                   /locus_tag="Hbor_06660"
FT   CDS_pept        complement(619062..619841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06660"
FT                   /product="predicted metal-dependent phosphoesterase, PHP
FT                   family"
FT                   /note="PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06660"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66265"
FT                   /db_xref="GOA:E4NN35"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN35"
FT                   /protein_id="ADQ66265.1"
FT                   /translation="MSLTVRIDPHVHSDASYDAHDPVELILEQAAEIGLDAVVITDHDV
FT                   IHESVRAAELAPMYGLVGIPGVEVSTADGHLLALGVREMPPRRAPMKETIEWVRDRGGV
FT                   AIIPHPFQRSRHGIRKKRLQGVEPDAIEVYNSWLFTGWKNRRARRFARSGGYPGVAGSD
FT                   AHKVGYVGRAYTEIDIPDVQRVGLTADVILDAIRDGATRVEGRRTPIPTSARHYAGAGL
FT                   RKSGYFAKLGVRKSGSVAKTGVVQAARTLYRVSPFSR"
FT   gene            620032..621795
FT                   /locus_tag="Hbor_06670"
FT   CDS_pept        620032..621795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06670"
FT                   /product="ferredoxin subunit of nitrite reductase and
FT                   ring-hydroxylating dioxygenase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06670"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66266"
FT                   /db_xref="GOA:E4NN36"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN36"
FT                   /protein_id="ADQ66266.1"
FT                   /translation="MLLCFMGSIDRFRETVPLAELEREGRVQTSVDGRALALFHHEGEI
FT                   RVVDNRCPHMGFPLSEGSVEDGVLTCHWHHARFELSCGDTFDPWADDVQTFPVEIRDGS
FT                   VYVDPHPEPDEPPAEHWMRRLEDGLEQNLRLVVAKSAIGLADAGVSSDAVVERGVRFGS
FT                   RYRESGWGPGLTILAAMRNVLPDLADDDRKRALYQGLVHVAGDCADAPPRFDQEPFDTE
FT                   DVSFERLKAWFRENIKVRDADGAERVLRTAIANGADDAHLAEMLVAAATDHRYLNTGHT
FT                   LDFVNKACEVLDHVGWDHGDAVLPSLIEGMATATRAEERSSWRQPVDLAAMVSETFADL
FT                   DSLVESGAGTEWSPPASFTETLLSDDPEIVVAALEDAIREGASVEALAREVAFAAGTRV
FT                   AQFATVNEFSDWNTVHHTFTYANAVHQLARRTGARELYRGVFDAAINVYLDRFLNTPPA
FT                   PLPRPASSTETDLSVHLDELLDSFDVEGEVDEAGRRAAHYLDCGGDVSLLRERLAESLL
FT                   REDAGFHTYQALEAGFTQAELRDSPEEVRTLLVAVARYLSAHFPTRREREQTFTIAARL
FT                   HRGEKIHEEGQ"
FT   gene            complement(621818..622858)
FT                   /locus_tag="Hbor_06680"
FT   CDS_pept        complement(621818..622858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06680"
FT                   /product="predicted NAD/FAD-dependent oxidoreductase"
FT                   /note="PFAM: Flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66267"
FT                   /db_xref="GOA:E4NN37"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN37"
FT                   /protein_id="ADQ66267.1"
FT                   /translation="MTLRVGIVGAGAAGVGAAYALRNADAEVTIVEKSRGVCGRAATRR
FT                   KHDCYYDHGANYIKESDQRTESLIRDLGTDGVVDIEKPVWVFDESGEITEGDDGDSHKW
FT                   TWTEGITQLAKRLLARTDAEVRRETRVESIVCDDSEATWSLIDTEGETHGPFDRLLLTP
FT                   PAPQTAEILRATEWDGERLGDATAAVSDVSYRTIRTFVLHYPFREEYSWYGLVNVDKAH
FT                   EVGWVSREECKDGHVPDGESLLIAQMSPEWSAERYDDPLAEAGDDAAALVAELLDDDRY
FT                   ADPDWVDDQGWRYALPNDGVDTDAVRATEDAGLFFAGDWVVGEGRVHHALWNGHEAAER
FT                   IVGRAE"
FT   sig_peptide     complement(622799..622858)
FT                   /locus_tag="Hbor_06680"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            622990..623694
FT                   /locus_tag="Hbor_06690"
FT   CDS_pept        622990..623694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06690"
FT                   /product="haloacid dehalogenase superfamily enzyme,
FT                   subfamily IA"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66268"
FT                   /db_xref="GOA:E4NN38"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN38"
FT                   /protein_id="ADQ66268.1"
FT                   /translation="MQYDAVIFDNDGVLVRLSPLAVLREASRAAFEAVGVTDPAAEHVE
FT                   QMMLGVTPADVREVSEVYSLDPDAFWAARDGAAADAQISEMRDGRLSCYDDVAALEHIR
FT                   APRGIVSTNQQETIDAVLDHHDFSHLFATAYGREPTIESLRRKKPEPHYLERAMADLDA
FT                   ETALFVGDSETDVLAAHRAGIDSAFIRRPHRSDTELDASPTYEIETLYDIHAIDGVPVA
FT                   DAAADGGTEGKR"
FT   gene            623722..623889
FT                   /locus_tag="Hbor_06700"
FT   CDS_pept        623722..623889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66269"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN39"
FT                   /protein_id="ADQ66269.1"
FT                   /translation="MTVVGDALVSAGARERLCCHSEGTFCVASPRESRRPMNLERNADE
FT                   IARIDAVDCP"
FT   gene            623953..624657
FT                   /locus_tag="Hbor_06710"
FT   CDS_pept        623953..624657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06710"
FT                   /product="RecA-superfamily ATPase possibly involved in
FT                   signal transduction"
FT                   /note="PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06710"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66270"
FT                   /db_xref="GOA:E4NN40"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN40"
FT                   /protein_id="ADQ66270.1"
FT                   /translation="MRIPSGVSGFDHLIQGGFLPGRLYVLSGPPGSGKTTFTTQYVAEG
FT                   LRNGENCMYITMHESREELVNDMSSYDFGFETLTESDQFRFINLASQKGKHVLNQFSGG
FT                   GGSSGVQSLTDKIVAFVNSRKVDRLVIDSTMLLQLLFTGDDQEMTRFLTALKQGDATTL
FT                   LISEMTDPSSYSDEHFLAHGVIFFHNYLEATGMTRGIQVVKMRGTDIDCDIRSLNFTDE
FT                   GLVVDPMDHVEF"
FT   gene            624661..625074
FT                   /locus_tag="Hbor_06720"
FT   CDS_pept        624661..625074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66271"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN41"
FT                   /protein_id="ADQ66271.1"
FT                   /translation="MYERAFDLDWDSLSAEEALRRMYALGISTELGHTYDDERTRILRI
FT                   ANTAYQRSVLDLAYNEGRNAIRDHRAEYESDEAAWENLIEAKGIDVDPSVGDIDVDETP
FT                   NELPGAVERASMLDLDVDDLERLKLPKFLRRED"
FT   gene            625188..625595
FT                   /locus_tag="Hbor_06730"
FT   CDS_pept        625188..625595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06730"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="PFAM: SelR domain; TIGRFAM: methionine-R-sulfoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06730"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66272"
FT                   /db_xref="GOA:E4NN42"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN42"
FT                   /protein_id="ADQ66272.1"
FT                   /translation="MSERRSEDVPTTDEEWRERLSEEEYHILRERGTEPRFSGDHVDRD
FT                   EDGAYLCTGCGAELFDAETKFDSGCGWPSFFAAHDDAIETETDTRHGMRRIEVLCENCG
FT                   GHLGHVFDDGPEPTGKRYCINSVALEFDPDE"
FT   gene            625776..625985
FT                   /locus_tag="Hbor_06740"
FT   CDS_pept        625776..625985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06740"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66273"
FT                   /db_xref="GOA:E4NN43"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN43"
FT                   /protein_id="ADQ66273.1"
FT                   /translation="MYLLFFLGLIGIVTGIAYPAEAFFNAATPESLVTSGVNLDRGSLL
FT                   LGGTLVVLGSCSIVIAELLILARI"
FT   gene            626129..628561
FT                   /locus_tag="Hbor_06750"
FT   CDS_pept        626129..628561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06750"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06750"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66274"
FT                   /db_xref="GOA:E4NN44"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN44"
FT                   /protein_id="ADQ66274.1"
FT                   /translation="MRSDVGSMASIWSRLRFGAIQDTFRNIRSYLSRSVVASLVPKAVR
FT                   RRYAWKFAAAMLVAMLVMGSVGAVSYTQVTESLDSQVETQVTSTAELQADGMDEWLASK
FT                   SAQTRALSQAKEFQLGQERKIDLYLFSQANDLSSDVVAIHYVRVASGDVVSSTAREMKG
FT                   ENAAEMGLPWAENRTAIDSKTNDASVVHVSKTPYESPVADGKALAFISAVPSNTEHAVV
FT                   VTVNLTHRVGQFYQTMAEGETTIYDVEGDPVVSTGPDAEATNVSHAALGTSAQFSRGDD
FT                   AVAAYAPLDDMNWVVGTRVPTQSAYALRNGVGQSLLWTVLAAVGALGVAAVVIGRRTTR
FT                   TLTHLTDRAEMMADGHLEEPLESSREDEFGRLYDAVDAMRASLRTSLHEAEALNNHLES
FT                   TAEDYRAVMEQCADGDLTCRMDPDDENKAMADVAHAYNRMVDELAAVVGDAQSFSEGVA
FT                   DASAQTSANVAAVKDASADVSESMTNILDDAVRQDDHLTDAADRMNEFSATVQQMSASA
FT                   ADVAERADAAAERGERGRAAAEDAVAELQVIDEATAETVSTVEELESVIEDIESVVSFI
FT                   DGIAEQTNILALNASIEAARAGEAGEGFAVVAEEVKSLAAETQAATEDIESSIDRVREQ
FT                   TETTADDIRRTRERVVDGSETVTEAMDAIETIVDDVEQTSEAVQEIRAATERQAETATE
FT                   VVGVVADVSEISDRTSSAAEDAAATAQQQTASLVAVSDSVDSLADRADELQQALDRFDV
FT                   TGSVVVADESSPVPADNDPSALPAHTGSENSSTDAVSVQSDGGDNLNRPSWRVSDDE"
FT   gene            628610..629095
FT                   /locus_tag="Hbor_06760"
FT   CDS_pept        628610..629095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06760"
FT                   /product="predicted flavin-nucleotide-binding protein"
FT                   /note="PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06760"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66275"
FT                   /db_xref="GOA:E4NN45"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN45"
FT                   /protein_id="ADQ66275.1"
FT                   /translation="MASPVPTEIERLLTSEPLMAHVATCRNGRPHAAPVWYRYEDGVVE
FT                   LVTSGTKLRNLRENPRVALSIQKDENGDAKWMVSLLGTATVIDDEEATREATRKINRKY
FT                   GAEEDAWSENVLVRIDVGTASYRTYLNQGESPDVYGGRESDTLRHNPRSPLTPGYPP"
FT   gene            complement(629141..629956)
FT                   /locus_tag="Hbor_06770"
FT   CDS_pept        complement(629141..629956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66276"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN46"
FT                   /protein_id="ADQ66276.1"
FT                   /translation="MYQQQSSSDADIDVLQEGALRIPLPDEEAELAFHRNMANVAAAQA
FT                   QKAEMLDDPQSSVVEAYEQQLEQISESYRTSLEGFAGDEYETLARAYVADERDDGLAAM
FT                   AAYLSEAIWRLQQMITVSEMSFFPVILRYPHCCVINIRFASTHATRNAVRYESPEHLAE
FT                   EPDSTYAETYYHESILSQQQAAESIRSTASILRDEFPDPRTTAFEDRRTGGVVSAFGRR
FT                   GSEFSSALERVEPNPDRFEDAGDEPELVKPSPVAEQTEQTWLPRDATLL"
FT   gene            complement(630152..630967)
FT                   /locus_tag="Hbor_06780"
FT   CDS_pept        complement(630152..630967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06780"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66277"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN47"
FT                   /protein_id="ADQ66277.1"
FT                   /translation="MGYQRERFNGSIDVLHERAVRTPLPDKEAEREFHQNMMRVADGLD
FT                   RKAEMLADPDVSLLTAYERELEAIAESYRSRLQRVVGDEYESVALSYARGERDDPFAAI
FT                   AAYYLEGLWRMQQRITVSEMLFFPIILRYPDCFTVNIRFAAGHTTSESIRYESPEHLVE
FT                   ELNDTHDELYTSECLYSQKEAAEELEAFAEIIREEFPDPDEVPFEERKTGGIVSAGGRK
FT                   GSEFSSMLKRVEPDVDRFEDIMTEATLVQEGAEAKRTEEELLPEGTFVL"
FT   gene            complement(631076..631801)
FT                   /locus_tag="Hbor_06790"
FT   CDS_pept        complement(631076..631801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06790"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /note="PFAM: Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66278"
FT                   /db_xref="GOA:E4NN48"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN48"
FT                   /protein_id="ADQ66278.1"
FT                   /translation="MNGSHMRLARIRTADGVLTGEYDDGTVETDDGAYIVGDDAELLAP
FT                   CEPSACYCVGRNFAATLEQMEYETPEVPDWFIKPPVSVHPPDEPVEYPAWTEELTYAGE
FT                   LAAVIDERCTDLAIDEVDDAVRGYTILNDLDALDQAGRTARKAFDGSAPLGPWIETDLD
FT                   PEGIDMTTHVGGEQRQESNTELMLFSPREIISFLSERYTFQPGDVVSFGSPANPGLVEP
FT                   GEDVTIWYEGIGKLQNTVK"
FT   gene            631851..632585
FT                   /pseudo
FT                   /locus_tag="Hbor_06800"
FT   gene            complement(632612..633025)
FT                   /locus_tag="Hbor_06810"
FT   CDS_pept        complement(632612..633025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06810"
FT                   /product="Protein of unknown function, DUF393"
FT                   /note="PFAM: Protein of unknown function, DUF393"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66279"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN49"
FT                   /protein_id="ADQ66279.1"
FT                   /translation="MTDAVLVYDDDCGFCTWWADFLEARSDLRIVGFSALDPSLRDRLP
FT                   PDYESCSHLVTDDAVYSCGASIEEAMLRTDLGSGARPIVRSLRSVGLYRDVREWGYRHV
FT                   AHNRSLWGKLLSKHPPAREAATSEDEAKADDPS"
FT   gene            633124..633294
FT                   /locus_tag="Hbor_06820"
FT   CDS_pept        633124..633294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06820"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66280"
FT                   /db_xref="GOA:E4NN50"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN50"
FT                   /protein_id="ADQ66280.1"
FT                   /translation="MEQFVKLLVAGGVTLVTGLWTVTFLDSGSLLWAFGVVLVVAGVGG
FT                   LAGGIWRNIEY"
FT   gene            complement(633388..633639)
FT                   /locus_tag="Hbor_06830"
FT   CDS_pept        complement(633388..633639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06830"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66281"
FT                   /db_xref="GOA:E4NN51"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN51"
FT                   /protein_id="ADQ66281.1"
FT                   /translation="MSKPFAALWNLFCERPGRTAALSVAPVVLASAQGINALVHGTHSP
FT                   LVAVFVIGMLATAIATTRQSLASFRTESLERDLFEDIP"
FT   gene            complement(633727..634101)
FT                   /locus_tag="Hbor_06840"
FT   CDS_pept        complement(633727..634101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06840"
FT                   /product="SPW repeat protein"
FT                   /note="PFAM: SPW repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06840"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66282"
FT                   /db_xref="GOA:E4NN52"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN52"
FT                   /protein_id="ADQ66282.1"
FT                   /translation="MVDTSQWFNSISALFGAWLFASAFVFGMGGAQFWNSLIIGAAIAL
FT                   LAGYGAYRTRETGMGNTWTSGLAGLLGVWMIAAPFVYGAATTVMASSVISGLVVAVLSG
FT                   YEAYEARMEARAATTEGPRA"
FT   sig_peptide     complement(634021..634101)
FT                   /locus_tag="Hbor_06840"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(634186..635025)
FT                   /locus_tag="Hbor_06850"
FT   CDS_pept        complement(634186..635025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06850"
FT                   /product="Ion channel"
FT                   /note="PFAM: Ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06850"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66283"
FT                   /db_xref="GOA:E4NN53"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN53"
FT                   /protein_id="ADQ66283.1"
FT                   /translation="MGSHAPSGTDDFREQVRFYLLDHRTAVGKAIDVTLLALNLVFVGV
FT                   FVAQTYPVSSATDAWLWRAEVAIASVFVVEYVLRLYGSRNRLQEFTNPYTVVDLLSILP
FT                   TISVFLLPVPAVVLTVGFLRVARVVRVLRFYRFTRDEEFFFGTVSVETLRVMKLLLTVL
FT                   VVFFVSAGLFYSAEFQTNPDVNNFGDAFYYMVITLTTVGFGDIIPVTSAGRWVTVASVL
FT                   AAIILVPWQAGKIVREWTNREKVNVTCPNCGLSHHDPDASHCKSCGHIIYQEYDSRQ"
FT   gene            635131..635601
FT                   /locus_tag="Hbor_06860"
FT   CDS_pept        635131..635601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06860"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66284"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN54"
FT                   /protein_id="ADQ66284.1"
FT                   /translation="MDEKNYKNTSKYLHELIQEARATRAEGFLAPQSSDQEVQRLKKKI
FT                   EKLEDRLAVAKQQRRDSVTIRTIKRFRLIRRDTDLDDLFVGIRDDRLTKTVIQCAVREA
FT                   AVKESILEDSEDRFHKKFTPHTVGTVFTTLMRNQGRSSTSSSTSVRMRRTRR"
FT   gene            635871..636278
FT                   /locus_tag="Hbor_06870"
FT   CDS_pept        635871..636278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06870"
FT                   /product="DoxX protein"
FT                   /note="PFAM: DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06870"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66285"
FT                   /db_xref="GOA:E4NN55"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN55"
FT                   /protein_id="ADQ66285.1"
FT                   /translation="MVVETSPAAELFLIGRVLLGGVLAYLGVSNMLDAENKIEYARSTG
FT                   IPFAGLAVPVSFVLLILGGLGILLGVYPMIASVGVIAFFAGVTPAMHAFWRIDDPDERS
FT                   QEKTQFLVNFALLGSALIVLVIGSATWPYAP"
FT   gene            636315..636662
FT                   /locus_tag="Hbor_06880"
FT   CDS_pept        636315..636662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06880"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06880"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66286"
FT                   /db_xref="GOA:E4NN56"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN56"
FT                   /protein_id="ADQ66286.1"
FT                   /translation="MTTDDSTEAFAGLFADSDAEPEFLTKLRAHDPDFADHVAAIARNA
FT                   GTDDALSAQTKTLITLALDAADGNTNGVKDLAAVARSQGVSEQELAETVKVIANQGGLG
FT                   KLAVAAHALTE"
FT   gene            complement(636671..637057)
FT                   /locus_tag="Hbor_06890"
FT   CDS_pept        complement(636671..637057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06890"
FT                   /product="predicted transcriptional regulator"
FT                   /note="PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06890"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66287"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN57"
FT                   /protein_id="ADQ66287.1"
FT                   /translation="MVPAPDEKIDDNLREVRELTPNACAGVQSLDQFGTKWRLRILYNL
FT                   FDGDHRFNELKRASGASSYTLSRVLESLEEDAIVDRRVEEGPPVETHYSLTEKGAALKP
FT                   VFDAIDEWNAEWVGENGEECHRNA"
FT   gene            complement(637155..638096)
FT                   /locus_tag="Hbor_06900"
FT   CDS_pept        complement(637155..638096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06900"
FT                   /product="predicted glutathione S-transferase"
FT                   /note="PFAM: Glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06900"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66288"
FT                   /db_xref="GOA:E4NN58"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN58"
FT                   /protein_id="ADQ66288.1"
FT                   /translation="MGRLIDGHWKTTDELTENDQNRSDDGFRERISPDSRYPPESGRYH
FT                   LYIARACPWAHGAALVRKLLGLEDVISLDIVDPYRGAGGWQFTPDKPGCTPDSIHDSDF
FT                   LHEVYTAADPEYSGGVTTPVLWDRENGTIVNNESIEIMQMLATAFADHSDEYDLYPAGK
FT                   RDRIDAVVEKLHEPILQGAYTAGFAESQDTYERAVETMFDALNHWEGVLGDQRFLVGDS
FT                   LTIADLRLFPALVRFDPVYYTHFKCNIRRLVDYPNLWGYTRDIYQHDGVSETVTLDHIK
FT                   KHYYRSHTDINPTGFVPVGPDIDFTAPHSRTE"
FT   gene            complement(638137..638541)
FT                   /locus_tag="Hbor_06910"
FT   CDS_pept        complement(638137..638541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06910"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06910"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66289"
FT                   /db_xref="GOA:E4NN59"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN59"
FT                   /protein_id="ADQ66289.1"
FT                   /translation="MNALQIDHVHLRIPEDEIEHAIEFYQGHLGFPLEGFDEYEAGETP
FT                   IFHFRLTEDTIIHIRPTDEFVHPERENFDHLAIILDEDIKDVKQELEDAGVIIEREGTP
FT                   YGATGEAPAIYVRDPFGYLLELKEPVAETA"
FT   gene            complement(639300..639602)
FT                   /locus_tag="Hbor_06920"
FT   CDS_pept        complement(639300..639602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06920"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66290"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN60"
FT                   /protein_id="ADQ66290.1"
FT                   /translation="MNQTTSPITVQLTITNVASDAEVYSESVSVDYDEELANRVTTIEG
FT                   VIEEPGEHLISVELKDDNSDEYVWDVPGNQGQPDGAVGLDITVYEDRIEFTETAA"
FT   gene            complement(639756..640376)
FT                   /locus_tag="Hbor_06930"
FT   CDS_pept        complement(639756..640376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06930"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66291"
FT                   /db_xref="GOA:E4NN61"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN61"
FT                   /protein_id="ADQ66291.1"
FT                   /translation="MSISTVAAILPTHQFKQNESSSLLNNRADAISNAWETDIEDSSGD
FT                   YSLRTHTHWDKPVSISSDDAGTARQEAAEYVHNNYSFSSKYDSILVIHDEKWNDNVTGM
FT                   APIPPTDGDSDEIAAGNNPQPVAIATTGTLIAAADTHEMGHMYSARHSDHENWGVAEFT
FT                   VMGNPSSTTCNGNDHTFRTRKNRFSDCDITPIRDYMDNHSDLF"
FT   gene            complement(641405..641989)
FT                   /locus_tag="Hbor_06940"
FT   CDS_pept        complement(641405..641989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06940"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06940"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66292"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN62"
FT                   /protein_id="ADQ66292.1"
FT                   /translation="MQPIRTRSVLRTPVRVFAVQLHATGCSLRETKEILRILGVERSHQ
FT                   AFWQWVHRLADSGHTPPEAKPKRVAVDETAVKINGEWSWLYAAIDIETKLILDVELFGR
FT                   HGTDPAAAFLHRLSEKHDLSDTVFLVDGYGHQTALSRLGLSGLLDYVERNLIEKWFHIL
FT                   KMRVERFHNSWVGSHGSVHGWIIQFAQYYDF"
FT   sig_peptide     complement(641936..641989)
FT                   /locus_tag="Hbor_06940"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            642271..642438
FT                   /locus_tag="Hbor_06950"
FT   CDS_pept        642271..642438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06950"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66293"
FT                   /db_xref="UniProtKB/TrEMBL:E4NN63"
FT                   /protein_id="ADQ66293.1"
FT                   /translation="MEKCSNRISIMSSKQFDVENQLFQCLLYSLPKATRHDFDSGLVSN
FT                   NPLWLRLRQL"
FT   gene            complement(642740..643573)
FT                   /locus_tag="Hbor_06960"
FT   CDS_pept        complement(642740..643573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hbor_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hbor_06960"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ66294"
FT                   /db_xref="GOA:E4NN64"
FT                   /db_xref="Un