(data stored in ACNUC7421 zone)

EMBL: CP001698

ID   CP001698; SV 1; circular; genomic DNA; STD; PRO; 2472645 BP.
XX
AC   CP001698;
XX
PR   Project:PRJNA39877;
XX
DT   13-SEP-2010 (Rel. 106, Created)
DT   15-NOV-2016 (Rel. 131, Last updated, Version 7)
XX
DE   Spirochaeta thermophila DSM 6192, complete genome.
XX
KW   .
XX
OS   Spirochaeta thermophila DSM 6192
OC   Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
XX
RN   [1]
RP   1-2472645
RX   DOI; 10.1128/JB.01023-10.
RX   PUBMED; 20935097.
RA   Angelov A., Liebl S., Ballschmiter M., Bomeke M., Lehmann R., Liesegang H.,
RA   Daniel R., Liebl W.;
RT   "Genome sequence of the polysaccharide-degrading, thermophilic anaerobe
RT   Spirochaeta thermophila DSM 6192";
RL   J. Bacteriol. 192(24):6492-6493(2010).
XX
RN   [2]
RP   1-2472645
RA   Angelov A., Mientus M., Wittenberg S., Lehmann R., Liesegang H., Daniel R.,
RA   Liebl W.;
RT   ;
RL   Submitted (12-AUG-2009) to the INSDC.
RL   Goettingen Genomics Laboratory, Georg-August University Goettingen,
RL   Grisebachstrasse 8, Goettingen, Lower-Saxony D-37077, Germany
XX
DR   MD5; 071f1359980105a4ad71e399c25c7971.
DR   BioSample; SAMN02603259.
DR   CABRI; DSM 6192.
DR   EnsemblGenomes-Gn; EBG00001203763.
DR   EnsemblGenomes-Gn; EBG00001203764.
DR   EnsemblGenomes-Gn; EBG00001203765.
DR   EnsemblGenomes-Gn; EBG00001203766.
DR   EnsemblGenomes-Gn; EBG00001203767.
DR   EnsemblGenomes-Gn; EBG00001203768.
DR   EnsemblGenomes-Gn; EBG00001203769.
DR   EnsemblGenomes-Gn; EBG00001203770.
DR   EnsemblGenomes-Gn; EBG00001203771.
DR   EnsemblGenomes-Gn; EBG00001203772.
DR   EnsemblGenomes-Gn; EBG00001203773.
DR   EnsemblGenomes-Gn; EBG00001203774.
DR   EnsemblGenomes-Gn; EBG00001203775.
DR   EnsemblGenomes-Gn; EBG00001203776.
DR   EnsemblGenomes-Gn; EBG00001203777.
DR   EnsemblGenomes-Gn; EBG00001203778.
DR   EnsemblGenomes-Gn; EBG00001203779.
DR   EnsemblGenomes-Gn; EBG00001203780.
DR   EnsemblGenomes-Gn; EBG00001203781.
DR   EnsemblGenomes-Gn; EBG00001203782.
DR   EnsemblGenomes-Gn; EBG00001203783.
DR   EnsemblGenomes-Gn; EBG00001203784.
DR   EnsemblGenomes-Gn; EBG00001203785.
DR   EnsemblGenomes-Gn; EBG00001203786.
DR   EnsemblGenomes-Gn; EBG00001203787.
DR   EnsemblGenomes-Gn; EBG00001203788.
DR   EnsemblGenomes-Gn; EBG00001203789.
DR   EnsemblGenomes-Gn; EBG00001203790.
DR   EnsemblGenomes-Gn; EBG00001203791.
DR   EnsemblGenomes-Gn; EBG00001203792.
DR   EnsemblGenomes-Gn; EBG00001203793.
DR   EnsemblGenomes-Gn; EBG00001203794.
DR   EnsemblGenomes-Gn; EBG00001203795.
DR   EnsemblGenomes-Gn; EBG00001203796.
DR   EnsemblGenomes-Gn; EBG00001203797.
DR   EnsemblGenomes-Gn; EBG00001203798.
DR   EnsemblGenomes-Gn; EBG00001203799.
DR   EnsemblGenomes-Gn; EBG00001203800.
DR   EnsemblGenomes-Gn; EBG00001203801.
DR   EnsemblGenomes-Gn; EBG00001203802.
DR   EnsemblGenomes-Gn; EBG00001203803.
DR   EnsemblGenomes-Gn; EBG00001203804.
DR   EnsemblGenomes-Gn; EBG00001203805.
DR   EnsemblGenomes-Gn; EBG00001203806.
DR   EnsemblGenomes-Gn; EBG00001203807.
DR   EnsemblGenomes-Gn; EBG00001203808.
DR   EnsemblGenomes-Gn; EBG00001203809.
DR   EnsemblGenomes-Gn; EBG00001203810.
DR   EnsemblGenomes-Gn; EBG00001203811.
DR   EnsemblGenomes-Gn; EBG00001203812.
DR   EnsemblGenomes-Gn; EBG00001203813.
DR   EnsemblGenomes-Gn; EBG00001203814.
DR   EnsemblGenomes-Gn; EBG00001203815.
DR   EnsemblGenomes-Gn; EBG00001203816.
DR   EnsemblGenomes-Gn; EBG00001203817.
DR   EnsemblGenomes-Gn; EBG00001203818.
DR   EnsemblGenomes-Gn; EBG00001203819.
DR   EnsemblGenomes-Gn; STHERM_c01740.
DR   EnsemblGenomes-Gn; STHERM_c01750.
DR   EnsemblGenomes-Gn; STHERM_c02530.
DR   EnsemblGenomes-Gn; STHERM_c03670.
DR   EnsemblGenomes-Gn; STHERM_c04730.
DR   EnsemblGenomes-Gn; STHERM_c04810.
DR   EnsemblGenomes-Gn; STHERM_c04830.
DR   EnsemblGenomes-Gn; STHERM_c05490.
DR   EnsemblGenomes-Gn; STHERM_c05500.
DR   EnsemblGenomes-Gn; STHERM_c05510.
DR   EnsemblGenomes-Gn; STHERM_c05520.
DR   EnsemblGenomes-Gn; STHERM_c05850.
DR   EnsemblGenomes-Gn; STHERM_c05860.
DR   EnsemblGenomes-Gn; STHERM_c05870.
DR   EnsemblGenomes-Gn; STHERM_c05880.
DR   EnsemblGenomes-Gn; STHERM_c05890.
DR   EnsemblGenomes-Gn; STHERM_c05960.
DR   EnsemblGenomes-Gn; STHERM_c06790.
DR   EnsemblGenomes-Gn; STHERM_c07280.
DR   EnsemblGenomes-Gn; STHERM_c07360.
DR   EnsemblGenomes-Gn; STHERM_c07370.
DR   EnsemblGenomes-Gn; STHERM_c07400.
DR   EnsemblGenomes-Gn; STHERM_c07410.
DR   EnsemblGenomes-Gn; STHERM_c07420.
DR   EnsemblGenomes-Gn; STHERM_c07430.
DR   EnsemblGenomes-Gn; STHERM_c07920.
DR   EnsemblGenomes-Gn; STHERM_c07980.
DR   EnsemblGenomes-Gn; STHERM_c08750.
DR   EnsemblGenomes-Gn; STHERM_c08760.
DR   EnsemblGenomes-Gn; STHERM_c09430.
DR   EnsemblGenomes-Gn; STHERM_c10390.
DR   EnsemblGenomes-Gn; STHERM_c11470.
DR   EnsemblGenomes-Gn; STHERM_c11480.
DR   EnsemblGenomes-Gn; STHERM_c11550.
DR   EnsemblGenomes-Gn; STHERM_c11700.
DR   EnsemblGenomes-Gn; STHERM_c13460.
DR   EnsemblGenomes-Gn; STHERM_c16520.
DR   EnsemblGenomes-Gn; STHERM_c16530.
DR   EnsemblGenomes-Gn; STHERM_c16940.
DR   EnsemblGenomes-Gn; STHERM_c17190.
DR   EnsemblGenomes-Gn; STHERM_c20390.
DR   EnsemblGenomes-Gn; STHERM_c20660.
DR   EnsemblGenomes-Gn; STHERM_c20670.
DR   EnsemblGenomes-Gn; STHERM_c20750.
DR   EnsemblGenomes-Gn; STHERM_c21320.
DR   EnsemblGenomes-Gn; STHERM_c21400.
DR   EnsemblGenomes-Gn; STHERM_c21850.
DR   EnsemblGenomes-Gn; STHERM_c22380.
DR   EnsemblGenomes-Gn; STHERM_c22390.
DR   EnsemblGenomes-Gn; STHERM_c22400.
DR   EnsemblGenomes-Gn; STHERM_c22410.
DR   EnsemblGenomes-Gn; STHERM_c22420.
DR   EnsemblGenomes-Tr; EBT00001574586.
DR   EnsemblGenomes-Tr; EBT00001574587.
DR   EnsemblGenomes-Tr; EBT00001574588.
DR   EnsemblGenomes-Tr; EBT00001574589.
DR   EnsemblGenomes-Tr; EBT00001574590.
DR   EnsemblGenomes-Tr; EBT00001574592.
DR   EnsemblGenomes-Tr; EBT00001574594.
DR   EnsemblGenomes-Tr; EBT00001574595.
DR   EnsemblGenomes-Tr; EBT00001574597.
DR   EnsemblGenomes-Tr; EBT00001574599.
DR   EnsemblGenomes-Tr; EBT00001574602.
DR   EnsemblGenomes-Tr; EBT00001574604.
DR   EnsemblGenomes-Tr; EBT00001574606.
DR   EnsemblGenomes-Tr; EBT00001574608.
DR   EnsemblGenomes-Tr; EBT00001574611.
DR   EnsemblGenomes-Tr; EBT00001574613.
DR   EnsemblGenomes-Tr; EBT00001574614.
DR   EnsemblGenomes-Tr; EBT00001574615.
DR   EnsemblGenomes-Tr; EBT00001574617.
DR   EnsemblGenomes-Tr; EBT00001574618.
DR   EnsemblGenomes-Tr; EBT00001574619.
DR   EnsemblGenomes-Tr; EBT00001574621.
DR   EnsemblGenomes-Tr; EBT00001574623.
DR   EnsemblGenomes-Tr; EBT00001574625.
DR   EnsemblGenomes-Tr; EBT00001574627.
DR   EnsemblGenomes-Tr; EBT00001574628.
DR   EnsemblGenomes-Tr; EBT00001574629.
DR   EnsemblGenomes-Tr; EBT00001574630.
DR   EnsemblGenomes-Tr; EBT00001574632.
DR   EnsemblGenomes-Tr; EBT00001574633.
DR   EnsemblGenomes-Tr; EBT00001574635.
DR   EnsemblGenomes-Tr; EBT00001574638.
DR   EnsemblGenomes-Tr; EBT00001574639.
DR   EnsemblGenomes-Tr; EBT00001574644.
DR   EnsemblGenomes-Tr; EBT00001574646.
DR   EnsemblGenomes-Tr; EBT00001574647.
DR   EnsemblGenomes-Tr; EBT00001574648.
DR   EnsemblGenomes-Tr; EBT00001574650.
DR   EnsemblGenomes-Tr; EBT00001574651.
DR   EnsemblGenomes-Tr; EBT00001574654.
DR   EnsemblGenomes-Tr; EBT00001574656.
DR   EnsemblGenomes-Tr; EBT00001574657.
DR   EnsemblGenomes-Tr; EBT00001574658.
DR   EnsemblGenomes-Tr; EBT00001574659.
DR   EnsemblGenomes-Tr; EBT00001574660.
DR   EnsemblGenomes-Tr; EBT00001574662.
DR   EnsemblGenomes-Tr; EBT00001574664.
DR   EnsemblGenomes-Tr; EBT00001574665.
DR   EnsemblGenomes-Tr; EBT00001574666.
DR   EnsemblGenomes-Tr; EBT00001574667.
DR   EnsemblGenomes-Tr; EBT00001574668.
DR   EnsemblGenomes-Tr; EBT00001574671.
DR   EnsemblGenomes-Tr; EBT00001574673.
DR   EnsemblGenomes-Tr; EBT00001574674.
DR   EnsemblGenomes-Tr; EBT00001574676.
DR   EnsemblGenomes-Tr; EBT00001574678.
DR   EnsemblGenomes-Tr; EBT00001574680.
DR   EnsemblGenomes-Tr; STHERM_c01740-1.
DR   EnsemblGenomes-Tr; STHERM_c01750-1.
DR   EnsemblGenomes-Tr; STHERM_c02530-1.
DR   EnsemblGenomes-Tr; STHERM_c03670-1.
DR   EnsemblGenomes-Tr; STHERM_c04730-1.
DR   EnsemblGenomes-Tr; STHERM_c04810-1.
DR   EnsemblGenomes-Tr; STHERM_c04830-1.
DR   EnsemblGenomes-Tr; STHERM_c05490-1.
DR   EnsemblGenomes-Tr; STHERM_c05500-1.
DR   EnsemblGenomes-Tr; STHERM_c05510-1.
DR   EnsemblGenomes-Tr; STHERM_c05520-1.
DR   EnsemblGenomes-Tr; STHERM_c05850-1.
DR   EnsemblGenomes-Tr; STHERM_c05860-1.
DR   EnsemblGenomes-Tr; STHERM_c05870-1.
DR   EnsemblGenomes-Tr; STHERM_c05880-1.
DR   EnsemblGenomes-Tr; STHERM_c05890-1.
DR   EnsemblGenomes-Tr; STHERM_c05960-1.
DR   EnsemblGenomes-Tr; STHERM_c06790-1.
DR   EnsemblGenomes-Tr; STHERM_c07280-1.
DR   EnsemblGenomes-Tr; STHERM_c07360-1.
DR   EnsemblGenomes-Tr; STHERM_c07370-1.
DR   EnsemblGenomes-Tr; STHERM_c07400-1.
DR   EnsemblGenomes-Tr; STHERM_c07410-1.
DR   EnsemblGenomes-Tr; STHERM_c07420-1.
DR   EnsemblGenomes-Tr; STHERM_c07430-1.
DR   EnsemblGenomes-Tr; STHERM_c07920-1.
DR   EnsemblGenomes-Tr; STHERM_c07980-1.
DR   EnsemblGenomes-Tr; STHERM_c08750-1.
DR   EnsemblGenomes-Tr; STHERM_c08760-1.
DR   EnsemblGenomes-Tr; STHERM_c09430-1.
DR   EnsemblGenomes-Tr; STHERM_c10390-1.
DR   EnsemblGenomes-Tr; STHERM_c11470-1.
DR   EnsemblGenomes-Tr; STHERM_c11480-1.
DR   EnsemblGenomes-Tr; STHERM_c11550-1.
DR   EnsemblGenomes-Tr; STHERM_c11700-1.
DR   EnsemblGenomes-Tr; STHERM_c13460-1.
DR   EnsemblGenomes-Tr; STHERM_c16520-1.
DR   EnsemblGenomes-Tr; STHERM_c16530-1.
DR   EnsemblGenomes-Tr; STHERM_c16940-1.
DR   EnsemblGenomes-Tr; STHERM_c17190-1.
DR   EnsemblGenomes-Tr; STHERM_c20390-1.
DR   EnsemblGenomes-Tr; STHERM_c20660-1.
DR   EnsemblGenomes-Tr; STHERM_c20670-1.
DR   EnsemblGenomes-Tr; STHERM_c20750-1.
DR   EnsemblGenomes-Tr; STHERM_c21320-1.
DR   EnsemblGenomes-Tr; STHERM_c21400-1.
DR   EnsemblGenomes-Tr; STHERM_c21850-1.
DR   EnsemblGenomes-Tr; STHERM_c22380-1.
DR   EnsemblGenomes-Tr; STHERM_c22390-1.
DR   EnsemblGenomes-Tr; STHERM_c22400-1.
DR   EnsemblGenomes-Tr; STHERM_c22410-1.
DR   EnsemblGenomes-Tr; STHERM_c22420-1.
DR   EuropePMC; PMC3008529; 20935097.
DR   EuropePMC; PMC3147429; 21685171.
DR   EuropePMC; PMC3236047.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001698.
DR   SILVA-SSU; CP001698.
DR   StrainInfo; 115118; 0.
XX
CC   Source DNA and organism available from the German Collection of
CC   Microorganisms and Cell Cultures (DSMZ).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2472645
FT                   /organism="Spirochaeta thermophila DSM 6192"
FT                   /strain="DSM 6192"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:665571"
FT                   /culture_collection="DSM:6192"
FT   gene            101..1459
FT                   /gene="dnaA"
FT                   /locus_tag="STHERM_c00010"
FT   CDS_pept        101..1459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="STHERM_c00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00977"
FT                   /db_xref="GOA:E0RTB1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB1"
FT                   /protein_id="ADN00977.1"
FT                   /translation="MEHAWDYSIVWKETLNLLRGVLTEQEFRLWFFEVDYYDGSEETLR
FT                   IRVPSSFVRDQIKQRYQRLIEDKFYELLGRKLLLDFVVEKRSLAQERPVSSSSPQREIP
FT                   KERPPHPQLRRDYTFENFVIGENNAFAANAALAIAKNPGTAYNPCLIYGGVGLGKTHLL
FT                   QSIGNSVYGEFHNLKVVYVTAEEFTNEFIASIQNKETHKFKTKYRNVDVLLIDDIHFFM
FT                   NKTETQEELFHTFNALYDANKQMVFTCDRPVSELKNISHRLRSRFERGLNVDLQPPSFE
FT                   TRYAILKKKIEQKTVHIPDEVITFIAEHVTTNVRDLEAALTKLIAYAELVHRDITIDIA
FT                   KSQLKDMFTTTKQTNITIDLIQKVVADYFGITQSDLRNKKRTRTVVFPRQIAMYIAREL
FT                   TEYSTTEIGEYFGGRDHTTVMYAIQKIESKMRTDPTLDTIIAQLIREVQEGTK"
FT   gene            1652..2755
FT                   /gene="dnaN"
FT                   /locus_tag="STHERM_c00020"
FT   CDS_pept        1652..2755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="STHERM_c00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00978"
FT                   /db_xref="GOA:E0RTB2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB2"
FT                   /protein_id="ADN00978.1"
FT                   /translation="MKFTCERDELIKDISLAQDIIASKNALSILANVLLVAKDSRLTIR
FT                   ATDLKVGFETSSPVEVSREGATTVFCDKLLGILRSLPSGAVEFELDEHDSLHIRTVFKK
FT                   INFTLKTISPDKYPEMPLHGDSYFSIPQSDLLEMISHTVFAVSDDETRYFMNGVFVEKG
FT                   EKGLTMVATDGRRLAYIEKGVDGGVPDFNGVIIPPKILHLARKLLPGEGMVDVAIGEKH
FT                   VFLRYGDVYLSSNLIEGNFPAYRRVIPEQQAHSFTLQREEFLEALRRVSLLVEQKSRRV
FT                   FLTVKEGVLVVSSEETDLGVAQEEIPAQYADEEVTIAVNYLYLLEPLKVMTEEQVEIAF
FT                   TEPSRAITVRPVPEREFFHIVMPMQLD"
FT   gene            2760..3851
FT                   /gene="recF"
FT                   /locus_tag="STHERM_c00030"
FT   CDS_pept        2760..3851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="STHERM_c00030"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00979"
FT                   /db_xref="GOA:E0RTB3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB3"
FT                   /protein_id="ADN00979.1"
FT                   /translation="MFLTIGSEGFRNIVTGTIDVGAPVVVFVGENGQGKTNILELVYLL
FT                   CYGVSFRTRQNTFLIRRGRSSCRVHGEFRTEEGYILPILVEIGPTSKEIFLNEKKIANR
FT                   KELFSISPCIVFAHDDIQFVVGSPLLHRQFMNQILTLVDPLFLDSLRTYNRILTSRNEA
FT                   LKEAREDLLDVYDDQLADIAHQITVKRERMMDAFSSILRSTCEEFGFSGNVFDVSYRAS
FT                   LKGDGKEELMRILRSERTQDLMVGFTRRGPHRDRLVFTMNGHPVPDYASTGEIRLLSLL
FT                   LRVAQTTYVRESTGKTPILLFDDVLLELDPLKRRRVVEMIPHGRQSFFTFLPEEPILQV
FT                   LGGGRSLVYHVVEGRIVPDETSQ"
FT   gene            3835..4284
FT                   /locus_tag="STHERM_c00040"
FT   CDS_pept        3835..4284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00980"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB4"
FT                   /protein_id="ADN00980.1"
FT                   /translation="MKRASELVRALLSHIAPEQGEMYLRFFHMWRRILGERLAYHCRIE
FT                   DVEKGVVKVVVDHPAWLAEVHFKERYILSRLQKDFPSLGIRRLEFRVEPTMTPRSSQDQ
FT                   VRTQSSEGTEPVEVEEIHATETERIKDPHLREALERLRKTLSRGL"
FT   gene            4369..5607
FT                   /locus_tag="STHERM_c00050"
FT   CDS_pept        4369..5607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00050"
FT                   /product="transposase for insertion sequence element ISRM5"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00981"
FT                   /db_xref="GOA:E0RTB5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB5"
FT                   /protein_id="ADN00981.1"
FT                   /translation="MKRGKTRALTETQYTLSGLMKQVEAQLREEVRHTYKTYLEHLLET
FT                   LREEAVGRPRYARGEAEKPPYYRYGYRKWKSVQTPWGPIEEVRVPRIRTGGGKEVKLVA
FT                   YEQRLVALTEQLLLGYVGGMSARRYAILLRELGIGEAHPQTILRIIKRLREEKERWRRR
FT                   PLSGVKALVLDGVWGKLRGKGRRGLVILSAVGVKEDGSHELLDWVVAEREERASYERLL
FT                   TRLYERGLHEVELVVADEAEGIWQAVETVYPEAKKQVCLWHLERTLERTLLNELRGKEK
FT                   RHVQEMRRAFRDAYRKLLAAREKEEAEKALEGFWKEWGARAPRMSAALLWRKDRLFSYL
FT                   ELPYEWKEKVRTNALVENLFRHMRSFLRRYPGYMSRAHADEAVGLYVVGMQIHSQCGRR
FT                   TPYQLQLNFNTPP"
FT   gene            5710..5865
FT                   /gene="rpmH"
FT                   /locus_tag="STHERM_c00060"
FT   CDS_pept        5710..5865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="STHERM_c00060"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00982"
FT                   /db_xref="GOA:E0RTB6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB6"
FT                   /protein_id="ADN00982.1"
FT                   /translation="MKRTYQPSRVKRVRKFGFRARMKTKGGRLVLKRRRAKGRKKLTVS
FT                   DEKKPY"
FT   gene            6129..6410
FT                   /locus_tag="STHERM_c00070"
FT   CDS_pept        6129..6410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00983"
FT                   /db_xref="GOA:E0RTB7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB7"
FT                   /protein_id="ADN00983.1"
FT                   /translation="MKHGWSSSAPFSKRQSWWVRWIAFPRKLLVLVIRLYQRFVSPAFP
FT                   SRCRFYPTCSHYTIQALEKYGLVKGLSLGIKRISKCHPFHPGGYDPVP"
FT   gene            6429..8150
FT                   /locus_tag="STHERM_c00080"
FT   CDS_pept        6429..8150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00984"
FT                   /db_xref="GOA:E0RTB8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB8"
FT                   /protein_id="ADN00984.1"
FT                   /translation="MERNVVIAVILSAVVIIVSAVINQMLFMSQVPQVPAPVEEEVLSE
FT                   TPTPQATSSQEGSSLLSEGLPSGLSVEALLPAEDREVVYRSPLMEVVFSSRGGTVRSLK
FT                   LLTHRDGEESVEMVYRPEGGRNAFSLSIGKGDLLLDVPFQVRRPDERTVEFFQDVRLSG
FT                   LPPFRVTKRYRFYPEEYLFDLEVELVNSENSSLPLNFEGVMYTLDTGPQIGPPFAALDR
FT                   YGEYRKFFYFLNGKRKEVRLDPGKISELEEGDPTWVAISGKYFTLIAIPLLPQYDVAFS
FT                   TVVEGDLPLGSTVYLYRPAARSARITDLYRFYVGPKISGELSKYNKKNENSAGLSELHL
FT                   EKVVDTSLLGWLEGILKFFLQIFFRIIPNYGVAIILLTLFVKILLFPLTHKSYESASKM
FT                   QQLAPKMEEVRNRYKDDPQRMNQELALLYQKEGVNPLGGCLPLLLQIPIFFAMYGLFSS
FT                   HFDLRGATFIPGWIDDLSVPESVFHFDTPLPLLGWTDIRLLPLILVVTQIISTKITQGA
FT                   SSSSQNQVFMYVLPVVFLFILYNAPAGLLVYWVAMNIFTIAQQLYINRVMKRKTSD"
FT   gene            8162..8830
FT                   /locus_tag="STHERM_c00090"
FT   CDS_pept        8162..8830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00985"
FT                   /db_xref="GOA:E0RTB9"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTB9"
FT                   /protein_id="ADN00985.1"
FT                   /translation="MVQEFEGRTEQEALQRAIESLGLVREEFDVEIVEEQKPRLFRPGR
FT                   VVIRVHVPDGSDASRKERRGGAPQVGLERHLVAFLEGITERMGFPSRVKVKERSEEKLV
FT                   LVLESEYSHILIGKKGKNLDALQVLANVIASRDGGSSVRVVLDAENYRERRQEQLVQLA
FT                   KRVGYKVKRTKRSVLLEPMNPFERRLIHTTISGIPGVATKSEGEGLIKQVRVYYTDQKR
FT                   "
FT   gene            8843..9229
FT                   /locus_tag="STHERM_c00100"
FT   CDS_pept        8843..9229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00100"
FT                   /product="glycine cleavage system H protein"
FT                   /note="mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00986"
FT                   /db_xref="GOA:E0RTC0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC0"
FT                   /protein_id="ADN00986.1"
FT                   /translation="MEFRDDVRYASTHEWARREGDVVVCGISDYAQDSLGDVVFVQLPE
FT                   VGVVKKRGEAFGVVESVKTTSDVHMPVSGKIVEINETLKERPDLLNTSPFEEGWLVKLQ
FT                   PTDPAELEELLSADDYRKYVEEEE"
FT   gene            9266..10591
FT                   /gene="ugdH"
FT                   /locus_tag="STHERM_c00110"
FT   CDS_pept        9266..10591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugdH"
FT                   /locus_tag="STHERM_c00110"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="UDPGDH; UDP-GlcDH; UDP-Glc dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00987"
FT                   /db_xref="GOA:E0RTC1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC1"
FT                   /protein_id="ADN00987.1"
FT                   /translation="MPMKIAVVGTGYVGLTTCVGLADFGNHVVGVDIDREKVARLSAGD
FT                   PVIYEAGLEYYLRENLAAGRLSFTTSMKEALRDAEVVFLAVGTPEKENGEADLSQIEAV
FT                   LEELAPLIDHYLVVVTKSTVPVGTNRWIHEELSRMVDPRLFDVVSNPEFLREGKAIQDF
FT                   FHPNRVVIGYENERVKEVMHEIYRPLYLIETPFVWCSWETAELIKYAANAFLATKISFI
FT                   NQVANLAEEVGADVHVIAKAMGMDGRISPKFLHPGPGFGGSCFPKDTKALVKIGERYGV
FT                   DLSLVREVIRANEAQRVRMVEKAKRLLGGSLEGRRIAVLGLAFKAETDDVRETPAYPII
FT                   RAMLEEGAVVCAHDPLAMENFRRLVPSIEYAENEYEAARGADLVLICTEWNEYRNLDLE
FT                   RVAELMRERKILDTRNVLDPERARKTGFVYEGVGRILFRGKR"
FT   gene            10588..12003
FT                   /gene="ahcY"
FT                   /locus_tag="STHERM_c00120"
FT   CDS_pept        10588..12003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="STHERM_c00120"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="AdoHcyase; S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00988"
FT                   /db_xref="GOA:E0RTC2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC2"
FT                   /protein_id="ADN00988.1"
FT                   /translation="MIGTHDPYRVKEIGLAEAGRAAIEMAEKEMPGLMALREKYGDAKP
FT                   LAGARISGSLHMTVETAVLIETLRLLGAEVRWASCNIYSTQDHAAAAVAKAGIPVYAWK
FT                   GETLEEYWECTLNALTFPDGGGPDLVVDDGGDATLMIHKGYELEEGSRWVDEPSQSEDE
FT                   RALKALLRRVYQEDPHHWHKVVERWKGVSEETTTGVHRLYMLQEQGRLLVPAINVNDSV
FT                   TKSKFDNIYGCRESLIDGIKRATDVMIAGKVAVVCGYGDVGKGCAQSLKAFGARVIVTE
FT                   VDPICALQAAMEGYQVTTVEDTLGIADIYVTATGNVHVITVDHMARMKDQAIVCNIGHF
FT                   DAEIDVAGLKAASDIVRTAVKPQVDRYTFPDGHSIYVLADGRLVNLGCATGHPAFVMSA
FT                   SFTNQVLAQMDLWRNRRRYERRVYRLPKKLDEEVARLHLEKLGVKLTRLTPEQAAYIGV
FT                   PEDGPYKPEHYRY"
FT   gene            12030..13196
FT                   /gene="metK"
FT                   /locus_tag="STHERM_c00130"
FT   CDS_pept        12030..13196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="STHERM_c00130"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="MAT; AdoMet synthetase;
FT                   methionineadenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00989"
FT                   /db_xref="GOA:E0RTC3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC3"
FT                   /protein_id="ADN00989.1"
FT                   /translation="MSLRRYLFSSESVSEGHPDKIADQVSDAVLDACLAQDPESRVACE
FT                   VFTTTGMVLVGGEIASQARIDVQELVREVVKEIGYDRAEYGLDYRSMSVVNVLQKQSPD
FT                   IAQGVLEGIGLFKERGAGDQGMMFGFACDETPELMPMPIMCAHRLLQHAARLRKEGVIP
FT                   WLRPDAKSQVTVEYEGWTPKRITAVVLSHQHDDGLEYEEIRTVLIDQVIRPVLEPTGLL
FT                   DESTVYYINPTGRFVIGGPHGDTGLTGRKLMVDTYGGMARHGGGAFSGKDPTKVDRSAA
FT                   YMARYIAKNIVAAGLAKRCEIQVSYAIGVPRPVSIMVDTFGTGEVSDRALEEAIDGVFD
FT                   LSPEGIIRTLDLQRPLYRATAVYGHFGREEFPWERVDKVEEIRRAVGM"
FT   gene            13238..13825
FT                   /locus_tag="STHERM_c00140"
FT   CDS_pept        13238..13825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00990"
FT                   /db_xref="GOA:E0RTC4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC4"
FT                   /protein_id="ADN00990.1"
FT                   /translation="MCEVPFLGLLLYVGFVLIPFALRMPLRLEDFAVSARVEAPQVVVA
FT                   LEGEIIRRFKKGVEIAEKEGIPLVFIPCVLLEDNREYLEDVSASNPPFSIVIGAEGSAS
FT                   TYEDARITKSFLSERGLSKILIVTDWYHAWRTLLVFERVLGKEVEIGLELSSVPPTDDA
FT                   VRWYGVLWKERVKALAFHVSPFLYRLWEEDSP"
FT   gene            13840..15441
FT                   /locus_tag="STHERM_c00150"
FT   CDS_pept        13840..15441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00991"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC5"
FT                   /protein_id="ADN00991.1"
FT                   /translation="MVWLLVGVGFLGSASPGLDPADEIYTFLALCEGAGYVDHLPPLKP
FT                   YPETVLRELLSRVVDRSTGLVRERALQYLDQVGTETSIEGSGRIDLRMNASGEFFGIGG
FT                   GGIDARMYPASGVEILADWGLYLVDKQEGASLALARPPRRDLLMEGMALSSYETLQMDL
FT                   VADSSDFEIGERTYYVKQSIHSAVTLGSSDLFFQAGLMRSSYGVWDEEGIVISQDAPHA
FT                   PRFDLVWRTPWFTYTWLYMELVATDNEGAGSYRGKHLRLQGLSIPIFPWLSFGIWETVI
FT                   WGPEFDLYYFLPLSQLTYQQIYAGAPDNSLFGLSLAARLPHGIKAALEVYVDDAEFYDL
FT                   VEFNFNTLYKASLRAGLRWSAFTPFLAGISLDYLLITPYMYTHRDSDVNYLNYTHDGVN
FT                   LGPALPPNSDRIQVKAVLTPVSSLRWIPSLRFIRHGNASEGYENVEPGDGSIFDDGYTE
FT                   DGYPTFDAQPTRFLTQEVIEKTLQITQQLSYEVPAFHGVLELEGGYTYEYIWNVDLEEG
FT                   QEATNHYFWFGTRFSW"
FT   gene            15305..16453
FT                   /locus_tag="STHERM_c00160"
FT   CDS_pept        15305..16453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00160"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00992"
FT                   /db_xref="GOA:E0RTC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC6"
FT                   /protein_id="ADN00992.1"
FT                   /translation="MRFRPSTACWSWKAATRMSISGTWIWKRVRRRRTTISGSARGFPG
FT                   KSVVAICRSFGYSTYRMEGVTILVVEDEAVIALQVREELERLGISGVHTAYSGEEAVRL
FT                   AKQVLPDILIMDINLGAGIDGIEVARRLQEERFVPVIYLTAYSEPGLLMRAEETFPYAY
FT                   ILKPFHPHQLKVAVRMALSKYKKDRELFETRVWMKALLQNLHVPFVVVDVERRIRYVSS
FT                   GAEGFLLSQAKRIQGLPFSKAVPLFEETEDILHEPPFKEIIESKTRHRTRAVLLREDAR
FT                   RISVILDIAPFYSDRDEALGCLVFFQEEGGDEHPEPGGVPARPLLGSKKSLSSFLEVEI
FT                   IRLLLEHERSSSQEERAFLEGQRLAFETVLRYYTGKDVSLFN"
FT   gene            16471..17730
FT                   /locus_tag="STHERM_c00170"
FT   CDS_pept        16471..17730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00993"
FT                   /db_xref="GOA:E0RTC7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC7"
FT                   /protein_id="ADN00993.1"
FT                   /translation="MQRVLPFSKDQMERLIEEFPTPFHLYDERGIRETARRLYEAFDWV
FT                   PGGFKNFFAVKALPNPYILKILKEEGMGADCSSLPELVLAEKVGLSGEEIMFTSNNTPY
FT                   WEYQKAWELGARINLDDITHIPYLEAHVGIPEFICMRYNPGPLKKGNAIIGHPEESKYG
FT                   FTREQIIEGYRLLKEKGAKRFGLHTMVVSNELNVDYFEDTARLLFSLVAEVKEEVGVDI
FT                   EFINLGGGIGIPYRPDQEAVDLYELSRRIKAAYDEMIVRRGLYPAQIVMENGRMVTGPH
FT                   GFLITRAIHRKHTYKRFIGVDACMANLMRPGMYGAYHHITVLGKEDVPPSEVYDVVGSL
FT                   CENIDKFAIDRALPPIEPGDIIVIHDTGAHGHAMGFNYNGKLRSAEILLREDGSAVCIR
FT                   RAETVDDYFATLDFSGLDDF"
FT   gene            17830..18870
FT                   /locus_tag="STHERM_c00180"
FT   CDS_pept        17830..18870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00994"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC8"
FT                   /protein_id="ADN00994.1"
FT                   /translation="MEDSELTKEQLALYQKQLFDLRQLIEISKGLNTNLELETLIDSIL
FT                   YVCMGQLRVVKVGIFVRRGVGEHDFVLHRNYFGFDLVHDVEYRIPGEHPIISLLEKTSQ
FT                   PLTLEEMGRVISREEMERLPFYSLSIDLVVPLVAKGVLYGILILGDRIDGEPISQYEKR
FT                   YLMDLAGIASIALHNAFLYEMAVTDFLTHLKLRNYFDSMLADLMLVVEREQTPLSLIMA
FT                   DLDHFKRLNDTYGHLAGDKVLQEIARVIHFHTRKNDIAARYGGEEFAVLLPHTPLEAAV
FT                   GIADRIRIAVEHLEIPYGGAVMHITISLGVAQYDPRRDATPEDFIERADKALYMAKEKG
FT                   RNRVCV"
FT   gene            18910..19470
FT                   /locus_tag="STHERM_c00190"
FT   CDS_pept        18910..19470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00995"
FT                   /db_xref="GOA:E0RTC9"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTC9"
FT                   /protein_id="ADN00995.1"
FT                   /translation="MNEVKFLEAEVWTVARTEGGNAVLVRPKGSEKVVPIFIGQLEAQS
FT                   ILIGLGNVPMPRPLTHDLILNLFRELGVELLKVEICDLREATFYARLVLSHEGKTLVID
FT                   SRPSDALALAVRMHCPVYVADFVVQETAISVQIVGEEEEQAPDPRQLEVSRLEEELKKA
FT                   IENERYEEAARIRDRLRELRNSQ"
FT   gene            19490..21109
FT                   /locus_tag="STHERM_c00200"
FT   CDS_pept        19490..21109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00996"
FT                   /db_xref="GOA:E0RTD0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD0"
FT                   /protein_id="ADN00996.1"
FT                   /translation="MKADQGRHGVVLVKRLPLWFFHLSARYQRPVRSLREVPEEEVERI
FT                   SSRGITFLWLIGVWERSNASRRLKELMGKGDVLGSAYAITAYRVDPSAGTREDLLSLRR
FT                   RLHRYGIGLMVDVVPNHTAIDSDWVYGHPDWFISTREAPFPWYRFSGENLSSHPHIEIR
FT                   VEDGYYTRKDAAVVFERRDRRTGEVRYLYHGNDNQSVPWNDTAQLDYTRQDLREEMLRT
FT                   IRRVGEAADGIRFDAAMLLMRDQYRRLWFPAPGERTMVPSRERFSLGDEEFSALYPREF
FT                   WDEVEEVCLEFPHLFTVAEVFWGLQDACASRFFFDAVYDASFAAHVAAEENSRFQERLR
FT                   DLARRPERAGRMLFYLSSPDDLPPLMRYDPLRKYQGAVVFLTTLPGSILFTHGQWEGFR
FT                   EKYEMDGKSPGWEEGAELEAWHDETITPLLKERELFARPERWEVCRFSTEGGFVEDVFS
FT                   FFSQRGGRRHLVCYNNSGSPRNGMVLKEGGWGPPSGGGRRLSWYDRISGRRGGGDLHVV
FT                   EREGLPLALAPYQAVVLELSYE"
FT   gene            complement(21100..22749)
FT                   /gene="nadE"
FT                   /locus_tag="STHERM_c00210"
FT   CDS_pept        complement(21100..22749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="STHERM_c00210"
FT                   /product="probable glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="NAD(+)synthase [glutamine-hydrolyzing]"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00997"
FT                   /db_xref="GOA:E0RTD1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD1"
FT                   /protein_id="ADN00997.1"
FT                   /translation="MRIGLAQINPVIGDFSGNVKKICSFAMEAYRQKADLVIFPELALC
FT                   GYPPMDLLEHPSFVQENLRALRTLQHELPPELGVVVGYVEKNKSAAGKPLHNTAALIHQ
FT                   RRILLRQHKTLLPTYDVFDEARYFEPASERIVVPFKRRRLGIAICEDMWGETEPQPGLR
FT                   YPIDPIQDLLDQGAEIILIPSASPYYMEKVLLRAKIMELIGKGSGVPLVYVNMVGANDS
FT                   LIFDGQSLVTDREGRLVFRAPAFEEGLFLIDTEALPAPLPPLEVSRLEEVRGALHLGIR
FT                   DYLTKTGFDRVHLGLSGGIDSALVATLAVEALGPERVSAFLMPSQFSSEGSVHDAMALA
FT                   GNLGIQAHTLPIRAVFDTFLSTLEPVFQGLPWDITEENIQARIRGTILMAYSNKMRSLV
FT                   LTTGNKSELAVGYCTIYGDTAGALAVIGDLFKTQVYALARHIREDTGVIPEEILTKPPS
FT                   AELRPNQTDQDSLPPYEVLDQILELYLLRNLTAEDIIARGFDPDLVRHVLLMVVRAEHK
FT                   RRQTPPVLKISPRAFGTGRRIPIARAPYEPYS"
FT   gene            22788..23402
FT                   /locus_tag="STHERM_c00220"
FT   CDS_pept        22788..23402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00998"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD2"
FT                   /protein_id="ADN00998.1"
FT                   /translation="MLTTASEPLYYTDMGNLLIVSHFSGEAERLEARLRERGIDVFLAF
FT                   PGENVDEPCLPWKPSSPFSSKSLLLQVLQKGELERLVCLHRVHPESGGPLSFSEIEERV
FT                   DTCLKGWLFLLKEAAELTRKSEVVLVLDADGEGSSPLVPLLEAGFLSLLEVCRRMGIPA
FT                   RGLRREKATLDPLVDSILEGDGKSLYRWREIRERRRLWFSK"
FT   gene            23411..24634
FT                   /locus_tag="STHERM_c00230"
FT   CDS_pept        23411..24634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00230"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN00999"
FT                   /db_xref="GOA:E0RTD3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD3"
FT                   /protein_id="ADN00999.1"
FT                   /translation="MKIWLKILLAVLLGGALGLLLPLDDTTGEILSFVRDVVVGLGRLF
FT                   LLPLVATGVIIGTYELKREGRIGEILGRLFLVVCAVDIGVVLLALLSSGFLPLERIPIL
FT                   VEEVEPVEIPDIRSLLLSLVPMNFFEIFLSSGSFLLPVVLVGFSLGSIIPLDSYLTDPF
FT                   VDVVDAANRVFYLVNAFVVEILPFGFVGVVAHFLYSLRGETDLSLYGNLLGMIGVFGGI
FT                   LFLVLVLVSTVWIRRGTGRWFLHHLPALFLGLFPGDGYFPLGSLIRLGKENGGIPRKVG
FT                   ALAYPVGILFARAGSMGVMLISFTVLLSSYSSLGLSPLDYLWLAGMGLLFLPLFGALPG
FT                   SAVMVGLVMLSRLYGRGLDEAYLIFRPVFPLLVSMGTLLDVLCVSFLGETVAGLMGERE
FT                   PIPPERHI"
FT   gene            complement(24625..25248)
FT                   /locus_tag="STHERM_c00240"
FT   CDS_pept        complement(24625..25248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01000"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD4"
FT                   /protein_id="ADN01000.1"
FT                   /translation="MRSTRGILVAVVLLAGGGALSSLTLHSFELSDTIGIRLSSVDDAA
FT                   PPPVTHLLKGAVHLPLGEDLFLIPGISLWFGEYLFTGETAAPAELEAPDASLLMIPGLS
FT                   LELSYDLPLTRDLSAGMRGGILLQFPFAVRGYGEDPSASIMEYYYGGIRLLYLRIAPEL
FT                   VWRLSSFGLLVGPDIELPLFHVWDGEPFVHHLLVGLRLGLRFYM"
FT   gene            complement(25268..26701)
FT                   /gene="proS1"
FT                   /locus_tag="STHERM_c00250"
FT   CDS_pept        complement(25268..26701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS1"
FT                   /locus_tag="STHERM_c00250"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="ProRS; proline--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01001"
FT                   /db_xref="GOA:E0RTD5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD5"
FT                   /protein_id="ADN01001.1"
FT                   /translation="MAEQITPREVSYSDWFVDIVLKAQLADYSPVKGCMVIRPRGYAIW
FT                   EKIQSQLDRMFKETGHQNAYFPLLIPESFLHKEAEHVEGFSPELAVVTHGGGEALEEPL
FT                   VVRPTSETIIWSMYKKWIQSYRDLPLLINQWANVVRWEKRTRLFLRTTEFLWQEGHTAH
FT                   ATREEAEEEALRMLHVYREFAEEYLALPVFYGRKTESEKFAGAVTTYSIEAMMQDKKAL
FT                   QAGTSHFLGQNFAKAFDVTFQTQAGTLDYVWATSWGVSTRLIGAVIMAHSDDRGLVLPP
FT                   RIAPTQAVIIPIYTKKTVDQVADYAKRVFGRLAEAGLSVEMDLDDQNSPGWKFAEWELR
FT                   GVPIRVEVGPRDMEQEKAVLVRRDTGEKRAVSVSRLPEEIPVLLEEIQKTLFRRAKDFR
FT                   DEHTHYVEDYDSFKRIIEDGGFVFAPWSGSPDVEARIKEETKATIRVLEFGNEEKASGK
FT                   NDILTGEPARHIALFAKSY"
FT   gene            complement(26787..27470)
FT                   /locus_tag="STHERM_c00260"
FT   CDS_pept        complement(26787..27470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01002"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD6"
FT                   /protein_id="ADN01002.1"
FT                   /translation="MKRALLALVLSLIPLTLSAGDAAAFLNLGFSPDGRYFLFGVHGVE
FT                   EETSHPYAELYLVDVPRNEFVPAGIQRKTFAVSLLPGQESIGALLALLYDALPLVEKHR
FT                   IDHLRQGRLLYILLDGERPKEYLEFRDFYTSTLYRVTLIQTQRGSKETSEAAFHLQVVI
FT                   TGRDGKHRTYLVGRPNYYRKGVQEYRIRQVILAPDDVSLVFVIEKTIYAPTGPSIRYMV
FT                   ETITP"
FT   gene            27555..28349
FT                   /locus_tag="STHERM_c00270"
FT   CDS_pept        27555..28349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01003"
FT                   /db_xref="GOA:E0RTD7"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD7"
FT                   /protein_id="ADN01003.1"
FT                   /translation="MTLQQRNIVITGAQIALAAVFLVSVSIAVRVRGLEGVPGGDEALP
FT                   ILLSALLLSLSGFIGLQVVRYLFARSVSPEIYFFLLFLFSVGMGGVKALAWYAHRTGGP
FT                   LFLQVFAVRILYWSYFFGLASLGAASLYALGFPYPRVGRLSLGIGLAGALLAWTLPLSN
FT                   THFLAYAGLFPPLDLPSYGLLVGMLTMGTLAGFLTAYLVHAPRPLLQGTTGAFSMVAGY
FT                   TVVFYGWFEEGGLLLGLFFLITGMVLYGREHYRVTVTGAPRL"
FT   gene            complement(28346..28948)
FT                   /locus_tag="STHERM_c00280"
FT   CDS_pept        complement(28346..28948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00280"
FT                   /product="putative phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01004"
FT                   /db_xref="GOA:E0RTD8"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTD8"
FT                   /protein_id="ADN01004.1"
FT                   /translation="MISQYVLDRPVQQEVLRKSLHMSIALSPGVANTLGALPTIILLAL
FT                   GVTAYTLAEALRISGRRVGLISLITEWASRERDRDRFVLGPVTLGLGAMLALLLYPAPA
FT                   ATIAIYALAFGDGFASLMGRSLGGPRIPGTGGKTITGAFACFLAVYAAAFPLTRHPGEA
FT                   AAIALSATLLELVPVDDLDNILLPVGTGLIASIFFSS"
FT   gene            complement(29112..30212)
FT                   /gene="pfkA3"
FT                   /locus_tag="STHERM_c00290"
FT   CDS_pept        complement(29112..30212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA3"
FT                   /locus_tag="STHERM_c00290"
FT                   /product="6-phosphofructokinase 3"
FT                   /EC_number="2.7.1.11"
FT                   /note="phosphohexokinase 3; phosphofructokinase 3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01005"
FT                   /db_xref="GOA:E0RTD9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:E0RTD9"
FT                   /protein_id="ADN01005.1"
FT                   /translation="MKRPATRTFGILTSGGDCPGLNAAIRGVTKAAYWRYGMSIIGISH
FT                   GYRGLIEGDARLLHPRDFDGILTRGGTILGTSREKPFKPDPGEKDSEAGSRKVEAIIEN
FT                   YHKLHLDCLVVLGGNGTHKTAYLLQQAGLNVIGLPKTIDNDIWGTDVTFGFHSAVDIAT
FT                   EAIDRLHSTAHAHNRVMVIEVMGHKAGWLALYAGIAGGGDIILIPEIPYDLAHIVHHLQ
FT                   TRQQRGKEFSIVVVAEGALSREESLMSKEERKKRRKKNRFPTKGYEVAHLIQEATGMET
FT                   RVTVLGYLQRGGTPSPYDRLLATRFGTAAAELLYRGDYGKMVALRDGEVVAIPLGEVAE
FT                   KLKTVPPDHPLIDTARAVGTCFGDGV"
FT   gene            complement(30209..31432)
FT                   /locus_tag="STHERM_c00300"
FT   CDS_pept        complement(30209..31432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00300"
FT                   /product="GAF domain/HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01006"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE0"
FT                   /protein_id="ADN01006.1"
FT                   /translation="MNPEPQPSTEERGLSLLHLKDLDMLLETILRHARTITGADAGSIY
FT                   LREGNALKIAYSQNATLEKNLPPGRKLIYEIFALPISAKSIAGYVALTREPLIIEDVYQ
FT                   ISPEAPYRFEATMDKVAGYRTVSTLTIPLLTPQRDLLGVLQLINAKDTAGRIRTFTRVD
FT                   LEAVSQLCLAASYSLQQARMMRQIILRMIRMAQMRDPHETGAHVNRVAAYAVELYEAWA
FT                   ISHSVPLQEVIHTRDILRMSAMLHDAGKVAVPDSILKKPGPLTPEERSVMETHTWRGGE
FT                   LFIDRSSEFDQASFEIALTHHERWDGTGYPGVLDPATGELRLETRRPLAGEEIPLLGRI
FT                   VAIADTYDALTCRRCYKEAWEEEKALEEIQRLAGTAFDPSLVETFLSIHPNIQQIRKRY
FT                   PDPVMEAS"
FT   gene            complement(31476..32852)
FT                   /locus_tag="STHERM_c00310"
FT   CDS_pept        complement(31476..32852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00310"
FT                   /product="Na+/glutamate symporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01007"
FT                   /db_xref="GOA:E0RTE1"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE1"
FT                   /protein_id="ADN01007.1"
FT                   /translation="MNMDWTLPMDFAVISLLLLTATLLKRKVPLLRKLLFPNALIAGFI
FT                   GLLLGRDLLHLIEIPEERLGAYVYHLMAIGFIALALKERTQRDMPTIVRTGAFIVSGYL
FT                   LQGIIGLGLTLLLLPFIPHLFPAFGLLLPLGFGQGPGQAYSIGSRWEALGFPHGGNIGL
FT                   SIATIGFLWACLGGIVVLNILFGKEARKAVPDDEESPHLPGEVVEYDAPGDIPLTESID
FT                   RLSIQGALIGLVYLATYLTLKGVELLLEGTGTFGQTFSQLLWGFHFIVGSLYAIGLRLL
FT                   FNLFKRKGLMHRTYPNNYLLSRISAGAFDYMITASIVAISLDVFTANLLPILLITTTGG
FT                   LATVLFSLSVGRRIYHHHWKENATAVYGNITGTISTGLALIREVDPLFSSHAAENLVFG
FT                   SGVGLVMGLPLLVVLNLPVYGYLTGTPSLYWITMAILVLYFAGLLAFTFRNAARTRPTP
FT                   "
FT   gene            complement(32849..34030)
FT                   /locus_tag="STHERM_c00320"
FT   CDS_pept        complement(32849..34030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01008"
FT                   /db_xref="GOA:E0RTE2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE2"
FT                   /protein_id="ADN01008.1"
FT                   /translation="MRGLRLTSSPRRARLIFPVLKALGRGIGWFFHLSGEGLENLSALD
FT                   PPFLILANHASNLDPVFVNLFAPSLIRFVASDSLIRTPLSHMLFALMDVIPITKQVADT
FT                   GTLRGIFQARRDRRIISLFPEGHATWDGTTLPLTPGTARLVQALRVPVITATIRGAFLA
FT                   AGRWRRRAVRGPVSVRFHTPLSPDHLTPLPPPAVEDLLASRLAHDEWEAQKQDPLPLLG
FT                   PRAEYLERTLFLCPSCLSHGTLRSSLHTLSCTVCGLAVQVDPFGFLHGPIPFTTMKEWN
FT                   TWQRGTYPSLLSSLPEHSPILSAPASLLTGPLRTRPRLLTSGTLSLHRTHLRLTTPSGN
FT                   HALPLDRIRGLNIQKHERLEFLLGPTLHRIAFHDPRTSAYLWYFSLHLLKEHP"
FT   gene            complement(34027..34503)
FT                   /locus_tag="STHERM_c00330"
FT   CDS_pept        complement(34027..34503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01009"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE3"
FT                   /protein_id="ADN01009.1"
FT                   /translation="MSTLIVYYSHTGTTHEIAGILRNRLSCDIERISLQHPLPPRGWRL
FT                   YLLGGYQSIFRRRPPLNPLGKDPSLYDTVILGFPVWAGHLPSPMRSLLSSGTIHHRRCA
FT                   IFCSYAGNPGKALEEGVRLLEHHENRVVSIAGFREKMPSEDREQTILSWAETLQ"
FT   gene            34577..35971
FT                   /locus_tag="STHERM_c00340"
FT   CDS_pept        34577..35971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01010"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE4"
FT                   /protein_id="ADN01010.1"
FT                   /translation="MDSFRIGFVSGKLGDVDGVSLEVEKWIKVLQEMGHEVVTIAGKYR
FT                   APLTLIPEEHQVVFPEIRFDSPSQRHYERIFFPYLNKVPVYLTEEKLKGYVEECIREGL
FT                   EVGEHLFEKVKDFDLDVLIAENTNAMPMTLLGGVAVHHVATEKRVATIFHHHDFWWERS
FT                   RFSNNRIETFLNRIMPPSDIGLEHVVISSYAAHILTSIKRVSPHVVPNCEDFDHPVVLD
FT                   DYNSDFRQELGFSERDILVVQPTRIVRRKRIEDSIRLIAALLRAYPDLRGRVHYIISLY
FT                   QGDEPDVDYVDQIKALAEREGIPLHLIAERVSAVRGRDAEGRKLYTNRDVLVNADLVTY
FT                   LPLWEGFGNALLEAVAARVPVVTTTYLVYKTDIKLPGMRLIEVRDRYDEDGRLIIPDRT
FT                   VEEIHHVLTHPEERKVRVEETFQVARAEFGLHTLRKRLEKVFELYGDEIRASRKRLRKA
FT                   KRLYSV"
FT   gene            complement(35959..36933)
FT                   /gene="lgt"
FT                   /locus_tag="STHERM_c00350"
FT   CDS_pept        complement(35959..36933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="STHERM_c00350"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01011"
FT                   /db_xref="GOA:E0RTE5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE5"
FT                   /protein_id="ADN01011.1"
FT                   /translation="MAYVFYPSWLSPEIIPGLPFRWYSLMYLVAFAIAYVLMAHQVRER
FT                   RLPVTTDELLNFFFWGIVGLLLGARIFAALVYDPSGTYLRNPLLIFWPFDEHGRFVGLR
FT                   GMSYHGGLIGGTLGVLLYCLRHKKDVLEWGDMLTASIPLGYTFGRLGNFINGELYGRVS
FT                   ALPWAMIFPEAERFPAKESWVQEFAQRTGFPLPSSNVLVNLPRHPSQLYEAFFEGIVLW
FT                   ALLWFLVRPRRPFKGAVLAWYLVGYGGFRFVLEYFRQPDAGIGFPLMLEPSKANPHLLL
FT                   SPFNFTTGQILSFFMVLAGVILLLVLPRMQGRTRRKGTASHTE"
FT   gene            complement(36957..39923)
FT                   /locus_tag="STHERM_c00360"
FT   CDS_pept        complement(36957..39923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00360"
FT                   /product="polymerase most proteins contain PALM domain HD
FT                   hydrolase domain and Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01012"
FT                   /db_xref="GOA:E0RTE6"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE6"
FT                   /protein_id="ADN01012.1"
FT                   /translation="MTTQKLTVTGKAQITIDEQRLRVSLVFTKGEDGDPLWNVATLKEV
FT                   LEQHGLEGKVPEQRLREALRRIAQSNDHIVTLTLLEGIPPEKPVPETVTWAKDLSIPPE
FT                   MEKDIEKVLAKAPPPEIYRELQETVKEEKEVLKKAALPFLPPKKEKITVTHKKTRREKV
FT                   YVDPTVRSSFYVEEGKKLGVVSPAVPGLPGQDIFGEEIPPTVLADPSFYPGEGIRKERN
FT                   ELVALTTGILRVGRNWADIIPFRPHRWEVELSPDKASCFLSLYPGTEDAQFPDVSLIIQ
FT                   KVVTLGYPEERLLSPEEIQELIRLAIVRRSPLERVPISKDRDASFSIHISEDKLLATLT
FT                   IRKGAGRGKPLNLKEVGKAIKESGLKPLDYKKIGEDILAFYHSPELELKDYVLVKGTPP
FT                   QKGADRTLEPSVHYLPDEEAKAIKEKTATVVEAYKGIPSIVEFSLQEVEKLAYVEKDQP
FT                   IFLISPATPGQPGTDVFGNQIPGLPGDTPPLVIHENIEEKGNLLIATIQGIMEQGEKDG
FT                   VLHLRVRPHRDARILVETSPDDMEAYLTLEEGVGTGRKLTFEDILKAIREEGVVKGVDE
FT                   GLVKEALRRAQEEGEVRRALVARGKEPVAGGQRRIEFLVPLPSGKPFKEGPSGQVNFKE
FT                   QDRYTVVDEGQPIARIFPPAQLPEEGWDLRGRVRKPLQTRPSEITTGEGVREEPQEDGT
FT                   ILLLSTQRGVLSYAGGRIDILSRQVIKGDVDLSTGNLRLTGDITVKGSVRSGFYVITTG
FT                   SILVEEGVEAALLSAGKSVIIKQGIKGGGKAVVRAKEDISARFAEHTRLLAVGDIHLGT
FT                   ACYRSLVKCNGRLLVGPEKGVLLGGKVKSRLGVEVGTLGSEKGLRTEVSFGQDYLIEDQ
FT                   IEIEEQEITKLKQQIVQLDNEIQRLARNGNPGKRQELHARKFRLLKIMEKRSFRLFTLR
FT                   ERFEQHFESSIIVHGTIHPGVVIESHGRIHEIRSPQRAVRITFDPQSGRIEINPLASS"
FT   gene            complement(39932..41086)
FT                   /gene="fleN1"
FT                   /locus_tag="STHERM_c00370"
FT   CDS_pept        complement(39932..41086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fleN1"
FT                   /locus_tag="STHERM_c00370"
FT                   /product="putative flagellar synthesis regulator FleN"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE7"
FT                   /protein_id="ADN01013.1"
FT                   /translation="MHIFPIASGKGGVGKSLIATNLAIALAQAGKEVVLVDLDLGGSNL
FT                   HLMLGIPAPRGIGSFLTTPGLSFQDIVGPTQYERLRFVPGDAEIPGVANLTAGQKKKLL
FT                   SHLRKLHADYLIIDLGAGTHINTLDFFLMSNNGIIVTTPTPTATVNAYLFLKNVIFRLL
FT                   YLSCKRGSEGYQYLKRLEKEGKAFQELYLPKLAELIKEVDPESYEQFTRSLSSFHPRLI
FT                   LNMLEQPQDTVRAQRLRRSCQQYLGIDIEHLGIIYRDDLQDIALSSKLPILVYKPDSVL
FT                   SQAVYRIADKLLQIGEEETSLLDIEEIDESFQEADVEAQIDFENKMEYVEELLHTGTLT
FT                   MGDLVETVKMQQMEINRLRKENQFLKAQLVKAIQNGFLPETRGK"
FT   gene            complement(41068..41490)
FT                   /locus_tag="STHERM_c00380"
FT   CDS_pept        complement(41068..41490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01014"
FT                   /db_xref="GOA:E0RTE8"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE8"
FT                   /protein_id="ADN01014.1"
FT                   /translation="MMRKIFFLFAALWEMIRFAFLFLILQAPMRIEAGRALILLWLSGP
FT                   ALLLALQAFASLFERPAQGARRLHLSGKLLQVLMGLALFLSTLLSTPVIPPLFIIATTG
FT                   IDALIFLGLLLDRSSVPPSHGTTPLQEKDEPCTSSP"
FT   gene            41601..43010
FT                   /gene="ctp"
FT                   /locus_tag="STHERM_c00390"
FT   CDS_pept        41601..43010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="STHERM_c00390"
FT                   /product="carboxy-terminal-processing protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /note="C-terminal-processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01015"
FT                   /db_xref="GOA:E0RTE9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTE9"
FT                   /protein_id="ADN01015.1"
FT                   /translation="MMKKGDVRLRGIWWGGFLLLFGFLMSLVWADGLFALDRSTDQLLS
FT                   LFESVFSYVQDHYVEEPDPEVLLEGALEGLFESLDDPYSEYLSEEELRDLSDTTRGEFG
FT                   GIGLYIAKETANGGDAGYVDVVAPIEGTPAYRAGILAGDKIIGIEGESTMDLSIDEVLS
FT                   RLRGEPGTQVTITIKRGGDYVFDVTLTRAIIEVPTVRYEFLPEHKVGILRIIQFTPHTP
FT                   EKVEEAISAFKARGYRGLLIDVRSNPGGLLDSVLEITDFFFREGIMLREEGRTSEATRT
FT                   YYATGDLLVDEDIPVVVLVNRGTASAAEILSGVLKDRGRGTLVGETTYGKGSVQQVQLL
FT                   PRGGFRLTVARYYTPSGVVIDRHGIEPDVKVEEETFTEEQTALYGELLSSGRITEFVVS
FT                   HDVAPSEEAIGSFISRLVAERPEYDPDILRRLIHAEVVRRSTHPPLYDPDYDRVMEEGM
FT                   RILLGLMGGET"
FT   gene            43011..43406
FT                   /locus_tag="STHERM_c00400"
FT   CDS_pept        43011..43406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00400"
FT                   /product="automatic annotation"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01016"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTF0"
FT                   /protein_id="ADN01016.1"
FT                   /translation="MERISVRTGERVQVVLITREVQEIVARSGVEEGICVVYSPHTTAG
FT                   ITINEAADPSVIRDFLMETGKIVPFQDGYAHAEGNSAAHIKTSLVGPSVTIPVEGGTLA
FT                   LGTWQGIYFCEFDGPRTRKVFVQIIGR"
FT   gene            43431..44207
FT                   /locus_tag="STHERM_c00410"
FT   CDS_pept        43431..44207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00410"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01017"
FT                   /db_xref="GOA:E0RTF1"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTF1"
FT                   /protein_id="ADN01017.1"
FT                   /translation="MTAATNIPWKKRIRILGIPVDRVEDADLERVFHHFLLDGRLHHIV
FT                   FARRSDCMRARRSKRKRRILEEASLVLPLDRSLVWAARRLHQEAPVRYLPFSFIVRLLR
FT                   FLEEKGERVYLLGESPQDILTIERNIRETFPGLRVVGRYHGNFPKEVEETILTAVKKAT
FT                   PALILIGSGIRGGDEWVSQHRAELPPAMVIVHPETMQVFAGRRKRVAPEEFYGRIPPLK
FT                   GFILNPLRILKVFYYLWFALLVMVYKVFGLNKSRDD"
FT   gene            44200..45336
FT                   /locus_tag="STHERM_c00420"
FT   CDS_pept        44200..45336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00420"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01018"
FT                   /db_xref="GOA:E0RTW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW2"
FT                   /protein_id="ADN01018.1"
FT                   /translation="MIKVALIDMKGGSEDFFRLLLPEDVSMVLVDEAAVKVRLGDERPD
FT                   AVILVHGAGDEWQGVARTLGDVFPHIPLILCSPDPSPHTVVRGMDLGAVDYLPFPPERD
FT                   ALHRALQRALRCKGYSSPAVEDRSPLERLVGKSESIVKIREYISVVARVKETVLIQGPT
FT                   GTGKELVARILHDLSPRREMPFVAVNCGALPPSLIEAELFGTEEGAYTDARRRPGLFEQ
FT                   ADGGTLFLDEVGELPADLQVKFLRVLEEGSVVRVGGHRSIRVDVRVVCATHRDLAGEVK
FT                   RGRFRADLFYRINVLKISIPPLTDRKEDIPLLASYFTRMLADQYGCPARISSGAMDRLL
FT                   SYDWPGNVRELKNVLTRAVLEARFRGLEMITPDLVRFE"
FT   gene            complement(45337..45798)
FT                   /locus_tag="STHERM_c00430"
FT   CDS_pept        complement(45337..45798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01019"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW3"
FT                   /protein_id="ADN01019.1"
FT                   /translation="MKRLFLLYMTLGTLLWAYDPVDGVRFDLTLEDLIGTLPEGKEEVS
FT                   GYYLVLDGIIGSVEVLDPGEGESFTARLELVSGAWLSEEEVALYRADVILKGAEFRSRI
FT                   PLSRRDPILPESLIERRRIIVLCRLIDVESSPDGTPVPVLLAKAVRVIR"
FT   gene            45838..46593
FT                   /locus_tag="STHERM_c00440"
FT   CDS_pept        45838..46593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01020"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW4"
FT                   /protein_id="ADN01020.1"
FT                   /translation="MRRSSVRKDRKELGGKRALVVGGSGGIGRGVSLMLAEEGASLVVH
FT                   GGHDEARLEETRALCARTAEEVDGFLCPFDQGDVFLKEVASRLPFDIVVWCAGPVEYVG
FT                   LGEASLEVWERMARGNLVLPGAVVGMVAGLMAERGHGRIVLFGGPGSDALRGYTSIAPY
FT                   AAAKAGLGVLAKSVAVAYGSSNVACNVICPGIVFTEYTSREERERWREVPEARIASAEE
FT                   VVDLVRYLVKMPTPLVNGAVISADKGLRL"
FT   gene            46682..47233
FT                   /locus_tag="STHERM_c00450"
FT   CDS_pept        46682..47233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00450"
FT                   /product="anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01021"
FT                   /db_xref="GOA:E0RTW5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW5"
FT                   /protein_id="ADN01021.1"
FT                   /translation="MANNDIIPGFDEEKDESLKIRLQKVDSVPGCLILFLTGYIDTYNS
FT                   NFFQKKVTRAIEQGYIRLIFHCGGLNYVSSTGIGSFTAFLKAVKPRGGDIVLLEIQPKV
FT                   YEVFQLLGFSQFFTIKDNLEEAVAHFSEGGQKVQTEIFPKIFKCPICSKKLKATRPGRF
FT                   RCSECKTILAIDNNGQVFLG"
FT   gene            47245..47940
FT                   /locus_tag="STHERM_c00460"
FT   CDS_pept        47245..47940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00460"
FT                   /product="phage shock protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01022"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW6"
FT                   /protein_id="ADN01022.1"
FT                   /translation="MGFFQRLVRAVKAQFNALLKRIEDPEKLLDQLLLDMNKQLLEAKR
FT                   SVAQALADEKRLEKRVSEYAAQVEDWEQKAVTALKAGREDLAKQALVKKAELLEVLEQY
FT                   RKSHEEQHATVEKLKASLRDLQDRIEDARRKRNILIARAKRVQAQKRLQETIKGLSDTS
FT                   AFAAFEELEKRVEELEAEAEATEALEAEDTTLSLEEQIRKLEKPEDKADVLLEDLKKRL
FT                   GLPHDSSGS"
FT   gene            48077..48562
FT                   /locus_tag="STHERM_c00470"
FT   CDS_pept        48077..48562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01023"
FT                   /db_xref="GOA:E0RTW7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW7"
FT                   /protein_id="ADN01023.1"
FT                   /translation="MVSLPWKDFLSISLETGEGGPVWIPYGPADYVAQAFALGCGDYLK
FT                   EPWSVGELLVRARRFLPQRVVLRGKVCEYRNGVLRREGKEVRLTPVQGQLFSLLVRHRG
FT                   KPLGREALSHAVGMRNGSSRAVDMHVSLLRKKLAELDLEGVLVSVIRKGYMLIDEDR"
FT   gene            48559..49548
FT                   /locus_tag="STHERM_c00480"
FT   CDS_pept        48559..49548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01024"
FT                   /db_xref="GOA:E0RTW8"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW8"
FT                   /protein_id="ADN01024.1"
FT                   /translation="MKETGMRDSLFLPVYYVGWLLVILLLGVVSWGMASWGLADGVYVT
FT                   VDGKSTVLPFFLKALRALGPSAGILALIISLSRVFVRPGVLFLSILELALLMTGYLYLW
FT                   YAFVVPPLEEGVAALEWRYTSPVSSQALVRTAEDRYLFVYASGRFDAGVVDVWFEREPV
FT                   VRLFPEGWFDEETGRYVLGERESIDLSRGYDAAVLAPIPGWASVWEEVTLALEGVWDQA
FT                   FSMGAPRSLLFLGSWFLFSIGMWTWVRFTRWPFFNTILAVGMGMAPGLFMWGVKRFTEE
FT                   PLFVEVASRIPVSFDYVVLAIPAFIGVCGLLFLLFLLPYARLREEVAW"
FT   gene            49542..51224
FT                   /locus_tag="STHERM_c00490"
FT   CDS_pept        49542..51224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01025"
FT                   /db_xref="GOA:E0RTW9"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTW9"
FT                   /protein_id="ADN01025.1"
FT                   /translation="MVSPVGRIVRGLFVCYLVSFVLVMGWAYVMGKAEAPVHPLLAASW
FT                   RLYEGVADWLGGFLFFHLLSVVLVVGFFSSRYLLVQQDVRDRFRILQGLLVFVVVEAGA
FT                   YLLLQEGVKPLVIRNARHLEYRTRLAEEFLEVYERAKERGDGATMLQALRSYTRLIPSD
FT                   ESYREELRTLERERPTVEEAGEEEGFPAVPHNLSAGEALRLAEEAFQKEDAYTAYYYAR
FT                   LAHAIEPSLVEARRLQAKAWDAILREEETASSRKDKDFFAAKRQAYERLMEGDYLGAYY
FT                   AFMRLREERPRDADVVRYYEEAREQVESYAFYYEEIANLSDVGGIPRVFFARRGDDRVD
FT                   FFYLERVIRVAEGTYGFGVEVTGVGREGSLVYRLRAPYAKIERGILVLHCVGRSDRSVR
FT                   FLPEREGEVPYDPAFLVPVGLDVDQLLLLGGTGWEGRTLSELFQLVWLPDRVLLPRGEI
FT                   TTLIYIRIYRAVLFLIGSFLVLALAWRGRYRAARRSWGLLVVGGPLVAAAVWWGADMMD
FT                   KGGARLIAAAMALGGSGAAVAVLVVGSAVLLGLSLLLLVRAMR"
FT   gene            51258..52310
FT                   /gene="capI"
FT                   /locus_tag="STHERM_c00500"
FT   CDS_pept        51258..52310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capI"
FT                   /locus_tag="STHERM_c00500"
FT                   /product="protein CapI"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01026"
FT                   /db_xref="GOA:E0RTX0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX0"
FT                   /protein_id="ADN01026.1"
FT                   /translation="MRFLVTGSAGFVGFHLVDFLLRKGHEVVGIDNLSPYYDVGLKKAR
FT                   LAEHGIVVGERGEGMRSRIWEGYIFYFEDVRDRVFLETLLRRHGVERVIHLAAQAGVRY
FT                   SLTHPEVYLQSNIEGFWAVLEASRRCGVERLVYASTSSVYGLNEKVPFSERDGVDHPVS
FT                   LYAATKRSNELFAHVYSHIYGLPTIGLRFFTVYGPWGRPDMAYFSFTERILKGEPIEVF
FT                   NHGHMERDFTYVEDVVEGVARVAEHPLPERRDWDPGDPRPDRSSAPFWVYNIGHGSPVG
FT                   LMDFIRAIEEALGREARIVYREMQPGDVVATHASTKSLEEAVGYRPSTPLSEGIRRFVA
FT                   WYCSYYGIER"
FT   gene            complement(52311..53585)
FT                   /locus_tag="STHERM_c00510"
FT   CDS_pept        complement(52311..53585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01027"
FT                   /db_xref="GOA:E0RTX1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX1"
FT                   /protein_id="ADN01027.1"
FT                   /translation="MRYRIEGGFPLKGTILAKGNKNAALPCIAACLLTDEAVVLENVPD
FT                   IQDVRVMLDIVQYLGVQVTRLRKDSYRLKTTDIVTSEIPQEKAKLIRASILFAGPLLAR
FT                   TGKAVLSPPGGDVIGRRRLDTHFLALSALGARVEIDGVFRLTAHRLVGDEIFLDEASVT
FT                   ATENAIMAAVLAEGTTVIRNAASEPHVQDLCHMLNQMGAQISGIGSNVLTIEGVERLSG
FT                   TTFAIGSDYMEVGSFIGLAAVTRGDVVIENADPQHLRMTKLAFGKLGIYWEQEGRTIHV
FT                   PAGQSLKVVPDLGGAIPKIDDAPWPGFPADLTSIMTVVATQAEGTILIHEKMFESRMFF
FT                   VDKLIEMGARIILCDPHRAVVSGPSRLRGSELTSPDVRAGMAMVIAALCAEGESLIHNV
FT                   YQIERGYEDLVERLQNLGARIRKES"
FT   gene            complement(53597..54640)
FT                   /locus_tag="STHERM_c00520"
FT   CDS_pept        complement(53597..54640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01028"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX2"
FT                   /protein_id="ADN01028.1"
FT                   /translation="MHYRGRTALKTKKYAILACALLWASCRTPAPSPPIAPPPSPALPT
FT                   PAEKPLPSLPPDLFPVHGKDDRPVAAFRSDTGEALILCTPGAPYRWEELSDINRIYQSE
FT                   DLPELAIAWVTEQGLERIPLGRYPVLKEARPLTLASPRRGIALLLTCLKPQKIVHLLVS
FT                   SGGNGLPSIDTFFTTPSMTTSFQDLDTDGTIDVLVTETVREEGVGRETYLSWYTWNGIR
FT                   FSLERSLGIVRSLKAFFSKAGRLIRNGPDPFLSYACVPEAETLEDIFLAEGGDTLGLHG
FT                   IRGITFPEISENPFPDGGRPGEKILVPVRIETGEGSFVATAFLGLKTFPFQDPPFEFLI
FT                   DRPPTNP"
FT   gene            54729..56111
FT                   /gene="thrA"
FT                   /locus_tag="STHERM_c00530"
FT   CDS_pept        54729..56111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="STHERM_c00530"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01029"
FT                   /db_xref="GOA:E0RTX3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX3"
FT                   /protein_id="ADN01029.1"
FT                   /translation="MKVMKFGGSSVADGPKIAHVVELVRKAREREPVAVVLSAMKGVTD
FT                   LLLSMARKAESGDPSYREDLSSLTARQKETLSSLMGDGTQAGAAWDAVSALLEDLSSIL
FT                   HGIELVRECSRRSLDLVASFGERLNCTLVTRYLLSLGERAEYVDAREVVLTDDSFGSAV
FT                   VQFEETYGRIRERLAGDAIYVVTGFIGATREGVTTTLGRNGSDYSAAIVGAGVGAEEVE
FT                   IWTDVDGVMSADPRVVPEAFVLEEVSFQEAMELSYFGAKVIHPYTMIPAVERDIPIVIK
FT                   NTMNPGFPGTRIVKHPKPHPWPITGIASIPGVALINIEGSGMMGVPGIAARVFSALAEA
FT                   KVNIIMISQASSEHSICVVCRKEEVDRALDALERSLEPERRARIISDFECIRDLEIIAI
FT                   VGENMRGTPGLAGRLFQAVGERGINVHAIAQGSSERNLSFVVDEERGQEAVRVIHKAFF
FT                   GR"
FT   gene            56120..57427
FT                   /gene="thrC"
FT                   /locus_tag="STHERM_c00540"
FT   CDS_pept        56120..57427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="STHERM_c00540"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01030"
FT                   /db_xref="GOA:E0RTX4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX4"
FT                   /protein_id="ADN01030.1"
FT                   /translation="MRFVSTRNPKDVVSFEEAVFRGLAPDGGLYHPVERLDLAPLYERL
FT                   GPEKGFVDVSYEMVRLLFGDEFSEEEAGRLVERAFPFSPVLRELTDSILLLELFHGPSC
FT                   AFKDFGASFLASCMEVFLSRREGRAVILTATSGDTGSAVAQAFHGRRHIDVVILYPSGR
FT                   VSPLQEKQLTTLGGNVHALEVAGSFDDCQRMVKEAFLDQELSERCPLTSANSINLGRLV
FT                   PQSFYYVWAYAQLKARGERPFFCVPSGNFGNLTAGVYAWWWGMPVRGFLAATNVNDVVP
FT                   EYLSTGVFTPRSSVRTLSNAMDVGNPSNFERLLALFEGDHRRMAAVIRGERVTDEETLD
FT                   TIARYWRERGVFLDPHTAVGVKASERLLERERGVAPVVTLATAHPGKFLEVVEEALGIR
FT                   PPLPPQLEEVLAKEKRAVKIPNTLEALKSFLLDLWG"
FT   gene            complement(57429..58511)
FT                   /locus_tag="STHERM_c00550"
FT   CDS_pept        complement(57429..58511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01031"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX5"
FT                   /protein_id="ADN01031.1"
FT                   /translation="MNPQDVLASLHRAGHRPRLAGYSALDRYFKVKGTPTHLWIQSTAE
FT                   LVDLARLFEGLEYPGLEGVEAALSLEDTRIYFLTPHTPPPHPLLALTHDPSRDAFQAPD
FT                   ALYPLLRSPTLALSTPFTLTDALTCAVLLSRYPYTPPPTLPTLMPSPRPAIETQAATLS
FT                   LILTGQTPWHGLALLSRTEALPRLWPPLARLRDVHHVKDYHPEGSVWEHTLEALKHRKR
FT                   PDLLLSLAILLHDIGKPDAVPHGTNRFHLHANIGARIARTFLRDLGFPSSLQDDVAFLV
FT                   RYHMLPGALPRIPPQSIAEILSSPLFPVLLELYRCDLSSTFRGPQPYYQACRAYRSFLK
FT                   ARRNPFRDPRLRRLIKLYVE"
FT   gene            complement(58527..60311)
FT                   /locus_tag="STHERM_c00560"
FT   CDS_pept        complement(58527..60311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01032"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR032533"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX6"
FT                   /protein_id="ADN01032.1"
FT                   /translation="MKDWRAILEPLAAEAPIPPDPSSLPSRPLAPTERAALEAQGNRAE
FT                   NWEAIRVHPSFTPRGIWYSTFRGSCYLGLFEPSDHDLFPEGIYHSVIRHTVVCSHARIH
FT                   HCPLLSSLYIDEGAEVIHTTSHTPSPFSAGLLPTISPGIETGGREITPCDVLTPDLAIA
FT                   LTTRPLPGGLEEAYANFLTHYRDTTLFPFSYIGPKAHVAHCSTLSSVYIGSHAAVTGSS
FT                   LTHVTIHSSEEAPTLVGEHTTLQEAILQEGVHVTTGAVVRRSLLMEATGAEDHGKIEGS
FT                   IVLPNTHIAKGEVTASLVGPFVGFHHQSLLIAAWWPEGKGNIAYGANVGSNHTSRQPDQ
FT                   EIWPGEGMFFGLGCSIKFPAHFRDAPYTTIATAVMTMPQRMEYPFSLITQPISYPSEVP
FT                   TAYNQLMPGWMLTGNAYGLFRSEEKFRTRNKARRYRPEFEIFRPRILFLMDRALDRLSS
FT                   IGSPRPFYLPEHLPGIGKNYVTEEDRLGALEGYRLFLEYGILRILLGLSSCEDATWHNE
FT                   IQPLVEKYHLPEQREAQIPRYLELLDAVWDRIEGSRHKDAVRGRRIIDDYLTTHPEEDA
FT                   VLSTLRKRFDEERNRLTH"
FT   gene            60383..60823
FT                   /locus_tag="STHERM_c00570"
FT   CDS_pept        60383..60823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01033"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX7"
FT                   /protein_id="ADN01033.1"
FT                   /translation="MGIGALRVWWESQGEGWGREGVVERWGKVWRVGVGYGVCTNEVGY
FT                   EKSMLHSIEVLGGGGWHWGSRVVMCEVHVEALVRVDVLVHEEKYGDTERIVSVVVGPGM
FT                   GVDAWYEVGGGWQVGVSVGGEVVSYADPWWGMRMGIGVRCSL"
FT   gene            60869..61690
FT                   /locus_tag="STHERM_c00580"
FT   CDS_pept        60869..61690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01034"
FT                   /db_xref="GOA:E0RTX8"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX8"
FT                   /protein_id="ADN01034.1"
FT                   /translation="MHTSKGDGWRKVRKLRFWRYGPVLLLVVVSGGCVEGGLSVFTEVW
FT                   SDPGPCEVEVESFVEEYAVYVEWEEDPGADEYILECAEDGLGEKVFKEVYRGKGTSYWH
FT                   RWLEGEGRYYYRLLKVRGERVFGPGRDRMGVAGVVRQDGDEPNDRKESAKELSFERRTV
FT                   VGNAWYYRGSDGQEVRDLDWYKVKVPGGWSAQVKFFQEGINQGDQTDFIGGVEGELPHR
FT                   LVQEETLLLENTTTEDRYIYLCIRPDEEEFLGGGVVGGKVEDYMLQLLDVQ"
FT   gene            61680..62345
FT                   /locus_tag="STHERM_c00590"
FT   CDS_pept        61680..62345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01035"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTX9"
FT                   /protein_id="ADN01035.1"
FT                   /translation="MCNDMGVHMRYRDVVLSIGLGLVLMGCAQLWEGGWDGVVGGGGIE
FT                   EREDLFVEGEDGWVVFETNDPDDWGSAGVTMWAGVGEEDPFEGWEVEVVKECGDGAAGY
FT                   GVVFNEGEEGGDEVMYVVLITIEGEYIVGEVVDGVFEAFEGWKQSSAIERGYGQVNRLG
FT                   VSRDGDGYVVRCNGADVTRMEDDEPPVRTGGRYGYIVVISPEDEFPEVGVRVKFREVK"
FT   gene            62455..62766
FT                   /locus_tag="STHERM_c00600"
FT   CDS_pept        62455..62766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01036"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY0"
FT                   /protein_id="ADN01036.1"
FT                   /translation="MWGGGEGEEGVLGEGVVGPGGGVVVGWGGVEVRVPEGAVRGEVEV
FT                   RIEPLWEVEEVGEWRENVTGGAAGYRFYPDGIVFEEPVEVVIPVEEGVGGGGTGVLLR"
FT   gene            62750..65638
FT                   /locus_tag="STHERM_c00610"
FT   CDS_pept        62750..65638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01037"
FT                   /db_xref="GOA:E0RTY1"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY1"
FT                   /protein_id="ADN01037.1"
FT                   /translation="MYYYDEWRGRWRLVGKGEAEGGRVVVETRHFTDMVAAVLKVPEGV
FT                   EPLEVDINAVKGVGVGEVEGGVVEVGVGGVGGMGWEGVRVPLWVPEGRRGMRPELEVRY
FT                   VGKGWGNVGEGWWLKVGEVKRSDRWGVPRYEGGDRIELEGEELVEVGGGEWRRRREGGG
FT                   YEEVEYYDQRDEWEVRRKDGVVVRYGGNGGKVEGGGGTYIWYKSKEEDAYGNRVEWLYE
FT                   RDEWGGVYLAEVRYVGWGAEEGAYRVEVEWEGRGDVRVDGRGGKGVKWAKRLKEVVVEV
FT                   EGEEVVRYWCEYEENVFGASELKAVVVGRGGEEWYRYEMGYEGLTDVDGDGAYEGFVEE
FT                   EWGGVGEGVGGRVTERWSWGMGMDLTVEAVLYGLKWKPLWEIERTPVASVGASMGFSVG
FT                   GGWVEQAVVDINGDGKVDVVRVGRGGVLEVWYNTGGGFEGPHEDAGVGSGIGDEDQWEM
FT                   SVGAWAGVGPVNVGGLWSWGKTRRGSGFVDVDGDGLVDIVEAGRGEYWKNTGGGFERRA
FT                   LEGEVGGEEGGGEEGKVYYWEEVVRKWEVLRSGVVEVRVGVEEVEPEVGGVVGEVWKRG
FT                   KRGVEKVGEVGVGEELVKEVRVEVGEELVWAVVVKGEEVPVGVKVKVPIEVRYRKVKLY
FT                   EDVGWRGEEYVAPVGWQEWMGSYEDEKNPWLKVYQVVRDDEGTVVGVVRRGNWEEGLRE
FT                   IVEGDKGEEVRAGLREHLWVIPKEVRFVEMKEVVESYGDEEVTVKEAGGGEVDVKKGAY
FT                   MMACYAYEEGRATMAYREGEEEVVVVGEDGNEVRCELDPDVVVRLWREWYGGQVEKLKA
FT                   VVGYRIGDGYEWRWVEEEGGRKYVGYGGRYGEENGKWDGGEGDEGGGRLVVAEGEWGKV
FT                   WVEEEGGRWKGYEERGGEVEELGEVGVRRGDGWVEVEIERGGWSEAYRWEGEGGAVPIE
FT                   EGAYEALLWEEVGGGEVWGGGVRSFRRRCMSS"
FT   gene            65590..70695
FT                   /locus_tag="STHERM_c00620"
FT   CDS_pept        65590..70695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00620"
FT                   /product="YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01038"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY2"
FT                   /protein_id="ADN01038.1"
FT                   /translation="MGRGCEELSEEMYEQLSDEQKGWYEEEGGRYVLKEGVGEEEYEAV
FT                   VAALGSVGWEEEGVVVKCGDEWRVVKVDAGEKEEFLRYVEEEVGSGGREWFEEADEGWV
FT                   YVRRGLGGEERALLERVVRMYLLERRSEYYERVKEEGVWKVRAGEEEAAAKWLKGLGVV
FT                   AWKEGSGEVRYYADGEWEVGEEVVGREDEDWGWCEGMWGGVRRGLVVEVPVWKGGWREV
FT                   EERVVHLFSDEDLSEEDVFGVGGGGEEVAAYEGEVFRGGKYGWTYGIWNGFYEFDASKV
FT                   SREALESQGQSGGEALPYIVTMDPNREGDEVRLKYFGKTEGGDVEEVEEEAKWVGPVSM
FT                   REGAEFVEEDGQKKMRKVVYTYASYLGEGGVVRLVRHGGDAYEVTRGGGGGGFPPLAVS
FT                   ATGGQKTYVNGVSMQEGWGKQERVVMDVNGDRYPDHLTVREDGEVEVVWGTGSGFGMKE
FT                   VIGRVGLVEGEGTVGWHRNRGWSAPIGGMSWGGGERTVPSIFLAVDSRGIVRKVVPKVE
FT                   DAGGGISVQLSVGVSDEEAGLVDLTGDGLPDWVGEGGEGYRVRVGEGYGWGEEETWEGG
FT                   TKESEKGIFGRGLEEVVGVEGGLGSSVSATVGGAVGLSYTYGIYSVSGTVSISGTQHRS
FT                   EEGLYDLTGDGLPDLVRKEAGSDRFLVWVNLGDRFAEEPVALTVPGSWADPLSGVLESA
FT                   AEAVVSCFEDETIRGAIESTIGDALDAAFTWAADVIGAVNPFVVQDALTERKGYTLSVG
FT                   VEGSVGADLFVAEVTVSLGLDGNLGSDGVSVEMVDIDGDGAVDHVLKVPGQPLEVRRNL
FT                   CGKVGLLTEVRYPYGGAVRFEWGKVGGTVEMPQQEWQVVAVEYDAGESGAVRGERTYRE
FT                   EYRYRGGRYDRVERLFYGFREVEVRRPDGRREVRKYRNDDYYLRGMVEEVVVYDADGHV
FT                   LEEAEYLVKKERLWGKRYVVYVEEERHWSYEGGEAVERVVRYEYDEWGNIERYEEEWGG
FT                   GKKVAELTYAEIGGGRYLRAHPERIEVYDERGELLWLREGSYDEHGSLIEVRAYVRGGE
FT                   WRTWRMAYDERGNLERKEYPDGSYVRYEYDEEAGQYPVVIYEGSREGGEYESRIEWDLW
FT                   WGVRVREEDPSGAWVRYRYDGRGRLVAVDTPYDEGAVRIEYHSGDEPWYAVTRQKVYMG
FT                   GGDEEVVTVRWVDGLGRELYVAVSGERWTGGGKEAGWRVSGVEEWDEVWRPVARGQTVW
FT                   RAGEGIPTWEDVSACGLEAPVRYTYDAKDRVVAVRYADGAEERRTYAMEGGLVVEERVD
FT                   AEGRVERWYRDAAGLVRKVEKRGPEGEVGLIYEWDRMGRLTKVVDLEGNEVLFRRYNLL
FT                   GEVEEEGRPESGVVRYWYDLGGHLVAKSDSELGAKGKRIEYAYDGWGRLVKEVYPEGEE
FT                   VTYRYALPWEEDAGRLVGVESPWVKKGRTYGPMGEVEEERIVVKRPGAEWGEEEVGGTY
FT                   RYRYTYLGQVASLTYPDGEEVTYRYDRGGKVERVEGRYGEYTYRYVDEVGYDGRGRKVY
FT                   ERYGNGVEEEWVYDDARGWPVGVEAEVMRDSGVQVVRDLAWEWDRSGDLVRLEEEGWWG
FT                   QVVHEWGYDAYDRLVRAEGMYEVREGGSEAKEGGRYEQEWVFDRLGRLEEKRSRAVDER
FT                   GREEGKHTYVRRYEWEAGAPYRVSRVGEMWYGYDRSGRLVAEGRGERPVVEAGEVAIEE
FT                   VGEG"
FT   gene            70692..72050
FT                   /locus_tag="STHERM_c00630"
FT   CDS_pept        70692..72050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01039"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY3"
FT                   /protein_id="ADN01039.1"
FT                   /translation="MKRVEYAMGLVDPVGGGGGGADREYRWDSGGRLRAYEGGGQWGRY
FT                   WYDEGGERVRKETGLGEVVYLGPYMQYVEEGGKWLEVKQVYVGKERVVSKLGSVEGGDG
FT                   GTEAESARWVHSDLVGSVSVLTDGGGNVVGKWVYLAYGELWVEWRWAHDEWAGRPEVRY
FT                   RYAGKEWDEESGLYYFGARYYRAEVGLWLSPDPEGVRLVSPMEDGAPRSGYSLAEAAIW
FT                   YAYCSYNPLRYVDPDGRDSIWLTSARNYVSRRRMLTTLWSLFHPSEYLSWVQRAVVFHK
FT                   DYHRGGIGPFQREDDMPESIRNNKDRTWCNVAVYEMAVALGVPLDLITGGQRWDWVNAN
FT                   TAVGNMKEHAITEELEELMEVLGVAGGYGGLVRVSEERAIELADQGYLVIAGWRNPGGI
FT                   GHMETVSPHHPPGEIRYAGTGANAGTSKTFKEAFGRTVSEDDVYYFYYPRQFE"
FT   gene            72063..73763
FT                   /locus_tag="STHERM_c00640"
FT   CDS_pept        72063..73763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01040"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY4"
FT                   /protein_id="ADN01040.1"
FT                   /translation="MKERVLIVVVLLVVGCGRWVGGEEVGGEGGGSVVRKEEGVWARVE
FT                   GGIEGFLLGEGWEREPHRRMDLLYEGAVEGRYTGEGQREFLVAYRDYRVSPVNDSEVIW
FT                   AVVSFRFGPWGIEGKVWEECYWDDRFIECELFVESSGLPVAETARVEGGRRLGPLWVVD
FT                   VDMDGLEEIIEVWEHTQFRQSSLLVTGYNVLQKRWEREKSFDLSLEVVKEHGYGIGEVV
FT                   IRPGRVKVYGGREGWEYEAYRGVRPYVEWVWDEEEGEWVEVERGYEEVEKEAYEAFVRR
FT                   QEEEGERIWRREWERKMRFEWRWWEGLVKVMEGDAEWRVLKRAYPGVWEVNGEPEALPT
FT                   WYRRFEGEGWGEGVWYLVKYKGRNKESYRVEEWYAVVRVEGDEVEVYDKVEVGGEKQVR
FT                   WQPDGGGTLKGIWKGTLKGEGVGVEVEGGWYEGGMWVVDVDGDGKEELVDVGWHKEGKY
FT                   TVDIIKWEGELKTRWRLPIPGYLVRRVKIEEGRIECGGVWMEEEETTVVVGEGPYVVWE
FT                   LKEGEWVKVEEGEEEWRGEEEVIVEFDNAFGLHLHHWVEIMRRIIEENY"
FT   gene            73863..74024
FT                   /locus_tag="STHERM_c00650"
FT   CDS_pept        73863..74024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01041"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY5"
FT                   /protein_id="ADN01041.1"
FT                   /translation="MGLWLSPDLEGVRLVSPMEDGAPRSGYSLAEATMWYGYCSYTPLT
FT                   VRGSGWEG"
FT   gene            74185..74610
FT                   /locus_tag="STHERM_c00660"
FT   CDS_pept        74185..74610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01042"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY6"
FT                   /protein_id="ADN01042.1"
FT                   /translation="MAEPAAVVYGQAGLMVVSGGFLPGKGLSVVGKTPTSKVRVFWSGG
FT                   REVAGKAAMEWAKEHGGITLEMSIGGRIMENIGRFLPRNLQVKIWGVLSRRFAAGAEGV
FT                   VYCFQNAAGLSLKSFWATQEYPILAKNGVEIIYKLVK"
FT   gene            75232..75714
FT                   /locus_tag="STHERM_c00670"
FT   CDS_pept        75232..75714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01043"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY7"
FT                   /protein_id="ADN01043.1"
FT                   /translation="MMVGGAVVAVGTVVEDAVTGGWGTWNDPASFGAAGTLVLGGAALM
FT                   AEGIREDSRASSIAIPDALAESSGRDYVYHATSARAFVEELTRRGAAAIDYENHGDPEA
FT                   RFGLAFYVAEDPGTALAETKFSAEFVVKFSMDKRRILGSDRSSSSRTIWVCRRNEA"
FT   gene            75868..76374
FT                   /locus_tag="STHERM_c00680"
FT   CDS_pept        75868..76374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY8"
FT                   /protein_id="ADN01044.1"
FT                   /translation="MSEKEMPFETYVLKCSNCGHVFKEEWKDVDMTFDRVVKCIKTGEL
FT                   RYYNAYEDKIYNKIADLVKRFLGTKSLDEQTRINRFYDIIDKIYRKLTALSLGCEYAHR
FT                   YKDVCPQCGVKGKEKFEEICVFKERKKIKQLEYRPLSDDELRELVEEILREYEGGEAEE
FT                   DESGR"
FT   gene            76718..77194
FT                   /locus_tag="STHERM_c00690"
FT   CDS_pept        76718..77194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01045"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTY9"
FT                   /protein_id="ADN01045.1"
FT                   /translation="MGAAFTSFGEFVNKRGLPHYGLFLKGAAFIWKSPGNWYAGVKASI
FT                   VGTRRLFERRYEVPAHTYMRAAVAAGGMLAKGYSEADVREVYTYLLANPGSDVSVIGPK
FT                   GGSEGMGIYEKYAMEIGANYLPSEGWTKEKNRAYIEGIIERGMWYCSQGDLIHP"
FT   gene            77359..77835
FT                   /locus_tag="STHERM_c00700"
FT   CDS_pept        77359..77835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01046"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ0"
FT                   /protein_id="ADN01046.1"
FT                   /translation="MRWEGSSIRERAEFLVTYAEDKFHFLEERSFEVKTYRFGLEYAHP
FT                   LCVFKVHPISYATLIELIWYSSIDEKSRIYMLPLLEYIIYKKTGRKTQLFMPKAKLFSP
FT                   IDVDMKDCIDKIDISAEYSEKYFEDIMDFFQKHDEERVGFERFLDERRKERRGE"
FT   gene            78063..78743
FT                   /locus_tag="STHERM_c00710"
FT   CDS_pept        78063..78743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01047"
FT                   /db_xref="GOA:E0RTZ1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ1"
FT                   /protein_id="ADN01047.1"
FT                   /translation="MERKDARRIQESFLSGPERKALEWIAGRLPRWVVPDHLTWFGFFG
FT                   ALVAGAGYVLTTWGKGFLWVSSLGFVINWFGDSLDGTLARVRKIQRPTYGFFLDHNVDA
FT                   LTALVIGIGAGISPFVSLSVVLLILIGYYLLSIFTYINTYLREVFKISYGGFGPTELRL
FT                   GIIVLNGLFYFIPTDNPSVRVLGIGMKYFDLFALVVALVLFFLYFYFFLTARREYEKVD
FT                   PPRS"
FT   gene            78755..79225
FT                   /locus_tag="STHERM_c00720"
FT   CDS_pept        78755..79225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01048"
FT                   /db_xref="GOA:E0RTZ2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ2"
FT                   /protein_id="ADN01048.1"
FT                   /translation="MFVRFLKFFASRLVGTGVDTFVLWLASTFLFSSYVGKYLVAPALS
FT                   FEVAMLHNYTISYFWIWRKRIRHRGPADFFRRLLPYNLSVLFGFGVKMVLLLLLERLFH
FT                   WDVVWCNLGALTVSGVINFFLGELVVFKKGGYSYEDGLLLDPETGWTRGVEK"
FT   gene            79283..80428
FT                   /locus_tag="STHERM_c00730"
FT   CDS_pept        79283..80428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01049"
FT                   /db_xref="GOA:E0RTZ3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ3"
FT                   /protein_id="ADN01049.1"
FT                   /translation="MYYRTMGRTGVEVSALGFGCMRFPTKGGDGSRIDETQAERMLLYA
FT                   IEHGVNYLDTAWPYHGGRSEPFVGNVLERHGLRDRVFLATKMPMWEVKTGADLDRIFDE
FT                   QRRRLKTDYVDFYLLHSLNKENWRRVEASGALEWIQKKKEEGAIRFIGFSFHDEISEFK
FT                   RYVDALGEGWDFCQIQYNYMNEYEQAGTEGLNYAVERGLGVVVMEPLLGGYLAGRIPRL
FT                   EPVWAQSGRPWSPVEWALRWLWNNPKISLVLSGMSTIEQVEENVRIASTEGGAPGNLPP
FT                   EDLEVIVRVREVLESSKVIPCTSCNYCQPCPHDVEIPRIFKIYNDAEIFGNVGNARGAY
FT                   RWIPEGHRASDCVACGECETKCPQQIEIIDWLKKAGELLEV"
FT   gene            80474..80857
FT                   /locus_tag="STHERM_c00740"
FT   CDS_pept        80474..80857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00740"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01050"
FT                   /db_xref="GOA:E0RTZ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ4"
FT                   /protein_id="ADN01050.1"
FT                   /translation="MRVLVVEDEFLSREKLSAFFSRYGAVDSAPSGRDARVLFERAIEE
FT                   GLPYDCISVDLHLPDEDGLSLLASFIRREREVGGGWFSKKLVISGDTQRHVVESAVRAG
FT                   CDAYIAKPVRLKVLEERLRLIFR"
FT   gene            80897..82474
FT                   /locus_tag="STHERM_c00750"
FT   CDS_pept        80897..82474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01051"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ5"
FT                   /protein_id="ADN01051.1"
FT                   /translation="MGTYVLGVASGKGGVGKTTTAVNLGLWYARRGLRVALLDLDPLAN
FT                   LHVVLDIPLSELSGVRYPNDGAGLDDASYRYLPRFHLLFPPSSFRPAPDRIADLVFRSL
FT                   WHEVEARYDVVIVDFPPGISQEESLAFLPCLSHVLVVTTSEPTAHVSTGGYLRALFDVQ
FT                   SSAKAMLWFNRYSPSVWDGFLPDDVVGTYNRFAPEEMRLSHSERERILTVARVPYDATL
FT                   DLLKAEPSLDVVLDARLGETLEVLSRRLLDLWAVRLSLPSHVTSLWTKWLHEHPDLDAG
FT                   DAARSFLSSMERLLGVEEVERLVEGKAELVRFAEMLARTSLWRALCRVRGLLDARVEGR
FT                   SVPDRVLYEHVRDVLTLLLPYGMRDGFLRNLGGMLLASLALHMLAANPSVARLIRGFVP
FT                   LKKEGGRIRRDRAAQIRYLVSKDALYHEKYVDLVGRLFPPFMEQVSRLVQRWGFQRFLF
FT                   RVPGGEPHKAAYVKLLSNVLHDALHAGLGVFFAFKYSPAGEEIREGAERILGVMAGGRS
FT                   LAKGGRAG"
FT   gene            82471..83187
FT                   /locus_tag="STHERM_c00760"
FT   CDS_pept        82471..83187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01052"
FT                   /db_xref="GOA:E0RTZ6"
FT                   /db_xref="InterPro:IPR025749"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ6"
FT                   /protein_id="ADN01052.1"
FT                   /translation="MSADHGEGSGRMSVQDHGRSFLLGWWSRVRPLLSSKRYLGDLLAS
FT                   GSLLFFLVRVVYLEWLREYLAALPPNPIPDRILELAGPYNLDFFVSTYIVLMGTLLVLH
FT                   VVLTCPERLPFYLKVYSLLYALKFAGLPTTALTAPADAIFDTFDPIENDLFFSGHTAFM
FT                   FLSFLLVRHSSRPLSWAFLGSTFLEAACVLLMHMHYTIDVYAAPFFAYGTYRIAFLLFG
FT                   KNAVAYEALRTARGGG"
FT   gene            83786..84682
FT                   /locus_tag="STHERM_c00770"
FT   CDS_pept        83786..84682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01053"
FT                   /db_xref="GOA:E0RTZ7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ7"
FT                   /protein_id="ADN01053.1"
FT                   /translation="MRLRTYHAVVVLVATMVVEALAFWVSFPFEVPYWDVWMFFRVAML
FT                   VIALTWLVLLRKEFVQLRYMLTLFLGIWALVVAVWGELLAAAFWPGSVVIAVLNGFYVV
FT                   ALTGVTIGVMLLIRMYRMTISELSEKQRRLIELSITDDLTGLYNARYFYRRLEEEIARS
FT                   RRYGRPLSLLFIDLDDFKRFNDTYGHLAGDRVLRKVARVLRESLRENDSAYRYGGEEFV
FT                   IILPETGAEEGCVAAERVRRRIEVCSFRGKEKVKVTASVGVVEYREGDAIEDFVRRADQ
FT                   AMYKAKAEGKNRIFLVD"
FT   gene            complement(84679..86442)
FT                   /locus_tag="STHERM_c00780"
FT   CDS_pept        complement(84679..86442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00780"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01054"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ8"
FT                   /protein_id="ADN01054.1"
FT                   /translation="MRRFVSALCFILVVFPAFPQEVPRYRLTPTTLFTSLDGGAAWQEH
FT                   PLPAHLYPLTTLTWDRTDPHTLILATQHELLVTRDAGLTWKTLDLRGPLNASTHIRALA
FT                   LTGSSTLLAGTSFDGLFRSRDGGVTWEEVPLPEELPFYLGGGFHEEVAGIAPLEDGIAI
FT                   LLGFGKGAYLLPPGSPSPRPIPNPVLIERRFPEWGLDLQKILRQGEVLILPDQTLITPV
FT                   VRTAGKDPQRTRRREKASGKHAIYLRAPLATPEHLPRYIELLEAHGFNAVVIDFKDENG
FT                   SLRYESSLPLARAMGAVRPLFDARTLIETLHAHGIYVIARLPVFKDKALALYDGGTYAF
FT                   LDRKTGKPWGVFRTYTDEETGETRTEQVEFWVDPYNEEVRAYNAAIAEEVASLGVDEIQ
FT                   FDYIRFPSDGDTSTLTSRYKRPDETPTDALIAFLSDVRDRVSVPISLDVFGFNATSRTS
FT                   YLGQDITRLWPYIDVLCPMYYPSHYSKAFLPHLPYLERARWIYRESTLRAREMTEGQIL
FT                   IRPYVQTFLIGGERSFEEETYYTYFKRQIQGVIEAQADGFTCWNASGNYYMIPPDFTLR
FT                   PPEPTSAARLD"
FT   gene            86583..87713
FT                   /locus_tag="STHERM_c00790"
FT   CDS_pept        86583..87713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01055"
FT                   /db_xref="UniProtKB/TrEMBL:E0RTZ9"
FT                   /protein_id="ADN01055.1"
FT                   /translation="MFLLLSSCGFLLPEFSNPLDPYGKNADTFAIELLNEDSVPQDLGA
FT                   SIFTPLAAAWTGGEAVVAWVDATEVRACVVSGEGELLAGAGALYTGSVPSGVRMGGGDG
FT                   SCTLVVEDGGEVWVGVVEASDGALQVESAFQSSGWGVTGLAAVSEPVWVGWERWVVGYV
FT                   DGTGDIHLVLLDSSSDPAVVVQDLDLGPGSGTVVSLSAAGDGTGGGLLVVGDDNGVTAT
FT                   SIYGISFSLSQDTLEVGSGGIFGATLSGIGPFPVAFGEGLGAYLILSTDGSDLQGIAVA
FT                   GEQVLWTRDWGLPAAGGVYGVWGEPDGWGLLYEEAGVLRMARKDPALSSDKVGSPYAVY
FT                   TYTTGVEAAAVSTGEKYLVFYADTDGVSPGTLFVRE"
FT   gene            87717..89348
FT                   /locus_tag="STHERM_c00800"
FT   CDS_pept        87717..89348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01056"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU00"
FT                   /protein_id="ADN01056.1"
FT                   /translation="MRKVCPVVLSILVAATLCAAPVRVGVVPYDLSGGEVQARAVKETF
FT                   LRALVCNLAILEETEPVVVKGEDAGRDVREVGREYGVERLVRLSFSEGADGYRLSVFVY
FT                   DTKGGTAIGGPSVRISRGEALFEALVAPMGQVLTILLGREVPLGRLVVQNLGEPGRFQL
FT                   EVDGVDLGDRLKVLAPLVAGSHSWRVRQRRFGRIVEIQSGTVDVAASDTGKIIVSIPRL
FT                   LPEEERRIQGLEDRIRGAALEGRRDRLEALLAEWEALFGDVSFAPSLAAYRERRRAFRA
FT                   LVQVGDLRREVEGRVLDPDPFFFQRIRALEGALPEEVRSDPAVRDALAICAEEALLSQV
FT                   YHVFRLFRESRFGEAMARYASLRPLLVFVRDPWRIWYERLWFHMNRMDERYLREGVRGR
FT                   DLVLPILETALGISLDIAAVYLFYTDNSAQLLAEAYERYPDYLAADTPEEAARLHREIE
FT                   DRIRKANNHTFAEWSCAFGGLFFSIVGPIHLYRAMRAPAVRAWEELSLLFPRETRASEV
FT                   LFTLPAYRIDEWIREQHEDMAARPGS"
FT   gene            89349..90494
FT                   /locus_tag="STHERM_c00810"
FT   CDS_pept        89349..90494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01057"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU01"
FT                   /protein_id="ADN01057.1"
FT                   /translation="MRDPQGKEVTMKRWYHVCVVLFFVVTGCTTSPGERAESAVLPVDS
FT                   AGDEIEAMIGRASSLFDEGAFSEGLSLMARALSRAEAEGREDLAARVRERLESLEDRLL
FT                   LEPASPWLEEGLTQRTASTLGVELQPEVILSYTGAGGKVVVPDVPVVFSFVSGGGELSQ
FT                   RVVRTNEYGQAGTVILSFDDPKEEQIVEARVVVGEGDPRMVFDRLVVRFVYRAPSRKVV
FT                   LIPLVRPGEEEGRIAEVLKEALAGIPYVVQLYEGDLSSGLFIQAFRGERDALEQVKQTE
FT                   DTAYALLVLVESTGVFPLEMGGRTYKLYVAEGRADIRLVRIEDGALLYEKVLERTREAG
FT                   THGQGPTEDRAALDVVRALVEDARVFFREHGAELVEALTGE"
FT   gene            90615..93227
FT                   /locus_tag="STHERM_c00820"
FT   CDS_pept        90615..93227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01058"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU02"
FT                   /protein_id="ADN01058.1"
FT                   /translation="MKVEVCDRPEEVSERVGRLLDEGWCVVFPSEVVRRSFLAALARRC
FT                   GGIDAGRLHTWDRFVRDRFVGQGKIPAGPLHRVWAAAVLLSREEAQDYLAPVFGEVWER
FT                   GGLEGFLASVLPEILLLDLGGRGDAPWDRALSWLAEGYRGVLEEAGLYETEEEVRRAAK
FT                   EGRAPEERVVVVYPELYTAVGVPWEVLGPSWLGLSLRAGVPEDASVLVCYPDAVSEVRA
FT                   ALMEVRDALKEGEEVELVLADRGLLGLLAEEADLLGIPLSPEVGRALREVPGVRLLFLM
FT                   DEARRTGWDFDSVRDLLLAGDVPWKEGWGEAVREAVERKVWGRKGWEKVGRVGELLRAV
FT                   QGVMEAESFGALRKALDSWVQGWLGAWADDAEQRAWGFARGLLGQLSLLEGRTGVRVGR
FT                   PWEVWIEALKAVPYVPGGGEGVPVYPYRVSAGAVGVRQWVLGASAEGVEVASIPVEFLP
FT                   EDERGRLGVSTRRFTESFVYAYLRSGARMSMHRVQEEITHEVPSVFLLEGTVEERGMVE
FT                   DHPLAVEQRVWRGEVVEVRPVEAMVDGFRRAEKVRERWGKGAEPLGGVAGELLERHGMR
FT                   KGNELLLSPTVVQGFYECGLRAWYERVGGLEEASFRPGFIDRRSLGIVYHALLEEVFSP
FT                   YVGRLLSEVRLPEGFRARVEKELEKHGAVVREFIEIVADRVTARLEGVIERLKRLFSGT
FT                   PPARGARVGRIEGWERSPIAEGLALRGRLDLLVEDGAGNPVLFDFKYTNVPSFPHPDKL
FT                   EEGRRFEMQLLLYALLLEKQEKRLVEDALYVSVEKDEVLSLRKRLVSRGNRNTQMYRDD
FT                   EGLEDLFERLERTLVEIGQRMEGGQISYAEDRDICTTRAGGCPFRRVCRVRYTVREAE"
FT   gene            93224..96682
FT                   /locus_tag="STHERM_c00830"
FT   CDS_pept        93224..96682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01059"
FT                   /db_xref="GOA:E0RU03"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU03"
FT                   /protein_id="ADN01059.1"
FT                   /translation="MNLNEDQRRAVETEKTAVVIAGAGSGKTRVLTERYLRLVRNGVQP
FT                   SRILALTFTRKAAAEMHERISQGIRGLARSSHGLLEDFENAHISTLDSFCALVLRPHAL
FT                   GFGIRPDFGMCAADDLEGLESRALSFLLSKKDRPGVRRLIHSWGLDRVVNDFLCHYGRN
FT                   HAMVGAVPDPEEWEEWYQEKVEEAFTSVDEGMERCGDFVRECAREARILEEERKREKKK
FT                   VSESIGKLIDAGTMWEVVEAAWDRVRSRREGGSGLVPEVVREWREALDEVASSLKGLRV
FT                   DELRDAIDTLKKELGVGKKPPSSSLSAVAGDLVSLLERREEASSLFGVLAEWHGEVERF
FT                   KKERNLLTFGDVMHLVLTLLKEEKEVREFYKGRFDAILVDEFQDNNGLQRDLLFLLAER
FT                   KGRCGDGVPSFEDLEPGKLFVVGDEKQSIYLFRGADVGVFLDLKERANRSSHGEVMRLP
FT                   HNYRSEPGLLDAVNRMAGAFPEEMRGGIEFLPAEAGREGAGFTPRIEAGVYVKEEEKAR
FT                   AEGRDLVDAGTAEAWWVAGRIRRWVEEGELVVRDGEEVRPVRYGDIAVLMRTGTNQLAF
FT                   ERAFRAHGIPYTAAYSRNLFLEAPANDLFSWLFIAVYPHDLLSYAAVLRGPLVGLSDRD
FT                   ILRLIEREEGCFSLSREEVEEMLGDEEELLRERVERYERGKEIYDWLVSHRDRVPHERL
FT                   LRYLWVDCGYRMVLLGREQLHPFLRFYDELVAFVRRWEERPLARCLDEVKEELGRYGRV
FT                   DVEEGRGEDAVRIMTIHAAKGLEFPVVVLASCGAESRREGEGKMPYFMVEGVPAFGFEG
FT                   DEEGKKENPLYRRAAEEMKKKEAEEMLRLLYVGLTRAQSHLLITGEWRGAVGKEEHGAD
FT                   DGSKKTVPSFMSLLFEAKIEEPEVRFKADQEGIAGVEWRDPERIPGITEEELRERVGSG
FT                   SRGGRWEEAARWYEEVDEGVGGVRPGVLSVSVLAGEWEAERGGEARGRGAVFGSLVHRG
FT                   MVLWARLGDEGRVREALRGEALAWGGDGEWGEVDRVCEEAAALVRRWAESEVGREVLGN
FT                   GAGWEVECVAEWEGRVLHGVMDAVWVGDGVVRIYEWKTEEEPDVERYRAQLFLYGLIAS
FT                   RVWPGRRVECVLGVPGGRMWRGVWGMEGEWEEVAAWVRGRLGITI"
FT   gene            complement(96672..97661)
FT                   /gene="fabH"
FT                   /locus_tag="STHERM_c00840"
FT   CDS_pept        complement(96672..97661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="STHERM_c00840"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 3"
FT                   /EC_number="2.3.1.41"
FT                   /note="KAS III; beta-ketoacyl-ACP synthase III;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01060"
FT                   /db_xref="GOA:E0RU04"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU04"
FT                   /protein_id="ADN01060.1"
FT                   /translation="MMTQPAILSTGSYAPPRRLTNEELATMVDTSDEWIHSHTGIRARH
FT                   IAADHEAASDLGTIAGSRALDAAGISPEEVDMVLVATSTPDYLSYPATACIIQDNLSCT
FT                   RAAAMDITAACTGFVYGLETAACYIKAGRARYVLVIGTEVNSRILNWNDRNTCVLFGDA
FT                   AGAVLVGPSPDSTSSIEDSVLRSLGNDALALLRPKGGSRSPLTFTPEEEKDFYVQMNGK
FT                   KVYLFAVSAMGKTIEKLLRRNDLTIDDIAYIVPHQANVRIIQACSQRLGIPMEKFYLNL
FT                   EEYANTSAASIPLALDEMNRKGLLTRGDRILTVGFGAGLTYGGNLIIW"
FT   gene            97804..103323
FT                   /locus_tag="STHERM_c00850"
FT   CDS_pept        97804..103323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00850"
FT                   /product="putative inner membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01061"
FT                   /db_xref="GOA:E0RU05"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU05"
FT                   /protein_id="ADN01061.1"
FT                   /translation="MREKRLTPWIPAAWLIVLLAVLAACGGEKKERAAVSASRWISAYT
FT                   TGEISRKGSITVEFSQEILPGVEHGAVVKDGLLSFSPSVKGSLRKVDEFTLRFEPEGEW
FT                   TSGGTYRCKVSLSRLFPEEEGVPDTFEFSFSIVPLDASFEEVVLRAGGDLEEVDITGTL
FT                   ESSDVVAEDALEKSFSVQGVSFRRIEWEHEGKEHRFRVTGIPRGETGARARLRVDLSAL
FT                   GGEGSVETEVEISNKSEFKVLSSKVDRNARRVDVVFSLPLDPDQSLEGFVRIEGAEPLR
FT                   LVRQDNILSIYFPLPSGRKYTVRISKDLRSSLGSALGRVYVQEVVFQVPAPEVELLSPG
FT                   GIVPGVEEAYFPFKARGLRAVDVTVVEVHPGNIVHFFHTHAGFREEDWWGSSPLMYVGK
FT                   VVACTTVRLDDDPSFDPFEWATFRLPLTDLVDLTPGAVYWVAVNFRPSHFVGFTEEEAA
FT                   QMDDPLMVPVYGDPTKDEYREGMPTYLEYDWRRRDDPYHRAYYGRRREKSAFIFVSNIG
FT                   FVALRSKEEAVAFVTDIRTGLPLPNVEVEAYDFQGEPCGTGKTDGAGVVRIPCTSSPYL
FT                   LVGRSGEEVGYLILRGDTALDVSAFEIDGISSSEGLKGFVYTERGVWRPGDDIPLFFIL
FT                   EDRERTLPDNYPVVCVFKDPEGKVRRRLVVREHVGRVYRFDLSTRPEDPTGVWSAEVQV
FT                   GERRFYKSLRVETVKPNRLRTVLAFPSQTLSLGKGEVTVSAQVSWLHGAPGKGLRLQVE
FT                   RILSSASTRFEGFPNFSFDDPTADFHAQKEVVFDGRVDAEGKASFTMGLKGDLEAPGML
FT                   RALFVSRAYEEGGDFSINTTSVNVSPYASYVGVDVQGETENKWAEYEANREYALQVASV
FT                   SEEGKPVAREGIHVILYRLDWRWWWERTSDERGNFLSRYHAQRIKDWKVSTGKDGRGHV
FT                   KMSFPRWGRYLILAEDPVSGHRAGKIVYVWWNWGEEVPSEVGPALLFFEPEKQSYTVGE
FT                   KVRFTIPSSPEAHLYVFLSSGSRVLKTMELKGSGEKTEVSFTVTKEMAPTLYIHVFLVQ
FT                   PYGQVSNDRPLRLYGVQYVSVVDPQTVLEPQIACDDYFLPEQDATIVISERSGKPMVYS
FT                   LALVDEGLLDLTNFETPDPHSYFYGKEALLLRLWDVYGEVVASEILKRGRILRPGGGEG
FT                   MAEVPKQRANRFPPVVMVEGPFFLEGGASRRHTLRMPQYVGSVRVMVVSAYEGAYGAAE
FT                   KAVPVKAPLMVLSTLPRVAKAGDRFSMPLQIMVDEEAVGKVEVRVETEGTLALEGEGRK
FT                   VVDAPEPGEYLVSYPLRADRLGVGRVDALVTSGRFSMRSTVEMDVVSPSPLRTVVQEAL
FT                   LEKGGAHSFSLERVGIPGTTSHVLELSRLPSLNLEQRVSYLIGYPYGCAEQTTSRAFAQ
FT                   LHLPELVDLTEERQHEIQANVNGAILRLASFQTSEGGFAFWPGGEAHPWVTSYVGHFLI
FT                   EARRKGYHVPEEMWQDWLSYQKKAAGAWNEEGETREFIQAYRLFTLAAAGSPHTGAMNR
FT                   LAQREKLSNRTAWRLAAAYAILRQMDMARSLVERASGYLDVRGRYYDWETYGTPLRDRA
FT                   MGLEALVLLGDGVEAFKVLEEIAKELGTGRWLSTQTIAYSLTAIARYVESFGASGKLSR
FT                   VEVMWNGEGMDVVSEKVVASIPLQGEAGTLEVKNGEEGVLYVRVISSGYPPAEEREGFS
FT                   RDLEVRASFLDTEGRPLDVGSLPQGTDVIVKVTVKNPDTSRVYRDVALTVTMPAGWELI
FT                   NRRFFGLPVAEGTSTGDYQDYRDDRVHTFFDLGPGAEKTFVFLANAAYEGRYFLPGVHC
FT                   ELMYEAEIQAETASRFVDVVKAAR"
FT   gene            103259..105736
FT                   /locus_tag="STHERM_c00860"
FT   CDS_pept        103259..105736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01062"
FT                   /db_xref="GOA:E0RU06"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU06"
FT                   /protein_id="ADN01062.1"
FT                   /translation="MRRRSRPRRPRGSWMWSRPLDRVRRWGEALRAELPAADERTLRRS
FT                   TGLILGAAVLLVFLLVLIPLPEPLFSDPYCTVLKDREGRLLHVRIADDHQWRFPPPDHL
FT                   PETYVRAVLAYEDRRFFLHGGVDPFALLRAAWLNLRAGRVVSGGSTITMQLARLVRKPD
FT                   SRTLLDKVIEVWYALRLEWRYTKEEILLLYAAHAPFGGNIVGIEAACWRYFGHELGDLS
FT                   WAEAAFLAVLPRDPADAFTPQGREEVRGRRNRLLLRLSEAGHIPPPLLRASLAEPLPSG
FT                   LHPFPAEAPHLLLRALSDGHAGESLLTTVDRSIQRKAARVVALHHHRLAPRGIHNAAVL
FT                   VVDLSSGEVRAYVGNTPEPDPEYGPEVDCVSAPRSPGSTLKPFLYGMMMSEGLLLPHQL
FT                   ISDVPVSYGGFSPRNFHRTYYGVVPADQALIESLNVPFTILLARYGYRVFYGMLERLGL
FT                   RLPHPPEHYGLSLILGGVDLSLWDLAELYGGLGRIALGKGDRSFLRHRYLLGEEETLRA
FT                   RSPTQILDPAAVWYVIEAMAHLVRPENEAGWEHFVEGRQVAWKTGTSWGQRDAWAVGIT
FT                   PAYLVAVWVGNADGRGNPQLLGARVAGPLLFDVLRELPLPDTWFERPVDRMVPVAVCAT
FT                   SGMRAGPHCPEVRVEMLPSASRRAPLCTYHKLLHLDAEGEHQVDSSTYPVDRMRHEVWF
FT                   VLPPLEAWYYKRSGHVYRDPPPPRSSFRPELSLAYPSDGAVVYIPVDLDGRREAVVCEA
FT                   VHSREGAVLYWHLDGELVAVTRAPHQIAITPPAGWHTLYVMDGEGLGVSARFRVEESGV
FT                   RPGTEVNTGFSSR"
FT   gene            105889..106959
FT                   /locus_tag="STHERM_c00870"
FT   CDS_pept        105889..106959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00870"
FT                   /product="putative glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01063"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU07"
FT                   /protein_id="ADN01063.1"
FT                   /translation="MLSWDQIRVFFCSNEKPVSEGAAMSTRYTVVADPLPHIPWEDRPP
FT                   GSREVVWRYSGNPIVTRDHAKGANSIFNSAVVPFKEGFAGVFRVDDTARRMDLRRGFSE
FT                   DGIHWEIDDEPIRFTPEHPDLPRSEFKYDPRVVRLGSRYYITWCNGYHGPGIGLGYTDD
FT                   FETFVQMESPFMPYNRNGVLFPRKIGDNYALLHRPSDAGHTAFGDIFYSESPDLKYWGR
FT                   HRHVMGPRGVESLWQHTKIGAGPAPIETSEGWLLLYHGVLTSCNGFVYSMGAALLDLDE
FT                   PWKVRYRSAHYLLSPRAYYECVGDVPNVVFPCAVLCDGETGRLAVYYGGADTVVALAFA
FT                   YVDELIEFIKATDLGA"
FT   gene            106993..108270
FT                   /locus_tag="STHERM_c00880"
FT   CDS_pept        106993..108270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01064"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU08"
FT                   /protein_id="ADN01064.1"
FT                   /translation="MKRCVLLSVLFLMAASFLWAGAQQEQGGGAGGQATIRYTRWAGTQ
FT                   EAKDFQALVDTFMMAHPEIKVETEFLPWGAYWEKVRTTVVSGDAADVLSMSHQSSSPYV
FT                   TKGAFLALDDLPGAKELLDEMQPGTRAAVVYQGKIYGMPIGVGVRALIYNKKLLDEAGV
FT                   PYPDPEKPMTWDEFIRTYKVLTKKNAQGEIVQAAVHFHWLEMWQALVVQMGGKILDDDI
FT                   RPTRVMLNSPEGIAALKLAKRLFQEELEPPYSTEWAGPWGTPDSAVATGKVAFMHTGGW
FT                   GIPPLKDAGIDFGTAPLPYPAGKQRATRGYVNFLSIYRGSQKVDAAWTFVKWMCGEGQP
FT                   EFAKTGDLPANAKYLETVMKISPDYMKAFFSDLPYVITGPMLPTDEFTSLLEATMTDFF
FT                   QDRISAEEAVRIIEEEGNKIIKKIYG"
FT   gene            108327..109256
FT                   /locus_tag="STHERM_c00890"
FT   CDS_pept        108327..109256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00890"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01065"
FT                   /db_xref="GOA:E0RU09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU09"
FT                   /protein_id="ADN01065.1"
FT                   /translation="MRRTGTVSRLLARRNRMGYLYILPWVIGFLFLQVFPIAYSFYISL
FT                   TKWDLLGTPSFVGWENFRELLEDEVFFLALRNNLIFMIFGVGGGLLLSLFMAALISEPE
FT                   LPGRRFFRVLFFLPSLVMPVALGLMMAPIFGTENYGLINLVLKKLGLGQVEWLGDPGLA
FT                   IWSVVIVNFWTVGASMIIFLAGITNLPRSYYEAAAIDGAGWWTRLFRITVPLLSPVLLF
FT                   QLISGLIYGLRIFDLPAALANIGGSRSVMMGKDNSLAFLVFYLYTKAFRYWEMGSAAAI
FT                   GWVVFLVGFALTVVIIRYMRGSSEEGGV"
FT   gene            109256..110113
FT                   /locus_tag="STHERM_c00900"
FT   CDS_pept        109256..110113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00900"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01066"
FT                   /db_xref="GOA:E0RU10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU10"
FT                   /protein_id="ADN01066.1"
FT                   /translation="MRVSSYGFLRNERILVRWGGFLFLAILAVLVLIPFAWLFASSLKD
FT                   MGQYFSTDFRTIWFPSPLHWENYVKAFTYVPLLRYIFNSFWLGAVQTVLQVTSSAFVAY
FT                   GFARFEFKLRGPLFIVLLSTMLLPTEVTMIPLFIFYRAIGWTNSYNPLIVPHLFGGAWS
FT                   IFLIRQLMVGIPREMDEAAFIDGAGTFRIWRSIMLPQVKPALFVAGLYCFLWSWKDFLG
FT                   PLIYLNKKELYTLPLGIMFFESPTEVQYTVQLAAVVIALIPTLLIFGVGQRYFERGINI
FT                   GELK"
FT   gene            110135..110755
FT                   /locus_tag="STHERM_c00910"
FT   CDS_pept        110135..110755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01067"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU11"
FT                   /protein_id="ADN01067.1"
FT                   /translation="MQRVTVIAGVLVLLAAGCTSAPQPSQEAGVAQVQDSMVIWEDFET
FT                   TPFWFAVANAWNDDDSSLEVRWNRQEATHGTGSLEGVFRMNGKNGATFYTEEPEMNDFS
FT                   PYKNLVVDFVNKTDEDLEVALVLCTGADWVWHESATVVLAPGENRNIYFDLTGSNWKCA
FT                   ASNWQFTAQVADIQSVRRVAFKFWGPEGLEGSVLIDNVRLEKK"
FT   gene            110801..112615
FT                   /locus_tag="STHERM_c00920"
FT   CDS_pept        110801..112615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01068"
FT                   /db_xref="GOA:E0RU12"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU12"
FT                   /protein_id="ADN01068.1"
FT                   /translation="MRRIYTVLLGALLLAGCVTGSGVPEGGVDPDALLPHNGKRVFLNG
FT                   MNLAWVNFANDLTQFDEARFTRAVDDVASAGGNVLRWWLHVNGSKTPLFDENGMVVGMP
FT                   EEALINLKRALDISFSRGVGLILCLWSFDMLQPQSGVNQARNLRLIEDEEVTRSYIENA
FT                   LVPMVRMLKRHPGVIAWEVFNEPEGMLPGGGWTPRRTEMQYVQRFINLVAGAIHREDPD
FT                   ALVTCGSGMAYQTDVGGMINYYRDDRLVAAGGDPEGTLDFYSVHFYPQHMDESVSPFHH
FT                   PASYWQLDKPIVVAEFPAKGIREIGFGFRPKTSLTTEEAYLWLIENGYAGALSWTWTGH
FT                   DGFGNIYDAAPGISAVAMRYPEYARLNREGLDLSPKVVKPISHLILSVNEVGKAEEIDL
FT                   REVFEDQEDGDDLSYEVKKVGDPALVEVSLTKDGKALVRLKEARVGSSDVLIAAKDSGM
FT                   NESGLYFTVHALDPDRGNIALFKPVEASSVEDPNLPEYVNDGTLKTRWSSLYEDDEYIQ
FT                   IDLQGRFRIERIVLHWEVAYGKDYDILGSLDGKAWFPIVQVRGGDGDVDELSFDPVEVS
FT                   YVRMHGITRGTEWGFSLWEMEVYGERVE"
FT   gene            complement(112656..113669)
FT                   /gene="celR"
FT                   /locus_tag="STHERM_c00930"
FT   CDS_pept        complement(112656..113669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celR"
FT                   /locus_tag="STHERM_c00930"
FT                   /product="HTH-type transcriptional regulator CelR"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01069"
FT                   /db_xref="GOA:E0RU13"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU13"
FT                   /protein_id="ADN01069.1"
FT                   /translation="MKITINEIARLANVSKSTVSKVLNGYPGINQKTRERVLKVVKEMQ
FT                   YEPNTIARALSSKRTGNIGLLIPHTPEYSVSGAYWSTFISCITASVTEHDYHLLLLLPH
FT                   EEGRLERIFKAVIKRGIVDGLIIGSEFLDKYWLGELLHHRIPFVMLGRNPEFVHYAVDI
FT                   DNRKAAYEATSHLVQRGYTRIALVAGPESYFYNLQRAEGYQDALRRHGMTYHRTLYLPY
FT                   ENYPFVHTSIASLFAESPPPDALLVAAGGDFMLEVLQALEETGHRPPEVGFLTFDDYRY
FT                   LDHTSPPITAVAQPMGRMSRKAVEMLMALLKKEEPPAKEELFPATLVERESTRGPR"
FT   gene            complement(113775..114956)
FT                   /locus_tag="STHERM_c00940"
FT   CDS_pept        complement(113775..114956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00940"
FT                   /product="putative glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01070"
FT                   /db_xref="GOA:E0RU14"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR028583"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU14"
FT                   /protein_id="ADN01070.1"
FT                   /translation="MIELSFAQRKALVEEEYERLISRRNEPILPGNGIFVRYRYPILTK
FT                   DHVPPTWRYDYDPSTNPFFMERLGVNAVFNAGAIKLDGTYYLMCRVEGYDRKSFFALAE
FT                   SPDGIHFTFTTPVLIPDVPGETNLYDMRLTLHEDGWIYGIFCAERKDPEAPPGDTSSAV
FT                   ARAGIARSKDLVHWERLPDLVTPSPQQRNVVLHPEFVNGKYLLYTRPQDGFIETGSGGG
FT                   ICYAFCHSMEDPVVTEEHLLDPKLYHTIKEVKNGAGAPPVKTPAGWFHVAHGVRGTAAG
FT                   LRYVLYAFLTDREDPTRVIARPGGFLIAPEGEERVGDVSNVVFSNGMIADEDGRLLIYY
FT                   ASSDTRLHVAETTIERMVDYCLHTPEDGLRTHECTTQRLSLIEHNRRLLRSSC"
FT   gene            complement(114953..116173)
FT                   /locus_tag="STHERM_c00950"
FT   CDS_pept        complement(114953..116173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00950"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01071"
FT                   /db_xref="GOA:E0RU15"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="PDB:5ZIG"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU15"
FT                   /protein_id="ADN01071.1"
FT                   /translation="MPLPTTLRPTLRQIRSELAAQLFDHILPFWLGQQDPIHGGFYGSI
FT                   TTGPDPTAPKGLVMTARHLWTFSQAFLSRPNPAYLEAAGNAYRFLTHALYDATHRGFFW
FT                   SVHPDGTPLSRVKKLYGNAFAVYALAAYHTASGDREALTLAWETFDLLEDRGRDRRHGG
FT                   YYEAFTEDWSTPLPEPLGEGETPAPKTMNTHLHILEAYSTLFRTTKEPRVREAMEHLIL
FT                   IFRTHIAPSSHLGLYFAEDWAPMGGGISFGHDIEATWLLTESVELLYGDPLPEWFLSWI
FT                   RPVMEETARALDTHGGSLPNEQREDGSVDRARVWWVQAEAFVGFLNAYSLFEEPRYLDH
FT                   ACTVWRFIMDHLVDREGGEWFWAVTPEGSPLAGYEKGGMWKASYHNSRACLEGMRRIDT
FT                   ILEEERR"
FT   gene            116277..123221
FT                   /locus_tag="STHERM_c00960"
FT   CDS_pept        116277..123221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01072"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU16"
FT                   /protein_id="ADN01072.1"
FT                   /translation="MSALRAFLDGFSGKDFLCFLLLVGVTGGALFGQSAIPAQSGNYLQ
FT                   VTGTPQNGDQDPYMVLFYEVPDTITSTLYFAVEHPGLSGAAPDQGTGGTWEFFLVGGTG
FT                   ALTQSRKLNFANDAEVLAGTVLSTIQATNETGWVYFDGVVPSQGEHIGNRYYFKIVAKA
FT                   PDDSKNGFRCDVSYSNTGTPTGDSNIRAFAYVWTLALLDNVGTTWDLYPFVPDSAGPTD
FT                   TIDYKNWDMDGGETLAAWDKSGNPLSPSPSISGNGTTWPNDVATSSYTIGSETNGTWRL
FT                   QITEGNGGEPAINTSLFWFTLNDIAADDTDVPLKTYSAPYSPPAPDHVVISPLSQTVQT
FT                   GQGASVTLQIVDASGNPVPYVRNLYVTVSGNATISPDNNGTAQEELIATSSDGIATFTV
FT                   TDASAETVTVTVYWDGTGGSDSFGTASYTTATVDVAASLPPTISSAANTTIPIGTGPYT
FT                   LADVTITDVSGGQVTALNGIRIRLGGGLSAQFDATVTSLSMSGTAVSNGRVANPVSVSY
FT                   ESGNTVVFVPVLGDFAAGEEVTISGLALDSASLSPSSGYLELSVDGGTSWVSVDDKAIV
FT                   LQGSSYVWDGDTSTSWNDGNNWQGGSPPPDDGTAEITIPAGCTYYPQLVSGESHTVAQV
FT                   VVMSGGALTLDAGSSLTVNGGFQDDGTVTVSGTLLVSGLLTVTGSLDLQAGGQVSAGTF
FT                   SSDGTVQSAGDITTGDFTSMGSFTSTGANSITPSGDVSISGTFSDPSAQCTLTMSGTST
FT                   TLTSSQTLGNLILSGSASVTLGSSLVLGGDLSVPAGTALGAAGFDVDVTGGVSVGGTFD
FT                   ASGITLTVGGDLSVTGTLTLTGATCVLDGAGAQNVGLGGAQPATLQVANTGGQVRFTDA
FT                   VVTGTLQVMSAGSVVFEGDLTVTTSVSFSPAGYDLAFNAGPGGQTTSFPGGITFPHTGS
FT                   LSLGNAAADSFQAAGILTATACSSVQVGGTVSTAGAGGDVSLGDADTPVSLAADTTVDA
FT                   GTGGVTLGGTVDGGYVLNVNGGGNVVLGGDVGGGVPVGSLSVSGGSIEVGGDVTAVGDV
FT                   GFVGSVVVSADVVIDTSGGGGAVSFSGTVDGAVGGESVTIGAGTGNVVLGGAVGGGVPV
FT                   GALSVSGGSIDVGADVTAVGDVGFVGPVVVSADVVIDTSGGGGDVSFSGTVDGAVGGES
FT                   VTISAGTGSVVFSGDLGATTRIGVLTVSSGGRVDLGGSMRTDNAVVSITPPVRLTSAST
FT                   DIWVDSGIGNITFSDTVEDSASGAHNLILIGGGDLTFSADVGAVNEPAYLILDITGNIT
FT                   ISGNIRAGNFVLYNGTVFLNGNTIESTTGDVVLFGPNYGEDDPQTTPVDTNFAYPDMAT
FT                   LSAVYDPGSYGGAFDAASLGGSTIIVGQDFYANGVDLVASSTWTLTIPDNSASDRIAYP
FT                   VPGGVYGSGSGTYAVVYNCTVAYSNAGPGVVSASTGNGNTDGGNNSGWDFGSPSIVSVE
FT                   TVWDNVLHVTFSEPLENSNGEITLAVQNGLIRFNDETGTYTFDEVYQDAACSIPLPLGD
FT                   VGEFWLKATGPNETWNTDATGSGPGDTNSTDTGGTHSTLTPSLWIEKGALFDTAKNPIG
FT                   PYGINGGSPDTSTVDGVPPVLYRVEYGRADPATTAGTQYHGHNFFHLYYSEPVTIGSLG
FT                   TGAANERSEDLVSTKGGDIEDDGGTRLVVEGYFSIDFGAPVSMERGVQPGTPGGSSSNA
FT                   LYRTLPGLITSPDHELVIFLSGYHDGTGWPGWHRNVPNPAGGTIDAVYDLGGQIVDMVG
FT                   NPLDTSVHASTIDSSSTGSSDWDNPWDVDPPALAPYSPVSGSYEGVLLDTDGDGKVDTV
FT                   DFHFLDNSQDAGSWNSENDHPDPTGGIRDVFSSYPGNQHLAFSFEITGSNNPTSGYNQG
FT                   LSTAVNNSLFGSINQPDDPYLSLSLSGAPWQLVDLNLSVRYDHTKASFTDLAGNLLESF
FT                   GPLPLIEKVPPRIVFTLASAGSDRMYVRFSEPVYGNQAHTLPVGASDVAISGVTGIGVG
FT                   GVERLTLAADGVGVWDVLLTLTRPLSADEAVQAMIGAVDDTSIYDAAGNAMRSADTHRI
FT                   TDVGLGIVEPLWAADRVHSEETGGGFSSLKVFDGSGALLPGDITLQARIQASSLETSSL
FT                   FLVYDVDPPEDVYITTDQYDRTTFPEMWFPVLFPGVNPQPNTEVRTVSPFSSQGALRTF
FT                   LVPGSDPEMREGGTVEFLFYLNNLYCARLTDENDPRTLAPWSFVLSGLKEQRAGVTILN
FT                   NVINPTQGEVTVVNYRLSRAGMVTIQVFALDGSLVRTLQRGLQGAGTYTVAWDGRNGSG
FT                   RVVARGLYFIRVVGPGIDEYRKVMVVK"
FT   gene            complement(123252..124385)
FT                   /locus_tag="STHERM_c00970"
FT   CDS_pept        complement(123252..124385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01073"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU17"
FT                   /protein_id="ADN01073.1"
FT                   /translation="MKGVRHAPMPHLFLLIGGAILVGMGSCSLHDFLGPYHGVNLLEDH
FT                   PFPAWTADDGTGTYMVWEEEASVQYDGENAYRLRTCNLLPNGDFEDASDPPTGWAAAGG
FT                   ASVTREIVSPLEGTGSLRVSIPQQNDHVYYPLTSLIGWPYPEGTPLTVRLMYRVEQTIS
FT                   SFPVEYNDTSNPQPDTWCYRVTATDVGTVYHLPPSEDEALFFSVDTSGSPAFLINSLNP
FT                   IEQAINLEVTLDNVKITRLDAPIWARLSLRASGDTPMELVSGTYRLSFMVRQDPQAGSN
FT                   NVFPASRIAVRFNTLYDTESGSFVDNGYIHSIPAEPSWDAGWVEVSVEEDLTIFPPANP
FT                   DDPVVQICISATDPSSPLTMDAGSILVAHPRLELVQE"
FT   gene            complement(124387..124851)
FT                   /gene="bcp"
FT                   /locus_tag="STHERM_c00980"
FT   CDS_pept        complement(124387..124851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="STHERM_c00980"
FT                   /product="putative peroxiredoxin bcp"
FT                   /EC_number="1.11.1.15"
FT                   /note="thioredoxin reductase; bacterioferritin comigratory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01074"
FT                   /db_xref="GOA:E0RU18"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU18"
FT                   /protein_id="ADN01074.1"
FT                   /translation="MLREGEKAPAFTLPDDNGEVRDLSDFADKKKVIYFYPRDNTPGCT
FT                   KEACGFRDMYETILATGAVVIGISPDSVRSHASFKTRYDLPFFLLSDPEKKVIRAYGAL
FT                   TVRKVKGEEKERVRRCTYIIDEHDVIRAVFPDVRPEEHAREVLEILSRME"
FT   gene            124918..125625
FT                   /locus_tag="STHERM_c00990"
FT   CDS_pept        124918..125625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c00990"
FT                   /product="acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01075"
FT                   /db_xref="GOA:E0RU19"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU19"
FT                   /protein_id="ADN01075.1"
FT                   /translation="MKYSEQFVVRSYEACGRGFLRPDALAGYFQETAWKSAEALGFGYR
FT                   AVVEHGWAWVLSRLLVRYERVPRWGEEVVVTTWPRPSEGIFACRDYLVEDAEGGVCIRA
FT                   TSRWLLLEAASRRPVRPERLVRTGLLEESAIEDAPLKLGPQGEVERVSEVIAGYLDVDP
FT                   NGHVNNTRYIGWCTAGLVLRGGRPETWRGYHVNFVGEAHEGDVCTIWVGNGGVEVRKGD
FT                   VALARMRVEPGSP"
FT   gene            125789..127684
FT                   /locus_tag="STHERM_c01000"
FT   CDS_pept        125789..127684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01076"
FT                   /db_xref="GOA:E0RU20"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU20"
FT                   /protein_id="ADN01076.1"
FT                   /translation="MRLRTTLLFIIGTLLVGSILSIFIFRAGMRRLEDASGFGIQMERA
FT                   IGQFYQYSNAVRMTMSQEAGSTTLVQLMSLWDLAETSFERELSLLIAHPGKALMDESLQ
FT                   SEVEGLYGLWRNTVERMRPTKETVRALSKDPSLPAQYRRGLYVLYTRLILEEGQDARVA
FT                   ELHDTITELQDNLRILDNQLGAELQSLSAVVQERVVLLIRQTQVSVVVAIGFVLLLVSL
FT                   LIARILVVLSRRIRLVERVLNQVNNRDLTVRADLRGKDEFAEMASYINTVLDALQAFFS
FT                   SVRATVAHLNDLRLTFAHTSSQTVAAVTEINRNLDSLSTAFRRVLDEQAGPAVEEVEKI
FT                   HRAIAELSQVVSHQRENVETITSSIEEVNASIQNVTHLLEERMARFEQVREMVHRGGDF
FT                   LSLANSAVQEIGAAISNVMEIIGIINTVAAQTNLLSLNAAIESAHAGEAGRGFAVVAEE
FT                   IRKLAEATAGYASRITTTLREMRDKVEGATRTSRESVQVFDSVVKEIDESVLALNEVVA
FT                   SVTEMAKGGAQVLEGSQEVSRDARLIDERMKDVSRGADVLRGSIQSVYSLSEDVLRGLT
FT                   EIEGGAREILQGASEIERLARGTSEYVERLSGMLGEYVLEGGEDDASGERGDTGP"
FT   gene            127650..128534
FT                   /locus_tag="STHERM_c01010"
FT   CDS_pept        127650..128534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01010"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01077"
FT                   /db_xref="GOA:E0RU21"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU21"
FT                   /protein_id="ADN01077.1"
FT                   /translation="MPLVSVVIPVHNRASLLQEALASVVRQTWRDLEVIVVDDGSEDGS
FT                   AEVGERWGARVVRMAHCGRPGKVRNVGVEHARGALIAFLDSDDLWKPEKLTRQMALWEG
FT                   CARKGIPLVHTREEWMRKGRIISQAGQVHRREGNVFAWAVKKCIIGPSTVLMERRVFED
FT                   LGGFREDLEIAEDYELWLRLTDRCPVAYLDEPVVVKRAGAWEQLSEKYGHIEVFRIMAL
FT                   KPLVDGDVFLPEHRAVAREELIRKCEVYARGARKRGRMEEAERFLSCAEAYRRGEKGGP
FT                   DPWSCPVEESDVP"
FT   gene            complement(128502..129434)
FT                   /locus_tag="STHERM_c01020"
FT   CDS_pept        complement(128502..129434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01078"
FT                   /db_xref="GOA:E0RU22"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU22"
FT                   /protein_id="ADN01078.1"
FT                   /translation="MIPFQFSIPISHTHLRPPGPTWYNHIMKGVIVAAGYGTRFLPATK
FT                   TVPKELLPLVDTPSLQFIIDEFTASGVDEILVISSRRKKALEDYLDREIELELALERAG
FT                   KRDLLARIAPPRAHVFIVHQQEMRGTGHALLCARPFIGDEPFVVAYPDDLHFGNPPLTA
FT                   QLIRTYRETGCCVLASIHDPPDLSRYGVLKLAQDGIHVEDMVEKPAPGTEPSREVSIGR
FT                   YLFTPDVFPLLEEGWKAHTGGEYYHLYALRRLMAQGKVVHTRVEGKRIDTGEPSGYLEA
FT                   ILEYALTRDDLRVPLERWISRHVGFFDGT"
FT   gene            129485..130585
FT                   /locus_tag="STHERM_c01030"
FT   CDS_pept        129485..130585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01030"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01079"
FT                   /db_xref="GOA:E0RU23"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU23"
FT                   /protein_id="ADN01079.1"
FT                   /translation="MSEGRILVVEDDILTLSFLVKLFERRGFEVEGVSSGGEAVRRVEE
FT                   LEAFDLVLLDIVMPGLSGVEVCELIRERYPMFRLPVLFLTALAQPSEVARALDAGGNDY
FT                   IVKPPQEDELFARVRNLIRLKRAVEENEELQELLRLKERLFNLVAHDVKVPASSILQAA
FT                   ALLREGVPPGLRRYLSGIEDAARRILDLVKGFLGYVRVRRLVDLERGAPVDLSVLLLQV
FT                   VQRWKDRARAKGVGVAYGFDRGRRWTVQGDPLLLEELMDNLVGNAVKYTYPDTLVRVML
FT                   EERDGRVRFAVADEGPGVKESDRERIFQEFVSLSKEGGMGLGLALVKEVARLHGARVGV
FT                   EDAEGGGAVFWVEFEGTVERDREDGL"
FT   gene            130607..131287
FT                   /locus_tag="STHERM_c01040"
FT   CDS_pept        130607..131287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01080"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU24"
FT                   /protein_id="ADN01080.1"
FT                   /translation="MKKVLGLVMLGGMLALGGCRVEVDLVLGGQGARGAGKVVVDPILL
FT                   AYWKDLQVEEAPLFDLARLQSTAARYPGFRFVSLDPEGEGVLSFSFEVEEVRRFLASLG
FT                   RDEVASAGTNRGLTIKADRDLFVWIFSLVLGDEETAERLLPPPALSPEDMRAYFHWVFE
FT                   EYATPHEVNLMLDGAALVLRVSADAPVAAVKGGVREGQDAAVFTIPFFPLLAGEERDYE
FT                   ISWE"
FT   gene            complement(131299..132303)
FT                   /locus_tag="STHERM_c01050"
FT   CDS_pept        complement(131299..132303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01050"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01081"
FT                   /db_xref="GOA:E0RU25"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU25"
FT                   /protein_id="ADN01081.1"
FT                   /translation="MQTNPSLFPLNGEFPLFLAPMAELTHSGFRALLHTWGGCSVYATE
FT                   MISAPGLLSKGPYERFYLDFSPDPSRTIVQLVGYDTDSLVQAAGILAEYPILGVDINMG
FT                   CAAPEIRKRGGGAGWLLRGEEAVRLVGEVRRVLPPHLSLSVKIRIPESLPLEEFIAFLQ
FT                   GLMGQGLSFITVHPKGLKEKHDRPARWDLIPPLLEEIPIPVVGNGNITSFDVYRKRREE
FT                   IPGLAGIMIGRKAVQAPWFFAYLRSRDRGEREPFTVNLEEAARSFLELLSRHQPPEFHL
FT                   SRARRFFRYYTRNLFFGHTLLSAILKADSLTEIERLLSAYFERHPEEILHEEE"
FT   gene            132357..134546
FT                   /locus_tag="STHERM_c01060"
FT   CDS_pept        132357..134546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01082"
FT                   /db_xref="GOA:E0RU26"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU26"
FT                   /protein_id="ADN01082.1"
FT                   /translation="MLQVGLLVAGIVLGGGMAFFLLKGRMGKGVGNTMRLLSVVEDALE
FT                   EISQGNLETSIRLSRDGNLKATPGPLRPIQTRLFRLVREVNRITGEPLHRIFYVGSDLF
FT                   LEGITCAEDIGGRLGGRGKVALFARSPRHVGNMLRVQGFRNISGLRFPDLEILGPFFTG
FT                   GTVEDAVRSVREVLRAHPDVAALYCADETSPEGVCRAVKEAGRKDLYLVVHELRDALIP
FT                   YFEDGTLDVAMDQDLFFQGYNTAVHLFNYVVHSWRPASSHIPTTVDRVTKENFRDFWEP
FT                   GKGVRISKERLARRAEPMGPADRPVKILFIGDERYEVFEQIKQGVSQVAEVLSGYNAEV
FT                   EWACPPAHRVRGGKMLSAYELIPYIKEKIAETSPDALAVTVKDRRIFPFLNHLAHEGLP
FT                   IATYNTEPLTVRGLLYGISETAQDLFGLSTVLAQGTEESDLAMREIQSAITEVAESVES
FT                   QQSTVQKGAEAVSHLMGSIQRVREGVDRQVEAVDASSALRGDLRDAVRTLGHQVDRLTH
FT                   VREKMSEVVGRMEELGGFSQTIGEVVASIENVAVRTNLLALNAAIEAAHAGEAGKGFAV
FT                   VAEEVRKLAQQSGVESSRIAQIVAQIQEQVGLTSASMEELSGEIQEQMGSLSSLMESFQ
FT                   VLIGKFLDSVERVSEVIEENKRQADLMDRDAQQVNTMIDEVVAVSEQNRAATEEVSAAI
FT                   RELFAQMGSIRDMARQLAGTAQALKGAIVQFMSWR"
FT   gene            134560..136221
FT                   /locus_tag="STHERM_c01070"
FT   CDS_pept        134560..136221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01070"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="adenylylcyclase; ATP pyrophosphate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01083"
FT                   /db_xref="GOA:E0RU27"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU27"
FT                   /protein_id="ADN01083.1"
FT                   /translation="MSIRIKVVLVIIPILVLSLLIAGLSSYFFATSGITRIAREFLGFK
FT                   ADELEKYMLTQWQVLVESGLSDRPEMRAATQEGMASFAATLIRSTTELILAVDGDGALA
FT                   FSTSPVELTPEEWDTIREVFETGRAEGFFTLRLGDTERVGRGFFFEPFSWYVVLTEART
FT                   TFYQDVEKITTQTIYIVAGSILFASLLVFFFVGYLLRPLSRVVSTMQGIIASTDLSQRV
FT                   PVEYHDEIGELSHTFNLMVEGLDRAYTSIKNYAMEAVVARRNEMKIRNIFQKYVPQDII
FT                   DQFFEHPESMLVGDNRVLAVLFSDIRSFTTISEGMPPDELVEALNRYFALMVDIITARN
FT                   GIVDKYIGDAIMAFFGAPVKRPDDGYNAVLAAIEMTEKVKEFNQRQIEEGKPEFRIGVG
FT                   INYGLVTVGNIGCEKKMDYTVIGDMVNLASRLEGLTKYYHQEIVISESLFRKVEGKLPV
FT                   RLLDTVAVKGKHRGVRIYTVKRELSPRQEEIWKLHNEGMELYYARRFDEAAVLFQRILE
FT                   LDPQDYPAQMLSRRCRLYVVEPPPPDWDGVEKMLVK"
FT   gene            136261..137346
FT                   /locus_tag="STHERM_c01080"
FT   CDS_pept        136261..137346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01084"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU28"
FT                   /protein_id="ADN01084.1"
FT                   /translation="MRKALLTMVGMLWGVSVLSAVPQVRLEEPVVEELDLSPELVVKAL
FT                   VASLEAREVLVEDDAGYVLTTRVWGGGRRGVIAFRLYVEKGETRSLVAAVVASFPLNLS
FT                   FYAEVDRAVEDLLHRWLSRFPEVAAPEDAVFPVEVRGPDEGAVVKVGDVVLGTIEEGVL
FT                   VGDPFRVVLGSRVKLTVEKEGYFPRDVEVVIEESPVVVELPPLLRQHRFEVGLFSTLGQ
FT                   LKGAGVEARWYALPDQVFAGLREYVYGEGGGRWWMPEVVFRSQTEVVAGAYLVGGVSSA
FT                   VRLWMETGIGGYLSFVEGMPFDLYYHLIGLGVEWVVRPGWALYARTGYDYAAGTGLLPQ
FT                   GGLFLYPKGGPALSVGVGYRW"
FT   gene            137340..138299
FT                   /locus_tag="STHERM_c01090"
FT   CDS_pept        137340..138299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01085"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU29"
FT                   /protein_id="ADN01085.1"
FT                   /translation="MVGRARSIAWGLLVSFLLGTACSLFELSRFPFYDRWAEEGVDLGA
FT                   YLEDFGATPFYEHYEAVFTVSDGPSSRYVVLGIREKNGMRGRLFVMDGSLRIRRVLDAE
FT                   DVEEPERFYGRPFVDASDKVVFGDYWIDPEGSGDPELIQGGTYLEGKRFWGEEGGSLYN
FT                   YRLWGDGTDLHIEVCAENWGASTTYTMSFDWDVREGWRVKDRVVLECEKEGERRFLILP
FT                   FDSYTSWTSPLFDNYPWFPLPFEGYDGAVSVTEEGILVSKWEEDVRIHERYNIEGEFVD
FT                   SAEMPWDYEVFWAYAPTGDALYVFDPVLKKVFRGPVWW"
FT   gene            138290..139471
FT                   /locus_tag="STHERM_c01100"
FT   CDS_pept        138290..139471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01086"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU30"
FT                   /protein_id="ADN01086.1"
FT                   /translation="MVVRDGLRRLGAVVLFCVLAGGMWGQTVRVAVYADPEVHEAPIWY
FT                   EETLALLTSYSWVAVEEAGSLPPGWRDDAKRRGVSAALLITAEDDALRYRAYRFDTEEE
FT                   VFDFRVDTAVSSPLVVKARLSPLKEALDGLDARFRGVHDLATKGEGMLVVEAVPGTLLE
FT                   GIFTDPVEVGEEGVIRFRLPAPSTYVVRGLREGYTTEETVAVLRVGEETRVVLPQERVV
FT                   GVVTGVNLQYFQFPGWSIMYEVVPDWFSAGGGVDWYGVGLYLPERPWESDRQAGFVSFA
FT                   LIEPWIGLRTTFIRWRSGVSLFGAMRVFLRVVYPEGLWGIDPVAPGGVVLGSGIRLPLS
FT                   RRWAMVVEGGLSAYMTKNRLLFYEMLGEEAEQAEDIARSIFRPGMKAGVEVTW"
FT   gene            139465..140499
FT                   /locus_tag="STHERM_c01110"
FT   CDS_pept        139465..140499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01087"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU31"
FT                   /protein_id="ADN01087.1"
FT                   /translation="MVTDRHRVSAALFSFLVITGCMLPPYDEDLLLTLFVLDGRLEKVG
FT                   ETGVVGVLWDSSYEDLAYFPERDAIERGVVLMRGRDHAQVRWISGKKNLMDQGVPPGVA
FT                   RVVMGSSNEEQAQAFLLYYDGGGWWIMPGERNGEGVSWGNPESLSSLFPSAGVVVYGAF
FT                   ASFQGSPSEPLYVALLSGDGAGTYYEHVATGSVWGLSPYDVNLDLRELGSSGISLSRVS
FT                   GPGVYLFDVFRYESFFLGPGASSLHVWYEEEGALRERDVPVEGVPLEVTPSGYLLTYEE
FT                   STGEFLVYDSAFSLKDRFSAGRLSPAGWYEWEGKEVFFFSLPHILQTKEGAAAFFEVYA
FT                   YPLE"
FT   gene            complement(140504..142900)
FT                   /locus_tag="STHERM_c01120"
FT   CDS_pept        complement(140504..142900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01088"
FT                   /db_xref="GOA:E0RU32"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU32"
FT                   /protein_id="ADN01088.1"
FT                   /translation="MGGLLERAKRYRAEGGFIIMEETGPSETRRPTLNKEEEQEILKEI
FT                   EEIVEKERIRVDETTFRITARKRGVFLPLLINVLALLAIAGAFIGFRYLTTQEQEKIAS
FT                   GRGTINAVEARLIQEIQREAQEKLRAKEQEIASIQKRLQELQAQQEQLQTEMEERIREK
FT                   EIQLREQLSLELAKERERLQAAGVPEEQIETRLAEFEAQKQQEFEQELARFREEAEEER
FT                   QRLLETITRLREEYQATLTRLTQERETLQTEFQRREAELRRQYEARTEALQAQTREAQT
FT                   ALEEARAELGRLSRMEEEARAVENQILGLYREIRSAIQNQEYGRARELLTALQDLLTQP
FT                   RVAALTPLSGRRQIDLFITETLSRLIEQEQQARLDTATLLAQSRLLSRIEDLVAQARTA
FT                   LSSGDTARAEELYTAALDAIPAVKESHEYLLQMVSEEEARRREALTSALSRAEDAYRRG
FT                   SHQEALAAYREALTYLPLPASRREALVSSLLDIGGRTALARVEREGEDAASTLLTQARS
FT                   REAEGDYPSAMEAYARILSRLSRTPAGRQAFEGLTRSMRAYNRQVEQEDTAHEREAARF
FT                   MEQISSLEEQIEALRSENTRLREERDRMARETPTLPPEEEAQLQREIERLTQENDTLTV
FT                   KIQELTRQLAAAQEELEARPPATTDEELASLKARIETLEEAEARLEALSRGYASYARSE
FT                   DQLLSRYGEQGRVEAKSYLDAFLGSSEVEATFPGLLTRIKEYDRAFEKAGREAALLEVI
FT                   DLVEALTVLPSREERLDFLEEQAQEAEEGSLLREVIQALKILLGK"
FT   gene            complement(143021..144625)
FT                   /locus_tag="STHERM_c01130"
FT   CDS_pept        complement(143021..144625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01089"
FT                   /db_xref="GOA:E0RU33"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU33"
FT                   /protein_id="ADN01089.1"
FT                   /translation="MLKNLRLSYKIILIALIIIVLYSLFVLLYVYPEVRKDLYAEKYLK
FT                   TRHVVEVAYGVLVFYAQKAQEGVFSTQEAQERAKELVRQLRYEQEEYFWINDTRPYMVM
FT                   HPYKPELEGTDLSDYEDPNGKKLFMEMVKVCNEKGAGFVDYMWPKPGFDNPVPKISYVK
FT                   LFEPWDWIIGSGIYLDDVEAETGALFNLILVSIAVIVAISLGLAILMARSISLPITNVS
FT                   GNLLASSNQLESAATQVSSSSQELSSGASELASSVEEITSNMEELQSIIESNTKTVTEA
FT                   ELLMKETNESAGLSTRQTEELQNAMTLISENARKIVKINKVIDDIAFQTSILALNAAVE
FT                   AARAGEAGRGFAVVAEQVKSLAQKSAEAAKETTELIETVVDSIDSGQEKLSTVKESALK
FT                   VSTLAGKVNVLLDEITTAFKEQSRGVSQVTKAISQVNTVVQGTAASSEETASAGEELLS
FT                   QVEQLREVVVVLNRIVNGARAAAAAHADGEHHTEKDRPPAKTPPRTTPPPRDPHDHKDV
FT                   EIIRPEETLPLDDFKDF"
FT   gene            144791..146215
FT                   /locus_tag="STHERM_c01140"
FT   CDS_pept        144791..146215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01140"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01090"
FT                   /db_xref="GOA:E0RU34"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU34"
FT                   /protein_id="ADN01090.1"
FT                   /translation="MRKNTKIIATISDSRCDFSFIKALIEEGVDAFRLNTAHQTPETSK
FT                   RVVDAIRKVSSHVAIVLDTKGPEVRTRLGGAPLEVQEGDVVWVGGEPVEDAPWFSTSYE
FT                   RFVEDVPEGARLLIDDGEIGLLVEERKAGRLVCRVENEGVVKDKKSINVPGVHLSLPAL
FT                   TGKDREYVRFAVEEGVDYIAHSFVRSREDVEEVREALERAGGDAGTVGIIAKIENREGV
FT                   DHAEGILDTCDGLMIARGDLGIEIPAEEVPAIQKRLIRLCMERAKPVITATQLLHSMIE
FT                   NPRPTRAEVTDIATAVLDGTDALMLSGETAYGKYPVEAVKTMVRVASTAEKMRPELPEH
FT                   DIVGYTNPVRYFLSQVAMKASYRLPIAAIIVHTYTGRTARLVSSFRGKTPVYVFCHDSR
FT                   VARRLALSYGVYPRVIELPESTDELVKESISSLLTEGDVRPEDLVLILAGSPPHQSNSS
FT                   NFLEINTVATYLKERG"
FT   gene            146266..148566
FT                   /locus_tag="STHERM_c01150"
FT   CDS_pept        146266..148566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01150"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01091"
FT                   /db_xref="GOA:E0RU35"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU35"
FT                   /protein_id="ADN01091.1"
FT                   /translation="MLSQRELKRTMRYSLLSGVAFVFWFQVCSPQSLFNVFIKNHLGAG
FT                   ASGLGLLIAVISMMGVLQIFAVPLFNMVKTPKWLWLITHVIHRLHSFVLAGVAFSVASG
FT                   GDKETGFWIIVVTMGVSWALTNLTGSGWWSWMADLFPEEIRAEFFGKRSALSNVVNMIW
FT                   FFAVSLSLDLVPEEGVFLFWGVVFIIGGIGGLADILFHLPMPARSHEREQGVGFKGLWE
FT                   PLKDERFRPFLFVIGTVLFAVNLSMPFLSPYIVDPRHVGAPNFWLGIQFILFQITWVLT
FT                   APLWGLSMDRFGRKPAVVLGVLGRLSWVGFLFLSPTNYQVIIPLASIVTGIFGPPLWDG
FT                   MQQMMLSLAPERGRVSYVAWFWLVWGVASAGGSALGGVISDAVDAASFSIRGVGPVDGF
FT                   QVVLSLSLFLCAVALMVLMGIEEGKGKTARYVLARLANPGVVRTYVNMGIIRGSAPSER
FT                   VVSALRAVNERDSLLLEEVKARLNDPDEEVRREAIQALARLRASSAVDLLVSHLRDDSS
FT                   SLRVEAARALGAIGDPRAIPALIEGLTSSSPELQLACTYALGEIGGEEAAGVLLSTLKD
FT                   EESPEHLKVSGATAAAKLGVLEAAWEIIPLMHRSPNRVLKTQLAIALANLLGRPGEFYR
FT                   LVTGGEQEEVRERMLRSLPAQCSRLLFRMGLPSKEVETIRKGITEAVDLFLEGRKEECR
FT                   ETLGEVGKRLVLLCAEARNVEEGTVFEKACRLDQRLGVWWWLLKKARETDDPGQLELDL
FT                   LVLLYALGVMEIP"
FT   gene            148673..150883
FT                   /locus_tag="STHERM_c01160"
FT   CDS_pept        148673..150883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01092"
FT                   /db_xref="GOA:E0RU36"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU36"
FT                   /protein_id="ADN01092.1"
FT                   /translation="MKALLKNLKTLERCLSSYVPGDVIALAEIRELLGEVRREFERTPS
FT                   LKKLEGVLATFLQISDRLASDPGLEAGFVELLSGVVGDLILFFTRKIEAKTFAAHLRSF
FT                   IPRLKEMLSSSAPREEKGRPRYPSDYFDALVDDDRLLSQFFHEASDHLNEAQYTLLDLE
FT                   YDPTNKELVNDIFRNFHTIKGSSAFLGLRNIEEVSHSIEDLFVLVRDDKIFLSRDLIDV
FT                   VFYGIELIRVLLDIMETSGFEREKMTQAFLQVDIFTYLHLMERILTEYTVKKIGEILQE
FT                   EGKLKPEDLHVLLERQEKGGGERMPLGKLAVEERLVMPEDVVGALKKQQDQRAKARRLG
FT                   YVKVSNEKLNMLIDLVGELVIHQSMLQQHLLAEEDRERLDRTLTSLETTTSTIKNLVLS
FT                   LGMLPMGDLFNRLRVAIRHTAEELGKAIIVDTEGEETELDRNMLEVLYDPLLHLVRNAV
FT                   DHGIESPEEREKAGKLRVGKISLRAEHRGSGIQIVVEDDGRGIDRKKVVEKALLLGLVR
FT                   KEDAGRMSEKEVYDLLFLPGFSTKERVDTTSGRGVGMDVVKKNLESIHGRVEVESEEGK
FT                   FTRFIIGLPLTLAIIDGLVTVIGKNRYIFPFGAVEEIAVIPRDRLRMEEEQNATLLFHR
FT                   GRHIPVLFSHRILGEERHEEGDSFLGVLVLHERSSYCVVVDEIVGKQEVVIKNLGGLLS
FT                   GYRYLSGGTIFGDGSIGFVLDIQGLIEEAEARSAAKTVLREV"
FT   gene            150884..151249
FT                   /locus_tag="STHERM_c01170"
FT   CDS_pept        150884..151249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01093"
FT                   /db_xref="GOA:E0RU37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU37"
FT                   /protein_id="ADN01093.1"
FT                   /translation="MKHIMVVDDSEVILRIVSQTLQMHGYSQILTASNGKDALPIIKEH
FT                   LGKIALYIFDVNMPEMDGLSLLKEVRALDKTTPIIMLTTETDKEKIIAARESGATGWII
FT                   KPFEGEKFIKVVKMYLG"
FT   gene            151267..151788
FT                   /locus_tag="STHERM_c01180"
FT   CDS_pept        151267..151788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01094"
FT                   /db_xref="GOA:E0RU38"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU38"
FT                   /protein_id="ADN01094.1"
FT                   /translation="MADPVLNKYLLFSLGEEHYGIPIAKVQEVVRYIPITRLHDTSRFL
FT                   KGVVNLRGRIVPIIDLRLKFGFEERPYTDRTVFIVVEVLSPRSPYLVGLAVDAVEDVVE
FT                   IPDTRVEKMPSVGGKMKSHYLYGLVQLDDRLVLLLNLEEILSTEEVVKISEKVEPQKVS
FT                   PEPSPSQRKG"
FT   gene            151791..153368
FT                   /locus_tag="STHERM_c01190"
FT   CDS_pept        151791..153368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01095"
FT                   /db_xref="GOA:E0RU39"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU39"
FT                   /protein_id="ADN01095.1"
FT                   /translation="MKRTSSWFASIRALTVLAEVGLVASLLLLVMMQVFDMEGWTFLPL
FT                   LLVVLFVLLGLVVFLRRERRYIVELEQVVEHTIDAYRGVSLQLLLAIGDIYRDMLSLQE
FT                   EYLSPLPAEVEESRSMLDRVFSSETEFAKLIEEERKRIDGLKGVDLKKLLRGVAGFEVI
FT                   SRRYILASLVILGTVVKKMKEVISEKLELSRSMSRGLVEVSIVHDLIKRWDELSDQLIV
FT                   KEVSQSFQEIAPMREMLEKTLKVLAGDIPEMKRQQEEAREFLLLQRRRLEEFFEVMEKV
FT                   KYEFSLSMERYFDELKGIPSVVKEISEIAENVKMVSFKLSIEASKAGDRSFTLIARELR
FT                   TLSEKVSLFAKEITGRVSLTTQTVEKERRIQLEKLEELERIMGESSSLTQELDRYDESV
FT                   RRISDSFEMQLKRIGNIEEYGREANRLLMRFFEIAQQLVIVQEELLHRDAFVEELMQGL
FT                   QKHLEDFVSREESYRENKEVVRAILERLKSRITTKRERLLLKDFYRKFLGEEWEEDVSP
FT                   TDDSIIIF"
FT   gene            153378..154190
FT                   /locus_tag="STHERM_c01200"
FT   CDS_pept        153378..154190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01200"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01096"
FT                   /db_xref="GOA:E0RU40"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU40"
FT                   /protein_id="ADN01096.1"
FT                   /translation="MSALSPSMFTRLSGLFYEITGIRLKEYKRYLLEYRLMRLVGPDRR
FT                   FSSFEELYEALREDHTGELRGLFVHLLTTNYTYFFRESLHFPVVREYLQGRGREEPYVR
FT                   IWSAGCATGEETYSIAMVVRDALPDVDARDLKILGTDISPEVLYVAHAGVYPLRKIQSS
FT                   PYDHLLARYCRFDEREGILEVKDEVKRLVTFRRLNLMDPYPFRRMFDVVFLRNVLIYFD
FT                   LPEKERILSKVYDVVKPEGYLILGLSESLVGVRHRFLHLKASIYTKRG"
FT   gene            154192..154680
FT                   /gene="cheD"
FT                   /locus_tag="STHERM_c01210"
FT   CDS_pept        154192..154680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="STHERM_c01210"
FT                   /product="probable chemoreceptor glutamine deamidase CheD"
FT                   /EC_number="3.5.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01097"
FT                   /db_xref="GOA:E0RU41"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:E0RU41"
FT                   /protein_id="ADN01097.1"
FT                   /translation="MHEYFLHPGELIFSRRHMLVKTVLGSCVAVCLHDKVQRIGGMCHY
FT                   LLPVAPTDEQRSTKYGDVAIRVLLSKFLGKAGSRKEDLLASVIGGAFVVFDEREIFFVG
FT                   DRNVEVALRLLKEHGVYVLQMNTGGDYGRRVLFEPHTNRLVVEQIKGVTVDDLYNPEA"
FT   gene            154684..155751
FT                   /locus_tag="STHERM_c01220"
FT   CDS_pept        154684..155751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01220"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01098"
FT                   /db_xref="GOA:E0RN98"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:E0RN98"
FT                   /protein_id="ADN01098.1"
FT                   /translation="MSEKIRVLVVDDSAIVREVLSRLIGGAPDMELAGTAPDPFIARDK
FT                   ILRTNPDVLTLDIEMPRLDGLSFLERLMHYRPLPVVVVSSVTTKDSTAVVRALELGAFD
FT                   VVNKPGDSTSVGEVGEQILEKIRAAYRYRDQFIGKWRLLKEKGARSGPPAHHLSVVETT
FT                   EKLVVLGASTGGTVALEEVLSRLPRGMPPVVVVQHMPPVFTAQFARRLDELCTLRVKEA
FT                   EDGERLEKGTVYIAPGGYHLVLERRGEFLYVRLTRDEKVNFQRPSVDVLFESAAEVAGK
FT                   NTLGVLLTGMGKDGAEGLLRIKEAGGHTIAQDEASSIVWGMPRVAVEMGAAKEVLPLDR
FT                   IAERMVKVVSSEGGG"
FT   gene            155807..157210
FT                   /locus_tag="STHERM_c01230"
FT   CDS_pept        155807..157210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01230"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="IPMI; alpha-IPM isomerase; isopropylmalate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01099"
FT                   /db_xref="GOA:E0RN99"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E0RN99"
FT                   /protein_id="ADN01099.1"
FT                   /translation="MAGKTLFQKVWEAHVVDRLPTGQYQLFIGLHLLHEVTSPQAFAAL
FT                   REKGLKVAFPERTFATVDHIVPTHDQGRPFVDPQAERMMQELEKNVREFGIRFFNLESG
FT                   RQGIVHVIGPELGLTQPGMTIACGDSHTSTHGAFGSLGFGIGTSQIRDVLATGTLAMEP
FT                   LKVRKIEVNGRLGPGVTPKDVILFIINRLGVKGGIGYAYEYAGDVFEDMEMDGRMTVCN
FT                   MSIEGGARIGYVNPDEKTFAYLKGREFAPRGEAWDRAVAYWRSVASDPDAVYDDVVVFD
FT                   AAEIAPMVTWGITPGQSVPVDGVLPDPAALPESEREIAELAYRHMGFRPGMRILGTRID
FT                   VAFVGSCTNGRISDLRAAAELVRGKKVAPHVRAFVVPGSMQVKRQAEEEGLHEIFMDAG
FT                   FEWRGAGCSICLGMNLDRLEGDQISASSSNRNFIGRQGSPKGRTLLMSPQMVAAAAIAG
FT                   EVVDIREVG"
FT   gene            157220..157816
FT                   /locus_tag="STHERM_c01240"
FT   CDS_pept        157220..157816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01240"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01100"
FT                   /db_xref="GOA:E0RNA0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA0"
FT                   /protein_id="ADN01100.1"
FT                   /translation="MTNIIRIAGTMVPVRGNDIDTDRIIPARYLKEITFERMGEYAFYD
FT                   ERFGEDGTPTDHPFNRYAGASILVANANFGCGSSREHAAQAVMRWGIRAIVAESYGEIF
FT                   AGNCTMIGVPPVVASQEVVEALQTLAEARPEARVEIDLEEMVVRGEGFSYPVSMPEGRR
FT                   EAFLKGYWDSTALLLSNIEKTRKVAAGLSYVRGFE"
FT   gene            157834..158991
FT                   /locus_tag="STHERM_c01250"
FT   CDS_pept        157834..158991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01250"
FT                   /product="putative leucyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /note="aminopeptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01101"
FT                   /db_xref="GOA:E0RNA1"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA1"
FT                   /protein_id="ADN01101.1"
FT                   /translation="MHRSNPKKKEYSVRFLTMGIHDERLVKPARAVVQESLGVKAGERV
FT                   LIVTNPGAEIFRIASAVYDAAAELGARPVLVVQPRKTSLDYAEDAVIEALASEPEVFCS
FT                   LSEEKLGKDRRGLSRPYVWEGKEYDHIHGFLREGKKVMRSFWSPSLTLDTFLRTVDIDY
FT                   EALASVCRKVKARLEGAVEVHVTSPSGTDLRFSVEGRTPFLDDGLFREPGEGGNLPAGE
FT                   VFVSPVVGSAEGMVAFDGSIALAEGIAIPSTPVRVTFEEGYVVSVEGEDEAAELLSASL
FT                   EAGKKRALAFEQEGLLPRGQGEVYARNARHLGEFGIGLNEKARIVGNMLEDEKVYGTCH
FT                   FAIGSNYDEDAKALIHLDALVKNPTIRVRRDSSWEVLMEEGTLVG"
FT   gene            complement(158988..160250)
FT                   /locus_tag="STHERM_c01260"
FT   CDS_pept        complement(158988..160250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01102"
FT                   /db_xref="GOA:E0RNA2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA2"
FT                   /protein_id="ADN01102.1"
FT                   /translation="MIVPLLVLAFLLFLSAFFSGTETAFTSLSFVDIQTLKKKAPKKGH
FT                   LIEKMLSQPDIFLTTVLIGNNLANLSASAFTTTLTIRLAGSTAVGLSTGVLTMVVLLFS
FT                   EILPKRLAFHHNTFIALHTVRILWILSFAFRPVIWILSGITRILLPRNEQPPLTEEAIL
FT                   HTLSLAHSTGAIEPYKTRMMRRIIRFSEATLHTIMTHRTRIFSLPQALTVGEALPHVLA
FT                   RPFSRIPLYHQNPEDISGIVHLRDLLKAHAEGKADTPLFRLAVTPLFLPETMRIYNAFT
FT                   ALTKAQHKMAIVLDEYGGLAGLVTTEDIIEEIVGELYDENEQKEETPLRRLPHGWYKVA
FT                   GKAPLYLLLETFELDLEEKPDASTVAGYLTEVRGTLPESGEVIETPLGTFKVTVRSRTS
FT                   IDWVEYLPPGREEHGEGPLPR"
FT   gene            complement(160433..160789)
FT                   /locus_tag="STHERM_c01270"
FT   CDS_pept        complement(160433..160789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01270"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01103"
FT                   /db_xref="GOA:E0RNA3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA3"
FT                   /protein_id="ADN01103.1"
FT                   /translation="MTHKLTTEDFKEKVFDYENETEWKYKGEVPAIIDFYADWCGPCKM
FT                   VAPILEEIADEYEGKLVVYKVNTDEEQELAMVFGIQSIPSILFIPVEEQPQLAVGAIPR
FT                   EVFDQAIKEVLHVE"
FT   gene            complement(160817..161491)
FT                   /locus_tag="STHERM_c01280"
FT   CDS_pept        complement(160817..161491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01104"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA4"
FT                   /protein_id="ADN01104.1"
FT                   /translation="MKRILLALPMAIVVILLAVTLVLLRFRLDTPPSIDGSTPQFLSER
FT                   ELSLLVTTEYTVKIVFPHDFLPAGTTPSVYRTLTRKAASGEPLTPDETANMEVYDFLDR
FT                   LGHPFYLFPYDFIVVDLTVRAGYDFSDPTLPPLAAWWNEDGLLEVPPAAILSITMGDTP
FT                   HTEHYPAIRLSASQWKETSDFIISHAPSILPVEDILEHATRSARRALGALLSGRRASSM
FT                   LY"
FT   gene            complement(161488..162042)
FT                   /locus_tag="STHERM_c01290"
FT   CDS_pept        complement(161488..162042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01105"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA5"
FT                   /protein_id="ADN01105.1"
FT                   /translation="MKPLLPFALLLLLLSTCRPSPPPPERIAYHIKEVLLLGTYEYTYR
FT                   DIIYIEDPNWLARLFKVDHPLLFSIVYHIQAGIDLSTLTITRHPTDPGHLIITHEPARI
FT                   LSIDADERAIHEYFGAPNTYPHPRLLEEINRRKPAVEQLAISQGLLEKAQTRGHLLVEE
FT                   FLREAGYTTIEWHIESGGPEG"
FT   gene            162137..162916
FT                   /locus_tag="STHERM_c01300"
FT   CDS_pept        162137..162916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01300"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide
FT                   isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotideisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01106"
FT                   /db_xref="GOA:E0RNA6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA6"
FT                   /protein_id="ADN01106.1"
FT                   /translation="MREGSRMWCVPAIDVLEGRGVRLLQGDYGRVTVYDEDPVARVRAF
FT                   VEAGARRVHVVDLDAARGRGDNRGVIARMVRAAGEGVVVEVGGGVRTERDVEELLSVGA
FT                   GALVVGTVLVRDPGRVERWVREYGRVFWAGIDARDGVVRVQGWEEEGGVEDVALAGRAR
FT                   DLGLCGVIYTNIARDGMLSGPDVEGAQRVGEAAGLPVVVSGGVGGVEDVRRVAAEGGRW
FT                   VRGVILGKAVYEGRVDLPALFREFPQGDLVRLEGRMM"
FT   gene            162913..163482
FT                   /locus_tag="STHERM_c01310"
FT   CDS_pept        162913..163482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01310"
FT                   /product="phosphoribosyl-AMP
FT                   cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01107"
FT                   /db_xref="GOA:E0RNA7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA7"
FT                   /protein_id="ADN01107.1"
FT                   /translation="MTHKSETKEAFVKEAVFPAVCVDGEGRVVGAVLQNEKARDKSLEQ
FT                   KEVWMVHPATGRVVPAGMGPVVRVVQEDGWVRVVVRGKGSGEVQGEEGVVRADEGGVLE
FT                   RLEGVVRARRSAMPEGSYTTHLFSSGGEKIRKKTGEEAIELLLAPSRDRIVYEAADFLY
FT                   HLMVLLVWEGIPFRDVLEELSRRFDQ"
FT   gene            163489..164628
FT                   /locus_tag="STHERM_c01320"
FT   CDS_pept        163489..164628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01108"
FT                   /db_xref="GOA:E0RNA8"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA8"
FT                   /protein_id="ADN01108.1"
FT                   /translation="MRSSVLRYVMVVLVLLVVVAGGVWIASSGSGRRVYTVGVLLPLGD
FT                   RELAPIGRRIKALVERFSEEVVEPEELPWRLRFEFLDTGGDPAQVIRTMRSLLLSGKDV
FT                   VAFIGPHISRTAIPAGGVAESLGIPLIAPIATHPAVVGGRQYVFRLVASDEFQARVLCR
FT                   YAYERLGVRRMGVLFDGADDYSRDMAAQISRIFPVMGGEVVVEGFVSEEERREALERLV
FT                   GHEPEGVVLPLFREQLVLAAGELEAAGYTGSLLGPDSWGTLTPEDRISGYWVTHWDFTF
FT                   NDSPSSRFLERFLAERGEEPDVYVYFCDALFFLWESVKGLDLLSPEEVRNALTMKRGFV
FT                   GALGSCVFLEDGEPWRHLYVMERLPGGRTVVRDSLDPVE"
FT   gene            164631..166172
FT                   /locus_tag="STHERM_c01330"
FT   CDS_pept        164631..166172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01109"
FT                   /db_xref="GOA:E0RNA9"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNA9"
FT                   /protein_id="ADN01109.1"
FT                   /translation="MRGGRFHLVVVTGVLLLIHAGGLFLVVETAKSGVQRDLRQELDRA
FT                   HEVAALWREGALAAVEVLAAHPAVRAVLLEEGSPSDLIPFLEDLLGRVPLFERVCVLSP
FT                   LGDARVSIPAGDLPFWREPFFRRASSKAERPVWEGVYLSPVFLSHKAVVWMRSRGGALL
FT                   VVYLSLDDLEERLHRVGSHVVLLDGFGTPLEEELLEERFLSILRRGDGGVGRMRYQGRS
FT                   WYYGISWMDEVGLFFVAMRPASIVFPPLFLFLWGVLAVGGYLAILLSVKAGEGRVRATI
FT                   DTVSRSKGEDLSLLGLTADVVSNLFTGMYGMVKTMLGELAQRGGDVAERGVVLARELAK
FT                   ARAFAHQVRILSRGEPGDVGVWTVVSLIALVGERLGEDLVRRLDVISDPSLSFRGSREH
FT                   AAIALENVVRVLFSFDEDAFVVCRTTRRVLSGGEYTMISLYTPAGPEGFASSFGGRPME
FT                   GVDTGLQDPGILLAERVLSLQGGFLGFRGVAGGLLCEMALPAGEDVPGSRGRQKG"
FT   gene            166256..168226
FT                   /locus_tag="STHERM_c01340"
FT   CDS_pept        166256..168226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01340"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01110"
FT                   /db_xref="GOA:E0RNB0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB0"
FT                   /protein_id="ADN01110.1"
FT                   /translation="MDRKALEKIALSVRSLSMDAVEAAKSGHPGLPLGAAEIGAVLFGE
FT                   VLRLSPHDPAWINRDRFVLSAGHGSMWLYSLLHLAGFDLPLDEIKRFRQLGSKTPGHPE
FT                   YGHTAGVETTTGPLGQGFANAVGMAIAQEMLAARFNTPEFPLIDHYVYALAGDGCLMEG
FT                   VSAEAASLAGHLKLGRLIVFYDSNRITIEGETDLAFTEDVGARFSAYGWQVLEGDGYDM
FT                   EGILSLVEKAKAERERPTLIILHTTIGKGAPNKAGSHEVHGAPLGPEEVKASKRRLGIP
FT                   EDVQFYVAPEAYAYFEERRKAWRGEYDRWQRMFSEWARTYPEKKAEWDRFFGPVDLSKV
FT                   SFPSFERGSKVATRKASGEVLKALAAGVPNLVGGSADLAPSNNTALPGYGDFSVEDRTG
FT                   RTLHYGVREHAMGAVANGIALYGGLRTFCATFLVFSDYMRPPIRLAALMGLPVTYVFTH
FT                   DSIFVGEDGPTHQPVEHLASLRAIPNLLVLRPGDAEETVLAWRLAMESSSTPVVLALSR
FT                   QGLPVYEKPAAWEEDARRGAYVVKDCEGTPDVVVVATGSEVSLALAAAGEAEGRRVRVV
FT                   SMLSRELFLSQDEAFRERIVPRDVRTVVVEAGVALGWEGFVARRDDLVTLDRFGLSGPG
FT                   GQVAEALGLSKERVKQRIMGQ"
FT   gene            168357..169859
FT                   /locus_tag="STHERM_c01350"
FT   CDS_pept        168357..169859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01350"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01111"
FT                   /db_xref="GOA:E0RNB1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB1"
FT                   /protein_id="ADN01111.1"
FT                   /translation="MAYLLGFDVGSSSIKASLLDAETGKRVAQAVSPQVELEIKALKPG
FT                   WAEQSPLTWWEHVKRAAAMVREQAPSGMAQVAGIGISYQMHGLVTLDREGRPLRDAIIW
FT                   CDSRAVPYGEKAFRALGPERCLAELLNSPGNFTAAKLAWVKEHEPDVFERIWKIMLPGD
FT                   YIAYRFTGRVATTPSGLSEGILWDVKDDGPARFLMEYFGFPEDILPEVVPSFSDQGRVL
FT                   KEVAEELGIPAGVPVAYRAGDQPNNAFSLAVLNPGEAAATAGTSGVVYGVTDRPAYDTR
FT                   SRVNTFVHVNHGKTHPRYGVLLCLNGTGILNRWVKQQAVDLDDRTVGYEVLNEWASRVP
FT                   VGSEGVVILPYGNGAERTLENRDIGGSIHHLNFNIHRREHLLRAAQEGIVFALAYGMEI
FT                   MEEMGMPTEVVRAGHANMFLSPLFREAFANTTGARIELFDTDGSEGAARGAGVGVGIYS
FT                   RPEEAYVGLSRKGEVSPEPDLMERYREAYERWKETLRTVLGG"
FT   gene            complement(169918..171747)
FT                   /locus_tag="STHERM_c01360"
FT   CDS_pept        complement(169918..171747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01112"
FT                   /db_xref="GOA:E0RNB2"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB2"
FT                   /protein_id="ADN01112.1"
FT                   /translation="MRPMIEVKRTWYRLLLPVGYLFLLFLVVLLSFSGGRVLTSSWHGL
FT                   TVHTREVPGPEGVSILEEVRIDYHGLSLRFSRKTPLEASTDSGGKLPVVPLAFTGSSDE
FT                   LTIEASEGVRIRIIPSVGDSLRIVLSAPPRMTRLTIPFSLSGGLKAQVAEDLPILALNP
FT                   SGDDQYYLSLPGTSRILLEQRILEVGLSRDGNGTLTLGAPSGGKAVFAFWYRSQNRSIT
FT                   PRQVAAAIQQFVDSAYKGWQSRLLPDRLVWNYETERGIHEETVIAYAAESIRRNTFPDV
FT                   VDTLARMREAHPAAFTFLSNPYLGDLQRTSEAFFQDLDDLLEAYLDSLSPGAPSPLHTI
FT                   PDLYDLLVMSRTLGGSGRWLSRVQGLLSSLDPERLSPAQALELLRLFHRVRRSSPALLD
FT                   TTPIEPLFDTVLYPALTLTDEGLFVASGGRADIRLSLAAAAILSMEGARRGDPLMEEVS
FT                   RDLYVSSLKLVGPSGTLPASFPVDDPRQREGIVFPEEVYPFVMPDAPLPHIVPLLQGED
FT                   LTGWVWTILEFPRISVSETELLMEFEFPEGWIHHMVIQGVRPYTRLEILRLTWRTTPVF
FT                   EIYPMGAYYTPGNETLYVKYRHREQRERILVTY"
FT   gene            171856..173220
FT                   /locus_tag="STHERM_c01370"
FT   CDS_pept        171856..173220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01370"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01113"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB3"
FT                   /protein_id="ADN01113.1"
FT                   /translation="MRLRIVPVCAASFLVMISMGCRTTQPGETVLPEEEFPYQAISYFV
FT                   ELGRPEDAIRAFEEASARAPEDPETRLLYVNLLLMAGKETEAEAELSKILEEYPDHVGA
FT                   LYTLALLEGARGREEEHRRLLERILVLDPHHTGARAALGELLLSKKQYARAEKEFTTVL
FT                   EQDPGDLVALVGLGNVYLRTRKAEKAAEVLTRAIQEAPDYPFAYADRARAWQMLDEPEK
FT                   AERDISRAIELDPGFSWHYYDRARILISEGQMDRALEDLSRAILLDPSNFLAYVYRARI
FT                   YDGKGMMKEACSDYARALELRPDYYYIYVPYAVSLYHEKDYRGAAGYFDKGFDAYPSEY
FT                   PLILLAATAYKRAGDDRMMRDYLTRRMPQIPRDSIYYFVARYYLEGKGDSLVLTRLRDI
FT                   ADKVERTRVYFFLGIMAEEEGHPRLAQTYFTEVADNPSLRAIEGRMASWEMEKYR"
FT   gene            173217..174179
FT                   /locus_tag="STHERM_c01380"
FT   CDS_pept        173217..174179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01380"
FT                   /product="DHH superfamily protein, subfamily 1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01114"
FT                   /db_xref="GOA:E0RNB4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB4"
FT                   /protein_id="ADN01114.1"
FT                   /translation="MRVSELLDVLVPGVPVCVLVHDYPDHDAVASAAGLVWLLSRRGWE
FT                   AQVVYRGMLESESLKEALSRYPVPLSSLDGVDETSVQFVVVDGFYGSGHVPSVGGKVMG
FT                   VIDHHEPEAFPPPEGIPFVDVRPSYGACASIVYEYLRDLDLSPPSWLATFLMLAILMDT
FT                   EFLARGVSPAEMDALAGLYRMGDLSEATGILSNSLVIEDLPVLSGMWRRLELSPPGGFV
FT                   FVDGPARSEVMAVMGDLILRFREITCVFLCARDGDGYRISVRSEDGRLPAWMVVRRVLE
FT                   GYGVGGGHVHMGGGRVDAGVWPGEKVMRERFISVVKELV"
FT   gene            174176..175369
FT                   /locus_tag="STHERM_c01390"
FT   CDS_pept        174176..175369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01390"
FT                   /product="TraB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01115"
FT                   /db_xref="GOA:E0RNB5"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB5"
FT                   /protein_id="ADN01115.1"
FT                   /translation="MSDVHTTDTVKRLVFADREIILVGTAHVSKQSVEDVRVVIREEAP
FT                   DGVCVEIDPQRLSVLRQEERWTNLDVYRVLREGRGFMLLANLVLSSFQRRIGLETGVKP
FT                   GEEMKAAVESAEELGIPYHTCDRDVQVTLRRAWARTSLWGRAKLLAALLASAFEDEKIS
FT                   ADEVERLKRTDALQAMMEELASYLPEVKEVLIDERDVYLARRIWESPGRKLVAVVGAGH
FT                   LEGVVRHLERCAAGDEGVAFGDLETVPPSGRAGRVVGWLIPAVVVGLIAGGVVRHGWEG
FT                   GLRMFLLWVGVNGGLAGLGTILAGGHPLTILAGVLSAPFTSMTPVVGVGLVTGLVEASL
FT                   RRPRVGDLERLNEDIASWKGFFRNRVTRILLVFFFSSVGSVIGTFVGIPWLASFLGG"
FT   gene            175371..176120
FT                   /locus_tag="STHERM_c01400"
FT   CDS_pept        175371..176120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01400"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01116"
FT                   /db_xref="GOA:E0RNB6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB6"
FT                   /protein_id="ADN01116.1"
FT                   /translation="MRFLLSKFVGTLLVPPGLWVVFALLVGVVSLRRGSRRGAVAAWVF
FT                   AGFLYLGNTHLVEHLLLAPLERAFPVWDGGGGVRYVVVLGGGAQAGTPAGDVPGVVTLA
FT                   RLWGGLRYARMLGVPLVLAGGSVWDEGKSEGEMMADLVRELGWEEVVVEGESRTTWENA
FT                   RNTARMVGRGPVLLVTSAYHMQRAVWCFRAQGVEVIPAPVDFRDERPAHWIFYLGISAE
FT                   AARDVQAALREYVGMVWYRVAYGAGLP"
FT   gene            176152..178407
FT                   /locus_tag="STHERM_c01410"
FT   CDS_pept        176152..178407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01410"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01117"
FT                   /db_xref="GOA:E0RNB7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB7"
FT                   /protein_id="ADN01117.1"
FT                   /translation="MKSLVSLISSQRLKQYLFGLPLLEEELLRGERFINRARVGVTLLL
FT                   GVALLGYVALQGYVLPRVHGYGAVLLLLSVLHIIWVEWRIRGKKIEHIGYISISIDTVL
FT                   VSGAFLVFVLRFPFVSLITLLYVMYFGMIFSSLARYSPLSTVYAGVCGAVGFSVVGFVL
FT                   RESGSVGEGAPYFSFLLDPVGIVAGGAVLLFYSGLGAAYLVTVIDFIAKAARSEIQLKK
FT                   SEERLEGIVQNIPGVILQLEMSVSGNIYYTYISDQAREIFGEKVDRILQNPFATLRFMP
FT                   KEKLRAIVHTIRNLDRISVPLGWDVRLRTRRGHRWFRVTVSVTPSAEGTFYLNAIILDT
FT                   EEIHAYQERLKEAKEEAERANRAKSAFLATMSHELRTPLNGIIGMSELLMSSGLSGELV
FT                   EYARTIQTAGENLLALINDILDISQLESGKLKVERRPCDLKAVLLHVYKTLYPQTIHKN
FT                   LRFVLEVASEIPAVVISDEARLSQVLFNLVGNAIKFTSRGEVVLRVWMEEEEGRAELVF
FT                   QVRDTGIGIPREELPRVFERFHQVDQGVTRRFQGSGLGLSIAKDLVELMGGRIDVESEE
FT                   GKGSCFTVRIPFQVPVSSARVLPFVRDGLEEQVEWRGSLGEEVVEDEEPGGFWVLVADD
FT                   NEANRVLLHRMFSRMGGRVVTVENGKEAVERVRERPFDLVVLDYHMPVMDGVTAAGVMR
FT                   REGSVGEGVLVVLTGQALAEDKEFFMREAFDDMLLKPVRLEDLRRLVERWVKGRKRT"
FT   gene            178418..179761
FT                   /locus_tag="STHERM_c01420"
FT   CDS_pept        178418..179761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01118"
FT                   /db_xref="GOA:E0RNB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB8"
FT                   /protein_id="ADN01118.1"
FT                   /translation="MGKGVKSRFVCTECGYEVSKWVGKCPGCGAWNSMVEEVRGRGRER
FT                   GERRAGSGVMRLPEVVAQGEERIVTGVGEFDRVLGGGLVRGSVVLVGGEPGVGKSTLVL
FT                   QVAARLAGGVKVVYAAGEESVGQVAARAARLGCGKAEVELAAETQVESLEALLRQRRAD
FT                   VVVVDSLQMLYSPQMGSAPGTVNQLKFCAYELAQWAREQGGVVLLVAHVTKEGVIAGPK
FT                   QVEHMVDTVLYVEAAEHNLRILRGVKNRFGSVDEIGVFEMTGKGLVEVAEVSRLFLVQR
FT                   EGGVPPGVVVAPVVEGSRAFLVEIQALTVPAKSGVSRVYAGSIEPARVSRVAAVLEKHV
FT                   GVQFGSQDLYVNVAGGLRVQEVGVELPLAMALYSARTGLAVPAGLVVVGELSLAGEVRA
FT                   VRDLRRRVRTARELGFERVVSPPGDGADPLLVVRNVKEAVRAVFGAGG"
FT   gene            complement(179766..181040)
FT                   /gene="thiC"
FT                   /locus_tag="STHERM_c01430"
FT   CDS_pept        complement(179766..181040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="STHERM_c01430"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01119"
FT                   /db_xref="GOA:E0RNB9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNB9"
FT                   /protein_id="ADN01119.1"
FT                   /translation="MTQLEAARKGIITSQMEEVARKEGRTPEEIRALVAEGAVVIPANR
FT                   NHSGLSACGIGRGLRTKVNVNLGISPDCRNHEVEFAKAELAERLGANALMDLSCEGDTR
FT                   PFRKALIARTRLPVGTVPIYDAEGMGKSLEDLTADDFLSMLARHAEDGVDFVTLHAGIT
FT                   RECLDFLEEGERIMPVVSRGGSLIAEWMRKTGEENPFYACFDRVLDICREYDVTISLGD
FT                   ACRPGAVHDATDSLQIQELITLGRLVKRARKAGVQVMVEGPGHMRLPEIEANILLQKKL
FT                   CHGAPFYVLGPVVTDVAPGYDHITSAIGGALAAWFGADFLCYVTPAEHVRLPTLEDVRE
FT                   GIIAARIAAHAADLAKGIPGAEAWDRRMSEARGRLDWDAMMKEALDSEKPSRMRAESVP
FT                   GDPRVCTMCGRMCSIKRMQEAAPRP"
FT   gene            complement(181037..182188)
FT                   /locus_tag="STHERM_c01440"
FT   CDS_pept        complement(181037..182188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01440"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01120"
FT                   /db_xref="GOA:E0RNC0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016229"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="InterPro:IPR041397"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC0"
FT                   /protein_id="ADN01120.1"
FT                   /translation="MRGLYRMLDANWNRAAEGLRVLEDVARFVWNDGPLAERLKGMRHR
FT                   VRGVLREREGLMAGARDVEGDVGKGMGVRGDGREGLEGLVRGNCARVEEALRSMEEALR
FT                   SMGLEREAGVCEEVRYGMYEVEGRLAGWLRRVRVARAFDGGVYAITAEEYSRGRGNLRV
FT                   MREALEGGARIVQYREKEKSYRAMYEEARALRELCREYGALFVVNDHVELALMVEADGV
FT                   HVGQDDWPVEEVRRVVGPGMVVGLSTHGPAQAQAAVERGVVDYIGVGPVFPTSTKKDVC
FT                   APVGLEYVAYASREVRIPWVAIGGIKEHNLDAVCELGARCVAMVTEIVGAEDVRGKVRR
FT                   VRERVEGWRGRAPAPRWVREWEAVLARQEAPTDQRRPTGEEEL"
FT   gene            complement(182185..182889)
FT                   /locus_tag="STHERM_c01450"
FT   CDS_pept        complement(182185..182889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01121"
FT                   /db_xref="GOA:E0RNC1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC1"
FT                   /protein_id="ADN01121.1"
FT                   /translation="MRKQGTVGEPAARVFEEGLSRYLGPRERGVLARVRVGILGAGGLG
FT                   SMAAQALVRTGVRHLVVADPDVVEASNLNRQFYFVDQVGRAKVEALGENLRRINPEVEV
FT                   EGHRLEVRSAEELERVFRGCEVLVEAVDGAEVKRMVAEEVRRRQEAGGGPRGRVWAPYL
FT                   LVSASGVAGWGAVDEVRVREVGEGWVVVGDGVREVGEGVPPLAPRVWVAASMEADAVVS
FT                   FVLGHTRLWEDV"
FT   gene            complement(182886..184013)
FT                   /locus_tag="STHERM_c01460"
FT   CDS_pept        complement(182886..184013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01122"
FT                   /db_xref="GOA:E0RNC2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC2"
FT                   /protein_id="ADN01122.1"
FT                   /translation="MSVLGVINEWKDFDFEGFFARVRPSRVEVVLAKEGALSPEDLLVL
FT                   LSPAAVPFLEAMAVKARRLTVQHFGRVISLYTPLYVSNYCVNRCVYCGFHAGAPVQRRQ
FT                   LSFEEIEREAEAIARQGFRDVLLLTGEDRRRTPVAYIEEAVRILTRLFPSVGIEIYPLE
FT                   EDEYRRLIQAGVDYLTLYQEVYHPEEYPRFHPGGPKARYDYRLLAPERAARAGMRAITV
FT                   GALLGLGEWRRETFFTALHARYLSRVFPEVEVGVSLPRLRPCVGGFTAPHPAGERDLVQ
FT                   AILAHRLFAPHCGISLSTRERAFVRDHLIGLGVTRMSAASVTAVGGHATRAEEGQFEVA
FT                   DTRGVREVCEAIRARGFQPVFQNWVEGLAGVGGGR"
FT   gene            complement(184010..184795)
FT                   /gene="thiG"
FT                   /locus_tag="STHERM_c01470"
FT   CDS_pept        complement(184010..184795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="STHERM_c01470"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01123"
FT                   /db_xref="GOA:E0RNC3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC3"
FT                   /protein_id="ADN01123.1"
FT                   /translation="MDDSLVIGGTSLESRLVLGTGKFPDRRLIPRVIAESGAQVVTVAL
FT                   RRVNLANPEDNVLSYIPKGVVVMPNTSGARCAEEAVRIARLARAAGCGNWVKVEIVPDQ
FT                   VYLMPDNQETLRATEILVKEGFVVLPYVLPDLVIGRKLQDAGAAAVMPLGAPIGSNRGL
FT                   KTAELIRMLVEELEVPIIVDAGIGKPSEAAAAMEMGCAAVLVNTAIATAGDPVGMARAF
FT                   ALAVEAGRRAFLAGLGPVREYAEASSPLTGFLQELEQPT"
FT   gene            complement(184795..184992)
FT                   /locus_tag="STHERM_c01480"
FT   CDS_pept        complement(184795..184992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01124"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC4"
FT                   /protein_id="ADN01124.1"
FT                   /translation="MRLIVNGERLETGATTVGGLLEERGILPERVVVELEGRIVPREEF
FT                   ERTPLSEGMRVEIISFVGGG"
FT   gene            complement(185252..186445)
FT                   /locus_tag="STHERM_c01490"
FT   CDS_pept        complement(185252..186445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01125"
FT                   /db_xref="GOA:E0RNC5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC5"
FT                   /protein_id="ADN01125.1"
FT                   /translation="MFKIQTLNKISPKGLEIFPRDLYEVASEFTHPDAILVRSADMHQM
FT                   EIPSSVLAIARAGAGVNNIPVERCTERGIVVFNTPGANANSVKELVIAGLLIASRKIIR
FT                   AVEWVRSIADEGDRVSELVEKEKSRFTGPEIKGKKLGVIGLGSIGVMVANAAVSLEMEV
FT                   IGYDPYISVEAAWGLSSKVQRAETLEKLIREADYITLHVPLNDDTRGMLNYEKFRMMKR
FT                   GVKILNFARGGLVNNRDILRAIEEGIVDRYVTDFPEAELLRCENVIPIPHLGASTPEAE
FT                   ENCAIMAVQQLRDFLERGNIRNSVNFPTCQLDVSGDTRILIANRNIPDMVRQITGVLGS
FT                   ARINISDMINKHKGNIAYNIIDVDGEVPSDISEDLSQIEGVIMVRVLRPKEFSPLDS"
FT   gene            complement(186445..187626)
FT                   /locus_tag="STHERM_c01500"
FT   CDS_pept        complement(186445..187626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01126"
FT                   /db_xref="GOA:E0RNC6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC6"
FT                   /protein_id="ADN01126.1"
FT                   /translation="MGACHIAARRDARALRPPYGGRPSHERSTPMRLERVYNFSAGPSV
FT                   LPEEVLKKAADEMLVYRDAGMSVMEMSHRSKAFERIIGGTEERLRRLLDIPDDYAVLFL
FT                   QGGASLQFAMVPMNLMGRTGKGGYVDTGHWSSRAIKEAGLFGEVEVVASSADRGYTTIP
FT                   EIPPLPEGLSYLHITTNNTIYGTRYTSLPATGDAPLVADASSHILSEPVDIRSFGIYYA
FT                   GAQKNLGPAGVTVVIIRKDLVGGHLPHTPTMLRYDIHVEKRSLYNTPPCYAIYMVGLVL
FT                   EWVERQGGVQAMYERNLEKAELLYRFLDESDLFTTKVEPAYRSLMNVPFFLPTEELTAT
FT                   FLEEAEERGLVNLKGHRSVGGLRASIYNAMPKEGVEALVAFMKDFERRYGRRR"
FT   gene            complement(187533..188222)
FT                   /locus_tag="STHERM_c01510"
FT   CDS_pept        complement(187533..188222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01510"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01127"
FT                   /db_xref="GOA:E0RNC7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC7"
FT                   /protein_id="ADN01127.1"
FT                   /translation="MKKITDKTPHIPLPSLERLASLYSALEEAGERGTTHLSSRDLGSM
FT                   LGYPPHLVRKDISTLLKATQPGGNLGEGPRGYPVEALLSLLTTAFGLQTRRRACIVGLG
FT                   RLGSALLHYSEQALPEYELIAGFDSNTNRLELISTPIPLYPAFRIPEVVRREGIEVGIL
FT                   AVPPESVDTSVERLRAGGIRGIVNFTSRPIPREEGVWVRAISLRAEMRVLSALLMAGDH
FT                   PTKGALR"
FT   gene            188530..197037
FT                   /locus_tag="STHERM_c01520"
FT   CDS_pept        188530..197037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01128"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC8"
FT                   /protein_id="ADN01128.1"
FT                   /translation="MKHISFVGIVLGALAVLVVSLTGCDVGLGEQVDVARPRVALTSHE
FT                   SGEYVKGVVILSGTATDDSGVSQVQISFDRGKTFEPVDSLKKKGDGYEWTYVWDTQQIP
FT                   DGRYYVVLKVFDEAGHSYETEELVFIVDNHAPVLLISSPDKAADPVQNPFNQEVTLSIH
FT                   AADYSPLVAFTVDVWRSSDGTSWEHLSDYPKNFSQTASPFTYTFIPEYPSGEAQQYFRF
FT                   VFTAEDKAGNTNTFFFHSDDVFSVAGKHLTVEQVKTIIEGGTVEGVTNEQLLQKAIQTF
FT                   VVYFDEDGDRPLVRFLETGSELYQSGKLTIEVEDDDAIDPASLTLRWYSSTDPDNFPST
FT                   ADLTLSGWDVISQDPHVTVLKETPTLYQFAYSLSDFEVDRFYKAEIEVHDAGGVSPSQT
FT                   PTKVFKVIASDSQPPEITQISIDGLSNIPDSGMYYITEGDYTISFAASDNAELSSVWIK
FT                   ENSQEIYSQTVNQSTFNASLDLTGKPDGTYTYEIGAQDASGIVTTKVCQVVVDTTPPAL
FT                   EFTTVAPVSNPVPAFNGVVELSALISDGIAVEFLYYYIGPDNTPPGYTVERDIFGRATG
FT                   VTGLPPAWTPYTDNKNAWNLEYDTTQLSDGTNYVGLLAVDRNGNVAVDFYTMNVDQSTD
FT                   EPVITISSPSDGGFAGAGQVLSGTVADDDKVDVTSIQVRYSTDGGTTWSSWVSPDSVTG
FT                   TGKNVSFTYILPDLGADGLKQIEVRGSDDPSAKLGSNPTAVTATEGPLSFTYDTTSPVV
FT                   SVSEPTEGDTFDSTFVASGSVTEAHLQIVRVKMDTDSWQELTPTGSAPDYSWTYDLGAS
FT                   FDGLSEGAHSFTVEAVDVVGQTSAVQVTFYKDTTGPAVIFTSIQEGGNTILTSMNPVVA
FT                   GSISDDYSNIASQIEYRIDGADPDPWQQAGVTGSGKTVTFSIDVSSLSDGQHDIDIRAT
FT                   DVLGNQTEVLDVQFRIDRAAPSLSITAPPEGTVYGTVSSGEVFTLTGTASDALLDAVSA
FT                   DLEGTPLSNGGSSTVWSFDVDKTLFDALSEGPHTIQVTATDLAGRSTLLTWQFVKDAQA
FT                   PVISFSNINEDGSTVLQDASPVINGAVSDTYGVGSIETRIERYDYSASSWSLVEDWTSA
FT                   GDPAGATVYVWSKDLGPSGLNLGAGRYRISVRATDMAQNTANQAEKSDIEFAIDQQAPQ
FT                   LSIDALDMYQNGDFLLTGTASDDGAVASVKIKVDDTDFSTGAVDATYDNGTGTWQVTVP
FT                   TTGLSSGDHTVYVQVEDSAGKTVMLNKPFVFDSDPPAVTILEPASQTRVNGEVTIRGTA
FT                   SDNVAVSTVEYRFGKNATTWQTSGLSGLYSWSYTFAQIESYANDTYATEIDPATGNPQS
FT                   GTNVWALPFQVRVTDVAGNAYEELSYELWIDPDMDTPLVYITSHSNNQTVGGTVRLAGY
FT                   ATDDDWVYDVEYRVDPTGTGSGFGSWTSANRIGAGTQVNWYVNLNEDGSLNPPPGEINE
FT                   VLVEVRAVDSKDNGLSRGIEGDVASIRLRFDSNVPVIEDVEVLKADSTRVPYTAGERVA
FT                   GTFTVEAVMRDEGGLSKIEWRGEGTTLFTDVLSDPTVVTTPPEVGASEIRAGVKYLITS
FT                   VGTTDFTAIGASSNEVGITFTATGSGTGTGTAYMAVTPPLVPATELVAGEAYAIFDPGT
FT                   TDWTAAGAPDNSIGTPFVATGAGTGDGIAFRIVAATELAVGEIYRIYEPGATDWTAVGA
FT                   PDNNAGTTFTATGAGSGDGFAIEPEKLSFVYRFHLQLDSTTLNSGAYDATSGFYQLDLR
FT                   VTDNASPTPYMSQQSLNLQIDNYYPAGEYLASPNAATAEYYIQGRAWDSGTGSGPIQGI
FT                   GAVVLYFERDGSFIDLAGGAGSWTTRYVKDESAGGTYQDVTFPADTASGIWVDTNEIGV
FT                   DIDGDGYVEGFSTDGIYKNWYAIYDTTVLADGPVTLHYVVIDGAGNATHYTQDLYIQNN
FT                   IPQIDGVVIGTDLDNSGTIDPSETKLYNTNYETTGFTVRNNYLQFQINASSGNGQLHYR
FT                   VGYVTGTTSVPASSLVRGGVYTIETVGDTDWTKLGAPANQAGITFVATGPGTGSGTAIS
FT                   YTTTELNATLTSNVVDVTDFTSIPDSSAPNDRQFIIKVYDSTVPAGGEDEQLASAVLVG
FT                   LTVDNTDEAAPEIAVADMGQTYTIAEAYADRVLQAVDAYEDNIVTSADGTRHGYVQYAA
FT                   ASSDTDADVSGKVIFMGKAYDNQNMNRIRVQITGYDGGNGVGQPFDIAVASGGTLVSAN
FT                   GATIADVEAGTAAWAFEIAPGSESLTVDNGHVINWRFAWNTATVQNVAQDDVTLTFNVE
FT                   DSAGNTGTAVSYTVDVRPYITDVQRDPANFNTYRSRYGWYSLRRGETVVVRGFNLYNST
FT                   ADTVSFGGASVNLPSSATTTSFSVTVPTSAVSGAITLTVNGLEALNNINDNTEPYNQEY
FT                   DPADPRSALWTDDRYAHIWQSNDTTGTFDSGYFPESDTPVHPAMTIDPSTGTLYASWSH
FT                   YASCRVYRAAIDDGARTTVFRIYDPSEHTDIDYGVRPVIAYNANYYDGASTYGGLYVWD
FT                   PQAPYQFTSGGVNDYFYEGENMGHDHYLMQFINERVVTVGDNIHVSYYDTETKALKYMY
FT                   IQSGDTSTAEHSWVNLDGGSDGDDTQVVSTGRVSAAGEFSAIDVTPAGYPVIAYYDISR
FT                   QTVRIARATSTTPTTAADWVLQDVIGTSDPNYRYSGKYISMRIDSQGYVHLAFFRVSTG
FT                   DLIYMKSTNNPQDGTTAYTFGPTVVVDSEGSVGIWADISLTDDDRPVITYLDFSLVNTF
FT                   DGLKMAFYDPALERESGDVAGEPDTSDGWETMYAALGYDIDNKRLSMEYDTNDHNAWWA
FT                   AIGYASSDYYRVAYYVK"
FT   gene            complement(197123..198121)
FT                   /locus_tag="STHERM_c01530"
FT   CDS_pept        complement(197123..198121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01129"
FT                   /db_xref="GOA:E0RNC9"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNC9"
FT                   /protein_id="ADN01129.1"
FT                   /translation="MNKRGSRRRKGPRGKDSHTRRGVPWWLGVAGGLVVVLVVLGMWWY
FT                   GGYYAPRWYVTPETEELWQGFLEEEEGAPWRRVERFPGSYEACRAPGILIAWEIPEGEA
FT                   HGFDLEGTSRLFPEGWGRLLGEGKVPEGSVPLVVDVWMVFRRVRQERLTRGELASGRGR
FT                   VLVAGGTPRGRWGAGVQAARFGVGAEEGVRVWLDEGVWARGSETAVWEDVWARFFEGEG
FT                   LWVYGPLSEAVRLGPGKVGLLEADRFPDPSEAAEYDLPVRVLCAVPVGVRNRRAVEAGL
FT                   AWVREGRVQEGLARRTGLVPALRGAEAPNPLAWRAKAAWDAATRLVVEGLH"
FT   gene            complement(198249..203114)
FT                   /locus_tag="STHERM_c01540"
FT   CDS_pept        complement(198249..203114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01540"
FT                   /product="BNR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01130"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND0"
FT                   /protein_id="ADN01130.1"
FT                   /translation="MKLRSLTMFFLFLLISTWLYAGGTTEWQEAEGEEDWKKEFNIQDE
FT                   KPGTHNVIIKAIDFAGNESIAGPFNIKVDPASDLPVVRIVSPQEHEVVRNAFNIVGVAV
FT                   DDDGVARVLVKLDDGSYQTAEGTEYWRVAVPASRLTEGTHTISVKAVDVNGTEGPEITS
FT                   TFALDTTPPVIEVTSHQSGVLVSGKIVLEGVVRDENGVRGLSVTIPTYTTVNKKGEEEQ
FT                   IPEKTLTLGVKYDKGEGVYRFSLPVDTRSFPDGPYVWWFTATDGTGTEVRSPFLLFVDN
FT                   EPAALNVLSPEDEAVVFGKVGITGTVRDAIGVKRLWYTFKGEEHDLELIPGNPYWHLTF
FT                   DTSQEKDGTLELTVHAEDASGNRSSQKIRLKNDRKAFQPQVELLFPALEEGEPVLTPDE
FT                   VLVGRIVGPNPPEKVKVLGMGDDPKQGVEIPASMGFYVPLEGLPPGRHTLTLIGVDVYG
FT                   LESPPVKVSFQIAPTAPVLTVEELVYTDTGESLTWKNGLTYEASRKAVLRGRIVSQEKP
FT                   SSGVLYVGGEDLWALMPLDPENLPQFPNTVRKTSLKISPAEEGGYVFEASLDPKAGHGA
FT                   LAAVFALTMRDGKRYLFPQVISYQAPPPKKEGETLPPPTKPDEVFLLDHRLSNGTMIWT
FT                   DRTPLIGFFSGEGVREVVLEGAGDLLTVRHEGNHLIITPQKAGKASGVQVVVTSTDGRT
FT                   YRSSRFTAEIDLEAPVLTLQTPSDGAYLNTSLTIEGEVQDDAGLPGLAYRLDGAPWVSI
FT                   SVSELRFSTTMAVSQLTPGPHLLELKAEDGAGHVRYQRIHLFYDATPPTLAFTTPEVGK
FT                   TVNGTILVAGSIASEAPVIRFGYLLEQGPPEPSGSPGESEEAAASTPEPSFTPLSPEDG
FT                   IFSFTVDFSRLAEEGKTMKLIAEDAAGNTSETLLSPSVDLSLDKPRVEIQTPPDDFVVT
FT                   KDVTIAGMAFDDDGISKIVWKLDDGTWQEVPAQHTFSFTIPLSSLSDNEHTVEIYAVDL
FT                   FGLQGEIASKTLRVSLSEPEGAMVSPTVEETVKGTVILKGTASDANGIDSVRVSFDNGN
FT                   SFHFAHLTIDGTEWTYPLDTTILTDGTYAVQFVVRDGYGIEASYSALVNVDNTPPEITL
FT                   TTPEEGVTVSGEVRLSGRVSDNIQLTSFKGILEPINNQLDPVEVTLPLERVLTTRIPLG
FT                   ELSPGWYNLRLEARDGAGNVALVDRNLFVVARTEGASVRILFPSEGEVVHGPVVVEGVA
FT                   TAPSPVEKVQIFLEDGFLTSADVNPRGYFRAVLDPGKLPDGEVTLKAVLSHDGARVESE
FT                   PRSFIYQKIGPYLTLESHMIGDMLANRPWIRGTAAYLTTLDPEDPDYRKKIREFEVVRI
FT                   QVSLDNGRTFQEIPARSQWKYRVETGFLPNGPLPVLVQASFRNGETAVLRTLFVVDKIP
FT                   PEVKVIAPLEGDRVNEKLVAFGVADDNFGLEDVQISLRAGDKAGYEIPEFIQGMYLDAH
FT                   FLGMTYWKAGLGLTFFDNNVKLQVSYGLGPRTTADGKPARLSGQFISGKLLASLLYVPF
FT                   ESFLGPDWDWLSLKLALGADFSYILLYDPIEVEEAQETRTISSVVLSAILAQLEFPIVE
FT                   VKRFPAFHTYSLYVEPELWFIPSDVDPKIVPKLTFGTHVVMF"
FT   gene            complement(203329..204312)
FT                   /locus_tag="STHERM_c01550"
FT   CDS_pept        complement(203329..204312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01131"
FT                   /db_xref="GOA:E0RND1"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND1"
FT                   /protein_id="ADN01131.1"
FT                   /translation="MARPRIAIRLADNSLFPVLEEGTPSRKRVVLEPAHTHQRAVHIDL
FT                   YRTLDEEGGEYLGTLTVDLPDYNGEKPEVELVLEMDEHEHLSATARERTSGETRHLELT
FT                   MEEPSPDTDFSMLTRMHEEGEYEEEASLPERSYDEDFGTPFDEEASLSYEEGEEEEGFS
FT                   FEEERRASSSLMSEEEQNLLQSGFEREEEERSAALPVERRPSMWVPFILGFILGVLVGG
FT                   VLSYLFLPRVLGEVPAPQVSTAPRPTPAVTSTPAPTQAPEAARPAPSEFTIIYTPTWGD
FT                   TLWDLADSFYNNPWLYPIIAEENRIANPDLIYAGRPLRIPHIRPQE"
FT   gene            204415..205125
FT                   /locus_tag="STHERM_c01560"
FT   CDS_pept        204415..205125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01132"
FT                   /db_xref="GOA:E0RND2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND2"
FT                   /protein_id="ADN01132.1"
FT                   /translation="MVRVILVEPEGAENVGMVARAMANMGHERLVLVRPACDHLSPPAR
FT                   RYAVHAESILEGARVCETLAEALDGVDLRVAVTRRHGQYRMPDLYLPEFPAFLAEFTGR
FT                   DVALVFGRERTGLTSEEVQACDLILTIPSSGACPSLNLAQAVMVVLYELMRASFLSLAP
FT                   RREEDLRPYLDEAVVRAREVLEKLGYYRNIPEEKVAFAVRKVIARMVRDRETAVRVSRF
FT                   FSHVAARLDLHGKD"
FT   gene            complement(205122..206990)
FT                   /locus_tag="STHERM_c01570"
FT   CDS_pept        complement(205122..206990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01570"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="AspRS; aspartate--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01133"
FT                   /db_xref="GOA:E0RND3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND3"
FT                   /protein_id="ADN01133.1"
FT                   /translation="MSPPRIRVHESSSLPLPSHCVRVAPMAHETPFSAWKRTTTCGALR
FT                   ATDAGKEVILNGWVHRKRDHGGIHFINLRDRYGITQVVVDEESPEEVRRLVEALKYEYC
FT                   IAVKGVVRLRPETMRNPQMPTGDIEVLATGIRPLSASEILPFPIDDAIDAREELRLQYR
FT                   YLDLRRPRMQRNLTLRHLVAWHAREYLVGKGFYEIETPTFIRSTPEGARDFLVPARLHP
FT                   GRFYALPQSPQLFKQLLMVAGFDKYFQIARCYRDEDARGDRQPEFTQIDMEMSFVTQDD
FT                   VLAETEGLMAHIFQKALGVDLSLPFPRLTYEEALDRYGTDKPDLRYGLELKDFTPHVDK
FT                   GSFQAFRNVVAQGGVVKALVVEGGASFSRKEIEALEEVAKTYRAAGLAWMKVTEGGLEG
FT                   GVGKFYQGTAPALITSLGARPGDLILLVGDAWKTACTALGAVRTAVARTRGLIPEGAFS
FT                   FCWVVDFPMFEWNEEEQKWDPAHHMFTMPREEHLPLLEEDPGAVKAAAYDLVCNGYELA
FT                   SGSIRIHDPELQRRIFKVVGFSEEEAASRFGFLTTAFKYGPPPHGGIAPGLDRLVMIMA
FT                   GEETIREVIAFPKTAAGLSPLDGSPAEVDPAQLEELHLRVVLPEED"
FT   gene            complement(206962..207933)
FT                   /locus_tag="STHERM_c01580"
FT   CDS_pept        complement(206962..207933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01580"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01134"
FT                   /db_xref="GOA:E0RND4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND4"
FT                   /protein_id="ADN01134.1"
FT                   /translation="MYGSSDAQGAGTSGTTGHEMRTIQRAGFLSIVGNVVLFGIKLAAG
FT                   LTSGSIAVVADAWHTLSDSISSIVLLVGARTARKPADDDHPFGHGRAELISTVMIGTIL
FT                   GMIGITFALDAVERLFHHEGAHYTDFTLWVVGFSILAKEAMAQYAFAVARKTGYSSVKA
FT                   DGWHHRSDALSSLLLLVGILAGGRFWWMDSALALGVSVFLGYTSYSILKEAFSPLLGEA
FT                   PPEELETRIQDVVRRTQPEGPDIHHLHVHHYGRHTEVTFHVVLDGETSLRKAHEIVSVI
FT                   EQDLRRELGLEATIHVEPFETWKDRQLRRRSRSNEPPADPGA"
FT   gene            complement(207896..208309)
FT                   /locus_tag="STHERM_c01590"
FT   CDS_pept        complement(207896..208309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01135"
FT                   /db_xref="GOA:E0RND5"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND5"
FT                   /protein_id="ADN01135.1"
FT                   /translation="MDPVILILGTVTVILIGLLAAGMVKDVLSRERARISGRDSSALPR
FT                   CPVCRTPLAPGERVSSRVFSRGKQANHLGIVESMAHILGCPHCYPAPREVRRRCPVCGK
FT                   DLLVTDVLVARMFENTRTGRKHVRILGCSRCRD"
FT   gene            208361..209041
FT                   /locus_tag="STHERM_c01600"
FT   CDS_pept        208361..209041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01136"
FT                   /db_xref="GOA:E0RND6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND6"
FT                   /protein_id="ADN01136.1"
FT                   /translation="MASLFVVATPIGNLEDITLRALRVLKEVSLIACEDTRRTRILLSH
FT                   YGIATRTISYHSHKREEGVPPILSALEEGKDVAYVTDAGTPALSDPGAFLVAKVREAGF
FT                   RVVPVPGPSAFTTLVSASGIEEKTITFEGFLSPKQGRRRRRLAELLDRGEAFFLYEAPH
FT                   RILKLLDDLSVLSPDRTIVVGRELTKIHEEILSGTPEEVATSLKEGNSVRGEFSVLVCG
FT                   TKKG"
FT   gene            209088..209372
FT                   /locus_tag="STHERM_c01610"
FT   CDS_pept        209088..209372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01137"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND7"
FT                   /protein_id="ADN01137.1"
FT                   /translation="MTVERTGPVDPIGRYLKTQKTEKVVKKQEGDSITLSEEAKFRAEL
FT                   HKSIELVKQAPDIRQDRVEEIRKKLEDPSYIDDKVIEVVADRVLKMFGL"
FT   gene            209395..210534
FT                   /locus_tag="STHERM_c01620"
FT   CDS_pept        209395..210534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01138"
FT                   /db_xref="GOA:E0RND8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND8"
FT                   /protein_id="ADN01138.1"
FT                   /translation="MAYRELEFPFTIVEGTDALSRLGPLVAGMGDRAFVLADPVAVEHD
FT                   LHTPVLQLLKASRVEAVLFHEISHTTSLHDLVRIGRILSASRAQVVVALGGPTALRTAR
FT                   LLSATRGDLDLLQSLPRSVPLHPLPLVALPTTPRIPHLFAPRVLLVQDPPDPHLLVPLP
FT                   HVPSLLLADPVLTRTLPPRATASTLLALLADAAETLLVSPPGLAAACASHTLAILSRTA
FT                   EPTVLRPDPSPLRPALLQAGLLSALARRFTPDGPLTLLSLALSCRGLPGSWTTALLFVH
FT                   AAPRLAELAPEVLEEVAASLGITGVAAEVAAAETASFVRRLLARAGLPTRLTDLELPRA
FT                   ALPEIARTAWDLDHPLRQLAAFPSSPDQAFLLNLLEAAC"
FT   gene            210537..211334
FT                   /locus_tag="STHERM_c01630"
FT   CDS_pept        210537..211334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01630"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01139"
FT                   /db_xref="GOA:E0RND9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E0RND9"
FT                   /protein_id="ADN01139.1"
FT                   /translation="MITPRKFARLTPSARLRKLRTLLRAWRTLSPPEWETVRPMVRDIL
FT                   FFVARDEEAPASLREACAGLLPYISQTTDPEALARPFLRAEILLDELLGTWTADWDLSL
FT                   EPRGALPPRTSLPIWVYLEDLRSPYNVGAIFRSAEAFGASGIYLSPATPTPDHPRAART
FT                   ARGTQHVLPWERLPAERLGGLGLPILALETGGTPIDTYPFPPEGIVVVGNEELGVSPEL
FT                   LALAESSQGRVSIPLVGTKGSLNVSVAAGILLCYWSRALTRRA"
FT   gene            complement(211318..211734)
FT                   /locus_tag="STHERM_c01640"
FT   CDS_pept        complement(211318..211734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01140"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE0"
FT                   /protein_id="ADN01140.1"
FT                   /translation="MAAKVTARHTGDMAFDVEVDGHTLTVDAHPEFGGKDAGPRPKNLL
FT                   LAGLAGCTGMDVVSILGKMRMPYDSFTLHIEADLSEEHPKVFTRIHLVYAFTGDALDRE
FT                   KIEKAVRLSQEKYCGVSAMLGKTARITYEIRLDG"
FT   gene            complement(211734..211967)
FT                   /locus_tag="STHERM_c01650"
FT   CDS_pept        complement(211734..211967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01141"
FT                   /db_xref="GOA:E0RNE1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE1"
FT                   /protein_id="ADN01141.1"
FT                   /translation="MKVVLYTTPTCAYCKMAKDYFRKNRIPFVEYNVAQDMRRAEEMVR
FT                   KSGQMGVPVIDINGKVIVGFNLPEIERALRSA"
FT   gene            complement(212040..213533)
FT                   /locus_tag="STHERM_c01660"
FT   CDS_pept        complement(212040..213533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01660"
FT                   /product="HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01142"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE2"
FT                   /protein_id="ADN01142.1"
FT                   /translation="MKKAVVDNSKVLQAIRHNLPVTIKIHAMTPEIEERVEEILDLVLT
FT                   DIGREKMRDALLYCLKELVANAQKANAKRAFFHERGLDIEDEEEYEEGMRVFHEVLSED
FT                   PRHYFELLKELGLYTRITFQLKNDILYLIVANNSPLLKEEQIRIFDRVARARLFETLEE
FT                   ALSTAYDVTEGAGLGIVTLIMILKRLGLSEEAFDIDVVGEETVARLTIPMDRIHLSRLT
FT                   ELTERVVDEIESLPQFPENVLYLQKLIDDPNSTVQDIARQISTDPSLTADLLKVVNSAQ
FT                   FMLPKKVDSILEGVKILGLRGLKNLLYTYGTQKILGLGTEEQQHLWDHSLRTAYYAYNL
FT                   AQTVFRDKELMEDVYVGGILHDMGKIVFSRVHPTLLEKIEMLRRERDIPQNLLEELYGG
FT                   LHHAEIGALLAEKWNFPDLLVAAIRFHHTPEGAPGEMDRIVQTVYAANAIAMFEEGRLT
FT                   WEQMDHGILSRFQITDKEGLDQLRRSLRRSFEREMKRRS"
FT   gene            complement(213638..216031)
FT                   /locus_tag="STHERM_c01670"
FT   CDS_pept        complement(213638..216031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01143"
FT                   /db_xref="GOA:E0RNE3"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE3"
FT                   /protein_id="ADN01143.1"
FT                   /translation="MQHEPYRLSPEEVGFSIPEEHIQALQEGVQPGTIIGQPRAVEALT
FT                   LGIQLSGKGYNIFVAGPPGTGRHTAIRRILESLSPPNRWGKDIAYAYNFQNPQTPRVLY
FT                   FPARTAARFKRALRRTLEKLTKGIRHRLTSESYLRKKTALMREVEAEERRLLEQFQEEL
FT                   RREGFTMLERPGDSQTFTDLVPLWHGQPIEFDELAQKASRGEVPHELVEERRQKYFPLL
FT                   EKLQDLFATFDLKRLAAEERLAEIQRTHVAPDVRAEIQRLAASFHAEGPLLQHLKEMER
FT                   DILEHLAAFLEEDTAGEEDGMPISLRYTIHIMHEVEDPDRAPVVFESQPDYTTLFGTIE
FT                   SIPEKAGEERANFLMIRPGSILKANGGFIILRVEDLLRHEELWATLKRVLLDGRLEIRT
FT                   PPGPFSAPSALKPEPIQVDVKAILIGNEFQYEYLFLQDEDFGKLFKIPAEFDTTIPLND
FT                   QTIREYIGFIRATCERKHLLPVDTSGIAALLEYGVRLSEERDKLTARFSLVTDILREAD
FT                   HWARTMGSDHIDRHVVEAVQRHRNHLFGLLEEKIDEQILSGELLIQLEGTAVGKINGLV
FT                   ILDRGFHSFARPVLITARTAPGTEGIVNIERESGLSGELHDKGVYIIQGYLQSRYARRF
FT                   PLSIKASIAFEQSYVEIDGDSASLAEMCALLSDIAGIPLRQEIAVTGSINQMGQVQPVG
FT                   GISEKVEGFFKVCRKKGLSGTQGVIIPRLNLKNLILEKEVQEAAREGLFHIYAVETIDQ
FT                   AMEVLTGMEAGTRTSKGMFPPGTINERIETRLREMARVVKEFGS"
FT   gene            complement(216073..216717)
FT                   /locus_tag="STHERM_c01680"
FT   CDS_pept        complement(216073..216717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01144"
FT                   /db_xref="GOA:E0RNE4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE4"
FT                   /protein_id="ADN01144.1"
FT                   /translation="MEDFPLPGIPCTPDAPPSPLILNAPEFTQAAVLVPCIPTPTGWHI
FT                   GFEVRAHGIPQEGEICFPGGLVEPHDPSPLHTALRETHEELGIPGSRIPHIRYAGAFLS
FT                   ASGRLIHVFPALVPSWDEAHPSPDEVSHLFTLPLSWLRTTPPRIHHVRLTLHPREGETE
FT                   LLPASRLGLPSLYHTPWKGPLRPIYLWHTPHGPLWGITAGILYHLLHPSRG"
FT   gene            216769..217296
FT                   /locus_tag="STHERM_c01690"
FT   CDS_pept        216769..217296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01145"
FT                   /db_xref="GOA:E0RNE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE5"
FT                   /protein_id="ADN01145.1"
FT                   /translation="MLDAIFARRSIRRYRSDPVPDGVLKEVLRAGMAAPSSWNGRPWAF
FT                   VVIDDPAALEEIARRHGYAAMCREAPVAVLVCGLPEGMKEPDFLPQDLSAATENVLIAA
FT                   TELGLGSVWVGLFPHEDRMGVLREVCGLPPEVVPFSLVVLGYPAETKRPHEGWMEGRVF
FT                   HGRWGRVWRPTG"
FT   gene            complement(217310..218830)
FT                   /gene="glyA"
FT                   /locus_tag="STHERM_c01700"
FT   CDS_pept        complement(217310..218830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="STHERM_c01700"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="serine methylase; SHMT"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01146"
FT                   /db_xref="GOA:E0RNE6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE6"
FT                   /protein_id="ADN01146.1"
FT                   /translation="MEERMASTLLGSYLARTPQAASNPEMVGFVAQLEVIARTAPDVAR
FT                   AIVKELRDQRRNIKLIASENYSSLATQFAMANLFTDKYAEGYPGHRFYAGCDNVDEVES
FT                   LACEEAKALFGAQHAYVQPHSGADANLVAFWAVLQWKVQAPALEKLGKKNLYDLSREEW
FT                   EALRKELGNQRLLGLDYYSGGHLTHGYRYNVSAQMFEAYSYGVNPETGLLDYDEIARLA
FT                   REIRPLILLAGYSAYPRKIDFARLREIADEVGAVLMVDMAHFAGLVAGGVFEGPYNPVP
FT                   HAHIVTSTTHKTLRGPRGGIVLCVKELAEFVDKGCPMVLGGPLPHVIAAKAVALREARS
FT                   PAFREYAHKIVENAQALAAFLQEEGITVATGGTDNHLMLIDVRPFGITGRQAEAAVREC
FT                   SITLNRNALPYDPNGPWYTSGLRIGTPAVTTLGMGREEMREIARIFKLILTHVRPEVKD
FT                   GSPSKARYRLDPSAKEEARARVEALLSRFPLYPRLDLAFLEEALGLQG"
FT   gene            218954..219241
FT                   /locus_tag="STHERM_c01710"
FT   CDS_pept        218954..219241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01147"
FT                   /db_xref="GOA:E0RNE7"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE7"
FT                   /protein_id="ADN01147.1"
FT                   /translation="MKADGASDPEYISKRLYLEERGMKGNVGTIDRIIRVVLGLVLIGL
FT                   GVFVRGGAYWWLTVIGAISLVTGAVGFCGLYTLFGISTCPRKEGTDSSKT"
FT   gene            219393..223910
FT                   /locus_tag="STHERM_c01720"
FT   CDS_pept        219393..223910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01148"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE8"
FT                   /protein_id="ADN01148.1"
FT                   /translation="MNKRRVFWSVCLTYAVLFFSCEVGLGPETDLQGPVITIESHSNMD
FT                   YVPRECELRGSWYDESGISRILVSLPETGETVGKARIQGKEWSIWLTLPEGEQTVRVTG
FT                   YDVWNNSSDQSMDQITLLVDATPPFLEGLSLERGPGYTVPLKSREELQGYDPEDIQFLD
FT                   YFQNGTFRIKGEIRENFTVHDVTLHLLDEQGREVLTKPVDDDAPPLSPVFTLSASDFEG
FT                   TGYVSGRAYFRVTVSSTDIGGNENTDQGGWFCYYPEADLPRIIQGDAREGVITVGQGAE
FT                   VPFSFVDDDGLDLIYVGVLSQSAWESIQGETDGEKLATLEEDDDMREALLGPALQGNGA
FT                   RSYNHTLSAPQDAGSYVLVALVRDTKPYDDPPVWSGAAYRLTVTDPDQPLGVITSPEEN
FT                   TFPAVDPAGRWVLQGACIDNSAVEEARLAWVPEGLPGGAEAHLEETRQLLSSVSVGPGD
FT                   KVVDDAGMVVWGLSLSGPEEITIGGRTYKRYPFAQEVDVLQDFMYEGVLENTTKLFLLY
FT                   VKDDSGNEAYTAFRLVGDTSLPVIGISQPEEDYQLYTSDEELTLSFSASKENGIPIHTL
FT                   ALYEVTSGDPVLLTTGSTSPLSYTFSPPLEEGLRSFRFVATDVFGNICEEERTVRITSR
FT                   PVLQYIGTPLADGVYKAGDELLFEAVFSSPVEVSGTPRLKLYYDATLDSPDAYATYHSG
FT                   AGSSTLLFSFTVPSGVQVDKLYTAYEEPFDLSGGSIVGAEGGEVEIPLLEEQDTLQGRS
FT                   SIGCDGIAPRATGLTGSGTYRAAQTVELSLSVEDDVLVSGDVRLVCAAGADTIEGQFDR
FT                   VENGDLIFVYLVEDGINAASLSYTVATLVNDPSRITDAAGNPLDLSSLTDGTLPITIDT
FT                   TSPDPPVITLGEGIYNTPQTLTIEGIEQGAVVEYSLDGGLSWFQYDQDNPPQITGDGVY
FT                   QVCARQIDEAGNVSEVSPVKEIGIDTGAPQVVEVACVNPDGVYGAGATLTFKVVFSEKV
FT                   RTTGGDAALELNNAYTAGVEEDPDGAYVLYFAFTVPDGAFLNPVEATRLTLSHVEDLCG
FT                   NLAPPVLEGDTLPDLGRPNLRVDAVPPALQSTSPTEGGILTGGNLTLTFDEPVFKESGA
FT                   VVVRRHQGWLIPPVMSEEEFTAVYYASALTSEDRQVLMETDDQGAPLLDQTGQPVGPYR
FT                   KLTHGLLQEGGEYVPDLSTKYVLAFERGLADEQIRTVLEKAGYHIFLDVNVTSSRIQIQ
FT                   GEVVTISLPEGIPPGIQWDLVIDAGAFRDSAGNPSPEITCSFWSDGVSPPIIRIDRYSH
FT                   GEGAREPEATPAGDGLTGTITGYRDVGPGDTTTEPTGFVRVRIDSQTPGVTIRYLVTDD
FT                   PQVPGEPSTVYGFTHASYTDFLAAGKPLTPGTSQAANEDDPQRIYIKAVAEHPQLGSSY
FT                   GYAGAFKTVVVLVDPQGGSAPVQIQGTEEAGAPPTTPGFPLRDADPDPRYSKYMYQFGN
FT                   NDWVWISWEIVTSWMQTSYRSNWQQNYNPGDYGALTYRENQPYW"
FT   gene            223925..228613
FT                   /locus_tag="STHERM_c01730"
FT   CDS_pept        223925..228613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01149"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNE9"
FT                   /protein_id="ADN01149.1"
FT                   /translation="MTRHITRWMGLIGILLVMGGCDLLTPGLGPDVDLSPPVLRVVRPD
FT                   YMENVQSTFTLEGTVKDDSEVRVLVVNLVGSAYQWKHQDGRWRYTQNGREWAPASGTWE
FT                   TQKDGTIRWSVEIVLPPDHTGEIVLEIRCEDAFGNVGSLSIERRTVVVDVIPPKVHLTK
FT                   PILFVGSYDEAQTKYASYQLEDHTVLSELLNGDVEIRGYQEENAKLSSLEIRLTDHEGT
FT                   VLWSKVLEDGSMLRNFSLTVPQEELQGIQGKTLIQVVVKSTDAAGNVDERAHGWFCYWP
FT                   EADIPWVEMPGEAGYPPVETTYPGQRLEGYAYDDDGLGSLQVVVERETGAGWEEVSSLS
FT                   VRSDEFGGVTSYAWYVNAPQESGIYRIKATVSDINGQAGEERTSYIDVADVNTPRVIVE
FT                   SPPEGELALGDEQGNLVFSGYADDDSGVESVKLVWIHPSHYDESLLSYLNRDYEGWEST
FT                   GPDGSGNIVFSVSLGNQTYNPGTGRYERPFSRTINLFDDLGISLSLPLSTQTFVFRVED
FT                   TNGRASTVKHTLQGDTTPPEVSIDAVIVRHADLQEETYTIDDNLILPPPQDGDEIRFRG
FT                   SWSDNTTTHWQDASRIGEVELSCNGVPVSTTRNSDATWESDHIPFESVAVLTLEARIRD
FT                   IGGNEASSVRSVRVETHLPFLVRITSLLPNGYYSVGDEVPIYLEFNKPVSFGGTPPSIT
FT                   LNNSATASYVGGEGSARLEFSYTVASGEDVDDLDVVEVVCEGPVIDESGAEVDFSTLPT
FT                   GVNSLAGGKDIIIDTTPPEFTQFVVLSHADAYRAGATVVIAAYVSEEVVVNEAPRLALS
FT                   SGDGAYALYEGNMGDYLRFSYTVAAGENASPLAVEGIDLQSGTISDRAGNPLSTALPDS
FT                   GALDREVRVDTVPPQAPEIAGISDGATYYGEVSFTVEGVEDGAWVQYSTNGGQTWLTGT
FT                   GASLTTSGTYTIVARQIDEAGNTSPKSTPVQIRVDNGSLLTRISSQEPDGIYKEGQTLH
FT                   IVLTFRKPLIVESGTPSLVLNTEPQRTAGYESGSGTTAFVFSYTIQEGDAIANDGVLDV
FT                   VGIDLTGVEITDESGTDVTQWISLDDLDQENRLSGQRSIRLITTPPEVVSIEISPSGEE
FT                   LWIEFDRAVYRGVGELTITQHEEGLKVPVVLSEREYEIVSQEAPDLAAHYRYMTNGATS
FT                   SGEPLLDPVYVLEFDKDPDDPALVSSYTAASLHERRIPVESSFVTISGKVVRVSLSGSY
FT                   ALPVRGASYTVSIPSAFMVDTVGHPSLSSERNISLPGVDPPVIRIDRRSETLTERNGRV
FT                   VAVQPLTVWLKMNSPTPGVEIYYTISEALFDPDPVANPEGNPPTPDPGPSEPADPASAS
FT                   TQYTAPFEIGGAADTLQGYKCWIKARAYKGSEPSEIANEVAFKSVVSFIYDGGRGDAIP
FT                   DYPGGPLYDRNTNELVVNDSTLPESMWVRGSDDKAGPPTIPGLPLSWNHYDYSGVRLMT
FT                   QLSSDPQEWYWVTWEVVSTTYIGLLWGTTPSTVEEAARGPWRWGWSKNAFVPFREYYPL
FT                   FPGESRRIQTSLYATINGQYRGEFIFAREGDGEVFIRDYLRE"
FT   gene            complement(228682..228755)
FT                   /gene="trnR1"
FT                   /locus_tag="STHERM_c01740"
FT                   /note="tRNA-Arg-CCG"
FT   tRNA            complement(228682..228755)
FT                   /gene="trnR1"
FT                   /locus_tag="STHERM_c01740"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            complement(228769..228842)
FT                   /gene="trnR2"
FT                   /locus_tag="STHERM_c01750"
FT                   /note="tRNA-Arg-CCT"
FT   tRNA            complement(228769..228842)
FT                   /gene="trnR2"
FT                   /locus_tag="STHERM_c01750"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            complement(228882..229604)
FT                   /locus_tag="STHERM_c01760"
FT   CDS_pept        complement(228882..229604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01150"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF0"
FT                   /protein_id="ADN01150.1"
FT                   /translation="MEKSKFVLAGVWLLCFGLSLSSQDLGFIVEDKDLHLYLLDLKEAR
FT                   PPHTKKNRLVFTFQGSPRTRSVGIAFSFERFRTVHLMARNPSRIFFYVLDPPEDRFTYR
FT                   LVVDGVWMADPSNPLVVEDEDGVRLSLVSLTPLPAEEAGPVPLEGEVAFLFRYTPGRQV
FT                   FLVGEFCNWDPFLLPMEEVEPGLYRKTLSLPAGTYAYYFLADGKRIADPENPRRVYLDA
FT                   IPVSLVEVPPRISARLQD"
FT   gene            229693..232587
FT                   /locus_tag="STHERM_c01770"
FT   CDS_pept        229693..232587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01151"
FT                   /db_xref="GOA:E0RNF1"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF1"
FT                   /protein_id="ADN01151.1"
FT                   /translation="MPEERDIERLGRELLKLREEPRVLDEWGETVEIPPPVEPEVHPRV
FT                   PHTEEEGARADEGDESIEGLLSRFGDEQAEEEAPEGDAFEALGFEPLEEEVEGEMPQAE
FT                   LPEELPEGLFDLEEEAASAGEDLGVLEELPEPGGEGPEEAVPPLEGPEGVSPEDAGVTS
FT                   AVEGVGSEEPAGEGTEEFVLPDFHDLEEESGEAVPGPDEDLGLSLDFTEEEGEAAPAPP
FT                   EEEIPSVPSPEDLALEEEALLAEEFPEDIEVEEFSLRDLGEEFGVVEEEPGLIAEEESL
FT                   NPAMAITPEAVEELPETGFGLTEQEFRRLQEHLFSLPRNLKMEIESLVAEAKVGGEDLE
FT                   RLVRMLVEGESPRALAAFVGRLTGKRIRIPARYERGTGAEFEKAKGGLWYLVRYRLLPV
FT                   VRAVLVGTLILAGLTAAVFQFIYRPVRAHLLYTEGYRQIFQEEYDASLLRFEQGLRLWR
FT                   MKGWFFRYARAYTEMRQYPLAEEKYEQLLAHYPLDKEATLEYADFESRVLANYEKADQP
FT                   LERYLRLENLKDLDVLLARGDNFLRWADEGGAEDFDRFEEARKMYARAMEYHGSRAPIV
FT                   QRMLMYFVHQEEKALELGRTDVDNLSHVEQLVEYILERPKLAVDAGELARAGGYLIDRN
FT                   RIDRVRDVLFRAREIQDPHPEVHYQLARYFRIVERPADEAKALQAARLLLEELPMRTRR
FT                   QTAQLVDTYRRQGDLFYAQGELLSAEDAYREAIRLYEQALSSRLLKRSARFGSIYASLA
FT                   DIYYYHSAEEETALTLYETAESHGYVTPENAYKKGRLLYRKGLYDRALTEFAKSEEAFR
FT                   NNRVVLFALANALYFKASYTAAEGYYRRLLDMLEREKAALPAVRVDENPDHRALVEGII
FT                   RVENNLGVTLFKRSGGREGHPAYPEALTFLTDAQELFVNLYRDPETMERAGAVNLAYLN
FT                   MDAILHPTVPFDQLPLAIYRSLPVDVKARGLSGP"
FT   gene            complement(232657..233751)
FT                   /gene="ilvE"
FT                   /locus_tag="STHERM_c01780"
FT   CDS_pept        complement(232657..233751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="STHERM_c01780"
FT                   /product="probable branched-chain-amino-acid
FT                   aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="BCAT"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01152"
FT                   /db_xref="GOA:E0RNF2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF2"
FT                   /protein_id="ADN01152.1"
FT                   /translation="MAKSFSLSLYPWVYKAQHQPDGSWQEAFEAKVHLAPEAEATLPHE
FT                   ARMALLARRNSFPDLPLVNYSTQYGFSVFEGLKAFPQKDGSLKLFRPEENARRMRRSME
FT                   GLKMPGFPEELFVRAVKEVVRRNKELGFYPRYNPEWEKDGFLSGHAVYVRPFSYTEPGI
FT                   GLDLSHHPWVVIITTPVGPYFEGPNNKAVTTDRIRATPKGTGWIKCSANYVIPTLVKKE
FT                   ANEQGYMEAIFLDAREQRYVEEGSSCNIFFYLKNGTLVTPELGDTILPGITRKSVLALA
FT                   AHVGIPTEERKISIDEVLSEAKEVFVTGTAAGISYIESITHKGKTVVFNNGKMGEVTRT
FT                   LLLTLKGIQYGAKEDPFGWMIPVE"
FT   gene            233907..234965
FT                   /locus_tag="STHERM_c01790"
FT   CDS_pept        233907..234965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01790"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /note="GDP-mannose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01153"
FT                   /db_xref="GOA:E0RNF3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF3"
FT                   /protein_id="ADN01153.1"
FT                   /translation="MVDVVVVLAGGKGTRLWPASTEAHPKQFLTVEGGRTLLEEALLRA
FT                   WALAPGEGVIVVTGDRYLEATEEIVDRLPREQREATRLVGEPEGKNTAPAVMCAATLMR
FT                   EREGVMVVLTADHLVRPLETFVEDVGKAAQIARDGYHVTFGIPPVRPETGYGYIHVGAP
FT                   YKGGFIVESFTEKPDEATARRYVEEGTYYWNSGMFLFRRDVFLEEMERYAPRIARPFLE
FT                   AGLGGLASAGGPVRGDVLEELYARIPADSIDYALMEHTERAAMVPARFSWSDIGSWEEY
FT                   TAWLGDHLGEVLEVESEGCTVVSDLPVVLCGVEDLVVSCRNGRILVLRKGRGQLVKKAV
FT                   ERMRWEGKGWEA"
FT   gene            235133..236509
FT                   /locus_tag="STHERM_c01800"
FT   CDS_pept        235133..236509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01154"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF4"
FT                   /protein_id="ADN01154.1"
FT                   /translation="MKRGLMLLLALTVVASLAFAETSAQVEYSISGSATSTVGYDLDGK
FT                   TFGIKNETSADLTITFVEGTEEKGGDGPVYGWIKLEGFSAKAGNNIVEEDVVLYDADGN
FT                   DITEDVKSVLASSGVNVDSIKAKSDFVITPPSITAKLMMGPAYLLITTKDTDVNKASLE
FT                   PDYIKEEAFGGSDVSAVSLDEDDNTLTFGVDVDMVSASVTLGSNDDWNGSNENAGLISG
FT                   EVSVNVAPVSLGVKTTGVFGKGGKSIGEDANNPLILGADLAVSVDASGISITPAVAYDF
FT                   IKKGDESAQEVKGGVSVSYSGLSAGVDTIYVLPAEKESRLLVKGSVSEPADGGVVPVAG
FT                   FGLKAEYGMSKNDNTKAEDSAMALTVDLDAALGVARPYAGVIYEQDLGDDATTDDAKTD
FT                   LMIKVGTDITVVPNTTFTLQYASGDLTHEESVANYTADVYTNDSGARLGEITFAIKISY
FT                   "
FT   gene            236697..238115
FT                   /locus_tag="STHERM_c01810"
FT   CDS_pept        236697..238115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01810"
FT                   /product="anthranilate synthase component 1"
FT                   /EC_number="4.1.3.27"
FT                   /note="anthranilate synthasecomponent I"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01155"
FT                   /db_xref="GOA:E0RNF5"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF5"
FT                   /protein_id="ADN01155.1"
FT                   /translation="MERPDIRVRMLPAERFTPFSLARKLGARVLLESASLQQGRGRYSL
FT                   LLVDEAFRVSQTREGVFLSRGEKTFRVRHQGRDLLDVLSYFARQHAPLDGGLPFPAGGV
FT                   GFLSYEFCTYCDTIRLEERPDPIGLPLGAFLFGHVWVVMDHYTDRMYLVGMNYREAEVD
FT                   LERALDAVERRLENLDFSFLEAPEEGRYPVEDLSGDQQWFLDAVTVIKDHIVRGNLLQA
FT                   VPSRRKTLRTAVPAFEAYRILRSVNPSPYLFFLDFGSFQLFGSSPEVHVKVKDGEAVIR
FT                   PIAGTRRRGRDQEEDRALEAELLADEKERAEHLMLVDLARNDLGRVCEPASVHVADLMV
FT                   VERYSHVMHIVSEVRGRLREGKTGIDALRASFPAGTVTGAPKIKAMEVVSGLEPVARSF
FT                   YAGVVGYLEPDGSLDTCITIRSGLKKGDMLFLQAGAGVVYDSRPEREFEETEEKLAALM
FT                   HAIGLEDAHVPSHR"
FT   gene            238096..239694
FT                   /locus_tag="STHERM_c01820"
FT   CDS_pept        238096..239694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01820"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01156"
FT                   /db_xref="GOA:E0RNF6"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF6"
FT                   /protein_id="ADN01156.1"
FT                   /translation="MYLLIDNYDSFTYNIYQYLCELTGEPVRVVRNDEITVEEVEEFRP
FT                   EGIIISPGPGRPEDAGISLEVIRRFAGRVPILGVCLGHQCIGQAFGARIVQAKRIMHGK
FT                   TDTVHLDGRGIFRMLPRTLTCVRYHSLVIDEESLPPEFEVTARSSDGEIMGIRHKEWVL
FT                   EGVQFHPESIATEEGKRMLANFLSYKREPFDYRGFLGRLLEGEDASREEAEEFMDELTS
FT                   GNLTPAQIAGVLVALNAKGFAPQEVAGCAAVLRRKAVPFPARGEFLDTCGTGGDGLGTF
FT                   NISSCAALVAAACGVPVAKHGNRAVSSKSGSADFYGALGIPVDLGPDEAARMLREEGFV
FT                   FLFAPRYHGAMKYAAGPRRDLGIKTIMNFVGPLSNPAGAKYQLVGVFSRDYLELMAEAA
FT                   LQLGVRRVMAVHGEDGQDEVSVTGRTFYVYLDAEGRREEGVFEPEELGVGRHPLEEVLG
FT                   GTPEENVEEARRLFAGEGRPAIRDAVAANAGVALYVAGAAGSPQEGVRMALDVLSSGRV
FT                   RELVERLASYGKERV"
FT   gene            239691..241133
FT                   /locus_tag="STHERM_c01830"
FT   CDS_pept        239691..241133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01830"
FT                   /product="anthranilate synthase component"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01157"
FT                   /db_xref="GOA:E0RNF7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF7"
FT                   /protein_id="ADN01157.1"
FT                   /translation="MRSGVSGDILDRIVEERRRRVAEEGPAQGVRIPAWREVPLVPLVQ
FT                   EPCVIAEFKRRSPSRGAICDEADPVVQVGAYVAQGVRAVSVLTEEAYFGGSLADLMRVK
FT                   ERFPHLAVLRKDFLLSEEDVEVSYRAGADAVLLIARVLPQDRLGRMLDLTGRCGMTALV
FT                   EVHTPEDVEKVRRFEPPLVGINARDLATFRVDLLHPVRLRGLVDWDARVVFESGLWTRA
FT                   HGYVAGSSGAWGVLVGEAVMREQGRVREIMEGLAAGKRDWVRGRRFWSGLPAGRTLVKV
FT                   CGLTREEDVALADRLGADLLGFILAPSPRQVDRSFLERIGPVRARRVGVVVGEQGGGLE
FT                   EAVRLVEEGLLDGIQCHGEEDPEVVGSLCVPWYKAVRVRERGDLEGGERYGAVRVLLDA
FT                   RVEGVCGGTGVRVPEEVVEEAARRGPVWLAGGLGPGNVGEVVRRFRPELVDASSGLEAA
FT                   PGVKDREKLERFFREIRDAEGV"
FT   gene            241117..242340
FT                   /locus_tag="STHERM_c01840"
FT   CDS_pept        241117..242340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01840"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01158"
FT                   /db_xref="GOA:E0RNF8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF8"
FT                   /protein_id="ADN01158.1"
FT                   /translation="MQKVYNDFFGTFGGRYVAEVLRCPLDELEQAFLEAMADPSFHAEL
FT                   AEAQRHFVGRPTPLMYAENATRALGGSRIYIKLEGLANTGAHKINNALGQALLAKRMGK
FT                   RRIIAETGAGQHGVATASVCARLGLECTVYMGEVDMARQRPNVYLMELFGAKVVPVRSG
FT                   SRTLKDAVNEALRDWAASWEDTHYLLGSALGPSPFPDMVREFQSVVGREVVEQIREQVG
FT                   EEVEALVACVGGGSNAIGFFAPFIEADRPKLIGVEAGGRGNGPGEHAARMSGAGVEGVV
FT                   HGYKSLFLLDEDGQVLPTHSISAGLDYPGIGPQLAYLGRIGRIRFTTASDAEALEALKF
FT                   FARHEGVVFALESAHAGAVAMKMAREGSPDKAIIVNMSGRGDKDIFITAKAIDGEKWRE
FT                   FLLREASS"
FT   gene            242337..243110
FT                   /locus_tag="STHERM_c01850"
FT   CDS_pept        242337..243110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01850"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01159"
FT                   /db_xref="GOA:E0RNF9"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNF9"
FT                   /protein_id="ADN01159.1"
FT                   /translation="MSARIMAHMVSFFPDEARSREVAQALVEGGAWALEVQFPFSDPTA
FT                   DGPAIQEACTRALEAGFTVEKGFRFLEWLKGRWPDLPVFLMCYGSIPVRKGVEAFVARC
FT                   ADLGLEGLIVPDLPPDYDEGLYGAGARHGVPVVPVVIPQIRGERLSRILSLSPAYVYAA
FT                   LRKGITGYHTEIGEENLSLLGTLEAAGTRTLAGFGIDSPEQVALLAPHVHAVVVGSAFV
FT                   RVIASCSGSPAAPLKAKIRELLCSEEGEPSRVDGI"
FT   gene            243159..243479
FT                   /locus_tag="STHERM_c01860"
FT   CDS_pept        243159..243479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01860"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01160"
FT                   /db_xref="GOA:E0RNG0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG0"
FT                   /protein_id="ADN01160.1"
FT                   /translation="MSLHVKTADFEKEVLQADIPVLVDFWAEWCMPCRMVSPILDELAE
FT                   EYAGKLKVVKVNVDEEPDLASRFGIVSIPTILLFKNGQVAAQQIGAAPRQVFEQMIQPH
FT                   LG"
FT   gene            complement(243476..244480)
FT                   /locus_tag="STHERM_c01870"
FT   CDS_pept        complement(243476..244480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01161"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG1"
FT                   /protein_id="ADN01161.1"
FT                   /translation="MREVQILLVVISCVIASACLEEGIEEAFDLSPPELVSWEAVSEEE
FT                   ILITFTEEVKASPDDFFLPQGKTLTSLTVEGEDLRLTISPPSLPGEPLPLEGRVRDRVG
FT                   NSLTFFLVVYGYNERVPEVLINEFTTQGSSSHPDCVELYLVTEGNIGGLVFYEGTDTDW
FT                   DQMFVFPPLDLPAGSFVILHTKPDGIPGEIDETTDPAASGGKDSHPSAWDFWLPDGKGL
FT                   SGNNGVLTLYTRPGGRLLDAVVYSTGTSERYEGFAQKKVLDRVREVEDLGGWKGASSPL
FT                   TPDDCIDPDPSTATRSICRASVPQDTDTKEDWHIVTTGGATFGGPNSDEVYTP"
FT   gene            244532..245155
FT                   /locus_tag="STHERM_c01880"
FT   CDS_pept        244532..245155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01880"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01162"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG2"
FT                   /protein_id="ADN01162.1"
FT                   /translation="MAGNPLVEKYGQLFPAGRIIFKEGDPGDKMYIIQEGKVRISKQVG
FT                   GKDHTLAILEKGDFFGEMALVMRSPRTATATAVTDVLALGFTREGFQSMVEKNARIALA
FT                   IIDKLCRRLNQTNLQLQYLVRRNLKNLILLDLYFVFKGTQGLVRTVPYNQTVHEIALNK
FT                   EVDAAEVERAIQDLIARGILERSGNDLVLMDMDGLKAMVDGAER"
FT   gene            245226..247049
FT                   /locus_tag="STHERM_c01890"
FT   CDS_pept        245226..247049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01890"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01163"
FT                   /db_xref="GOA:E0RNG3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG3"
FT                   /protein_id="ADN01163.1"
FT                   /translation="MCGIIGYCGPKPTARVLLEGLKRLEYRGYDSAGIATVRDGALTVI
FT                   KRAGKIKDLEGIVPQDLDGEYGIGHTRWATHGGVTDTNAHPHVSQNGKIAVVHNGIIEN
FT                   FQSLKETLEERGYRFVSETDSEVLAHLIEDFYEGSLEEAVKRALSLVKGTYGLLCVHAD
FT                   EPQVIVGARNGSPLVLGVGEHEMFLASDVSALLGHTRQVVYLEDNEVVRVTPEEFLTTD
FT                   LRNTVIDKKVELITWELEEIEKGPYQHYMLKEIFEQPESIKRAMQGRIDEEYATAHLGG
FT                   LNMTSRELLEVEQVVIIGAGTSYYAGMLGAYVIEQLARIPSVAELSSEIRYRNPVVRKN
FT                   TLYFAVSQSGETADTLYALRELKRKGARILGICNVVGSSIPRESDGGVYIHSGPEIAVA
FT                   STKAFTSQVTAFYLFALLMARMRHLSYEEGLLFIRALREVPERLREVLEKAPEIKALAR
FT                   KYAWAKNFLFLGRGLNYPVALEGALKLKEVSYIHAEGYSAAEIKHGPIALINPETPSVF
FT                   LVPHDELREKVLSNMKEVKSRGGKVVALCTEGDPDVREIADDVIEIPAVYRYMYPYLMV
FT                   VPLQLFAYYMALELGRDVDQPRNLAKSVTVE"
FT   gene            247094..248197
FT                   /locus_tag="STHERM_c01900"
FT   CDS_pept        247094..248197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01164"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG4"
FT                   /protein_id="ADN01164.1"
FT                   /translation="MKGSGVLACLLLSVGALGGLDLSLSSDDLLVEQALEGGYHLWIRK
FT                   KPDIASVLLTESTEDPARKVASYAFRTTVYNPVNGDERRILDGEFLDTSRGYHLVDSTP
FT                   ESHPVFGEAFHIFIPYVVIYGYPWSRSGELLVVDGTYLNVRTFEKRYADYTGAFQDNPF
FT                   ILRVIQKPFEGPPEENYMPAAVESFRKLAEESRTPLLYSTGQEDVLKRIEEVLSEREGD
FT                   TLDLVVVLDTTQSMEDDIPYVKRELGPLVRRVCAPYRSVRIGVVLYKDYMEEYLNKVIP
FT                   FERDMGEFQRLVQGIRVSGGRDLPEAVHEALYAALVRFDWQAEDRKIILVGDAPPHPRP
FT                   RGAVTEEMVRREAERKKVRIYPVLLPQ"
FT   gene            complement(248199..248612)
FT                   /locus_tag="STHERM_c01910"
FT   CDS_pept        complement(248199..248612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01165"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG5"
FT                   /protein_id="ADN01165.1"
FT                   /translation="MRRTAFLVGVLVITILSTGACKSTPPEIPEGLSREELFQRAQEAV
FT                   DRGDEQTALLYYQTVLERYPDDLEGRAAAEYEIAHIYYKQGLYGEAKDLFLTILSYYDT
FT                   QEGTSLPLWIKVLSEKHLSWIQEKEAEQEAQGS"
FT   gene            complement(248633..248938)
FT                   /locus_tag="STHERM_c01920"
FT   CDS_pept        complement(248633..248938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01166"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG6"
FT                   /protein_id="ADN01166.1"
FT                   /translation="MGKSGSTLSSREKKKKIYCANCIHCKVSAEPTGGGYLLRVRCAAG
FT                   KWRKKMGAEKLYRLSTVMRRVMTECEAYEPMGDEEEFLRELKKTLPVQDDPYEISS"
FT   gene            249042..249728
FT                   /locus_tag="STHERM_c01930"
FT   CDS_pept        249042..249728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01930"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01167"
FT                   /db_xref="GOA:E0RNG7"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG7"
FT                   /protein_id="ADN01167.1"
FT                   /translation="MIATFVNMVTVIVGSLLGLLFHARISEDFKKVVYQGVGIFTLVIG
FT                   LSMALESQRVLWMALSLVAGGILGTWWDIEGGIYRFGEFLKRRVARAEGESTFASGFLD
FT                   ASILFCVGAMTLVGAFKAGTEGDYTLLLTKSVMDGFMAILLTAALGMGVAFSALTILVY
FT                   QGGLTLLSGFLQPLVTETILNEVTGVGGAMVMMIGLNLLGVTRIKTGNFFPALILVVPL
FT                   CFVPWF"
FT   gene            complement(249768..251090)
FT                   /locus_tag="STHERM_c01940"
FT   CDS_pept        complement(249768..251090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01940"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01168"
FT                   /db_xref="GOA:E0RNG8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG8"
FT                   /protein_id="ADN01168.1"
FT                   /translation="MDRHKIALIGCGTVGSGVAALLTKDADLLAQRTGRHLHLAYVVDR
FT                   DFSRARALGLDERLFCDDYRKALADPEVEIVVELVGGTGVAKTITEEALKAGKHVVTAN
FT                   KALLAHHGPDLLRLAREHGVAVAFEASCGGGIPIIRALYDGLIANRIDALYGIVNGTCN
FT                   YILTRMIGEGIPYEAALKEAQEQGFAEADPTLDVSGMDSAHKLTIMASLAFGCRVDLNA
FT                   VPVQGIHRLELLDITYGRELGYVMKLLAVARREEGGLSLVVRPSFISTEHPLAWVSGSF
FT                   NAVSVYGHATGHTMYYGRGAGSRPTASAIVADIVALVTGTYPRLFQALPLWPDRGTPPT
FT                   YLPLEATISRFYLRIMVEDRPGVLARITGILGEHDISISSVLQKEVPEGRSTNHVPIVI
FT                   ITHTVGEARVQEAADRIGNLPTVHERPVIIPIVDEHEESIG"
FT   gene            251186..252073
FT                   /locus_tag="STHERM_c01950"
FT   CDS_pept        251186..252073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01169"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNG9"
FT                   /protein_id="ADN01169.1"
FT                   /translation="MKRAVYPVSALKRRLPEAEIWEEPSLPSEGALRRGVVPPLLWAPD
FT                   GLVWSGALCDRLREAGWKEIPVVLLEGEEARPLNRITAALECENRAGAYTWEEQAHIYE
FT                   LCRTYGLLEEAERIVPLVVPGKRDFSHVERYLSLPASFREMVREGKVDLKTAWEVRDLP
FT                   DPVGGLVSYYPHRMTFSERRQILVMLAEIVRREGLDERAAMHRAGELLASPKPLEAVRR
FT                   ARFPRLAGMEDSFTASRRRLLDGTGVALEAPPGFEGHSLRVSFRFSSRTEFARRMKALS
FT                   KLEEHLDEFLSFLG"
FT   gene            252048..253136
FT                   /locus_tag="STHERM_c01960"
FT   CDS_pept        252048..253136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01960"
FT                   /product="putative photolyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01170"
FT                   /db_xref="GOA:E0RNH0"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH0"
FT                   /protein_id="ADN01170.1"
FT                   /translation="MSSFRSLAEIGHVYVERGALSLPAVERARESLAGASWHVVEGKEE
FT                   IPPEDLNSRTLFLTRPKGRIVGRCPGSRGHVCCNYLTVDLYVGCPLGCSYCVMRGYLNF
FT                   SPLVVHVDPRPAVEELVRLAETHPDRPIRVGTGEVGDSLFLDPVFRLSEEFIQALAPYP
FT                   HVSFELKTKTASVDHLLGVTPKGRAVVGFSLNPPRVVAEEEGAAAPLEERLEAAGKALD
FT                   AGFRLSFHFDPVFRFPGWEDAYARVVKALASFPAERIAWVSLGTIRYLPALKERMAGRP
FT                   YLYDEFVLSRDGKFRYLQSMRVEVYRRMRDLVTGIWPGVPVYLCMESAAVWYRVFGALP
FT                   QKIPGLWAIFERVALSGERGKR"
FT   gene            253133..254197
FT                   /locus_tag="STHERM_c01970"
FT   CDS_pept        253133..254197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01171"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH1"
FT                   /protein_id="ADN01171.1"
FT                   /translation="MKRMVLVSLLVWVGLYAAGSEVGMVSYVEGEVVLLREDREPLPVD
FT                   FGMEVREYDLIRTGDDGYVVVDFLEEGGISGSVEIRPGSVFQVVREEEEKTTAMELFAG
FT                   QVFLKVKRLAGTDEVVVRTEGAAMGVRGTEFEVITSAGGDLLVVCTEGRVACRTGEGET
FT                   AFAEPGKAVERRVGERLRTVLFRLAEAEDLKRNWLTERMEAFRANAPRVFSLYARLYRE
FT                   RKGAFDEAYRDLLRRQEVVNEWIRRYKQGRLSEGGPEALRERKELAGVMLRLRKELFLF
FT                   SRVYYRLVELVSYYHEGVGHGRLDTGEGIGSFVAQVEKEARELASRLQYVRFVMFLFEQ
FT                   RGRSLLGESLLFED"
FT   gene            complement(254264..255361)
FT                   /locus_tag="STHERM_c01980"
FT   CDS_pept        complement(254264..255361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01980"
FT                   /product="sugar ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01172"
FT                   /db_xref="GOA:E0RNH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH2"
FT                   /protein_id="ADN01172.1"
FT                   /translation="MATVELKNVTKVYGGKVTAVKDANISVEDGEFVVLVGPSGCGKTT
FT                   TLRMIAGLEDITEGDLFIDGARMNDVPPKDRDIAMVFQNYALYPHMSVYDNMAFGLKIR
FT                   KFPKEEIDQRVHKAAQILDIEELLERKPKELSGGQRQRVAVGRAIVREPKVFLFDEPLS
FT                   NLDAKLRVQMRAELSALHHRLGKTMIYVTHDQVEAMTMADRIVVMRDGLIQQIGTPLQL
FT                   YNHPVNLFVAGFIGSPPMNFISSTIREEGAHLVADEGDFQIIVPEKYEKALKPYVGKQI
FT                   IFGIRPEDLTYDPSGKGEIKATVTVVEPLGAEIHLYITTGQNQIIARTPPQHEFKVGEK
FT                   VSFKPNLERAHFFDPETERSLTAEL"
FT   gene            complement(255431..256615)
FT                   /locus_tag="STHERM_c01990"
FT   CDS_pept        complement(255431..256615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c01990"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01173"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH3"
FT                   /protein_id="ADN01173.1"
FT                   /translation="MRGVLLFLLIVFSFIGCETTVDFSARLLTTIPETTLWVEAFHRTY
FT                   SHDHIEVLYAPSLEEGLSRYRDIDLVISEETLPASRLFPYPPGAENPLCDPDSFYPGIL
FT                   AALGNGSTLIRYPLSFSLPVLAYESASLTELQPGSLTDLETIIELSADHTTTRRGAITR
FT                   IGFFPGLAPSWVEHYLPLFDVTFLLGPGGKIIWDQRSLEGFMDFLTSWYNRAGISHREV
FT                   VHYRERYLTLPPAENLRQGRATMVYLSLATFFMIPEEARSSLDFVYLSHRGRVPAIPPV
FT                   TTASILRDAPHRDTAEHFLRWLLSPEGQEEILAHLGRTGIPFFGLAGGLSSLVEVSEGI
FT                   LPRIHPRLAGEIPPPNAILFTPPPREEVRRFYAESFLPWLEAALEGEAGKPLSP"
FT   gene            256677..257633
FT                   /locus_tag="STHERM_c02000"
FT   CDS_pept        256677..257633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02000"
FT                   /product="radical SAM protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01174"
FT                   /db_xref="GOA:E0RNH4"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH4"
FT                   /protein_id="ADN01174.1"
FT                   /translation="MMGNREGLRYRSFSRYLKERFGGMVYRVGVDAGFSCPHRDSREGR
FT                   GCAFCDVEGSRAPYLGDVRGLEEQVRRAKGFLKARYGASRFLLYFQAYTNTYGPVEELR
FT                   RVYEAGLAADEGEWVGLIVSTRPDCLPDEVLDLLASYKARGLEVWVELGLQSAFDETLR
FT                   RIRRGHTVAQWEDAVRRAGEAGLLRAAHLIAGLPGEGREEFWESARFVAESGVEGIKFH
FT                   DLHLPVGAPLFREYLRGELSLLSRERYLDYVMGALERIRPEMVVMRLVTDTPPERRGMP
FT                   RHYMPKGRFLRRLEDEMRRRGTRQGRLWVEAGGRNTR"
FT   gene            257651..259357
FT                   /locus_tag="STHERM_c02010"
FT   CDS_pept        257651..259357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02010"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01175"
FT                   /db_xref="GOA:E0RNH5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNH5"
FT                   /protein_id="ADN01175.1"
FT                   /translation="MILEVRVRRLGFPLDVDDTDISKEERGMWWKRVLERSYQGADLIV
FT                   KRKVSSLLFLDTFLGIGFVCLALVRLFQGMVRMGVGELVVAGVFLVYVALLLLGRFKLV
FT                   STGNVFLMWLAALVFFFMREIVSPRDIYVQATYLIPTLISLPLLAYASWQVITLIVLNV
FT                   LTLVFAYAVRIRPVALSAGAGDGLSEALVALILMIFSAAFIVHIFNLQYRSFRELQEQA
FT                   QVAVARYRGLHGLVEESAVAFNLGEHLSEHAARNAQRSSEMREGLVRMGELVLQLSDYA
FT                   ASAGEAEGRVKGARGLVRERMGAVKEAVAQTSSAVEELQAQVRNMASTASSRREELEAL
FT                   AGEAAAVLGRFEGARELFHRIGAHSGEILQIVQTITKIAGSTNLLALNAAIEAAHAGEA
FT                   GKGFAVVAEEIRKLAEESNAQARRIGETLGENNALVQEAVQALEEFREVFAGMKERIEE
FT                   TRDSLVEILGGMSESAAGYRQIEEAVASLSTLSQEVEEALGRMEGELDASGASIKRMRN
FT                   LVDVVREEVERVASHADAVLESTRELSRKGEENLAAYRRVMEGLKELDRMG"
FT   gene            complement(259399..260691)
FT                   /locus_tag="STHERM_c02020"
FT   CDS_pept        complement(259399..260691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02020"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01176"
FT                   /db_xref="GOA:E0RNQ3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ3"
FT                   /protein_id="ADN01176.1"
FT                   /translation="MKLNPLAQSLNQTLEGSVAYRLLSDVGKRMFFPRGVAAQSMEAKE
FT                   KAHRFDATVGIANVEQGRPIILEEIHRWVPELSPAEIVSYAPTPGDPELRKLWQQEILR
FT                   KNPEVPLDRISLPMVTSGLTGALSQVADLFVNPHDHVLVSDFFWGNYRLLFEGRREAQL
FT                   VTYPLFTEEGSLNLEAMERTLREIPAKKAVLVLNFPNNPTGYTPTVDEAQAMAGLLARC
FT                   AEEKDLLVVCDDAYFGLFYEEGIYPHSLFNLLATAHPNLLAVKVDGPTKELYVWGFRIG
FT                   FLTFGSPVLTAAQFDALNQKLAGSLRATVSNSNRLAQSLLKRALTSAHTPSELAKWADL
FT                   LKARYQKTRQILSRMGDDVPLVPQPFNSGYFMCFKTRGIDAEALRQTLLEKGIGTISLG
FT                   RDVLRVTFASIPEEHLEELFSEIFETARNLA"
FT   gene            complement(260785..261846)
FT                   /locus_tag="STHERM_c02040"
FT   CDS_pept        complement(260785..261846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02040"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01178"
FT                   /db_xref="GOA:E0RNQ4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ4"
FT                   /protein_id="ADN01178.1"
FT                   /translation="MMSSILPRNPFRTGAVPGIPSLILYILGENILNCQRNMSKGLTFE
FT                   AILDLSRETGLTEVYPASSEGIPGLDPHRHPSFLITHLPYTVPTPRPSPLPSARIAPFA
FT                   CANHYRELSHTLRRLVSLIGQRTGHPKSAFRVFSNSPLPERAMAHRAGLGVPGRNGLII
FT                   HPVYGSYIALGGILLPFPLDIPPPPPPPPPLSPCGPCTACLTACPTHALPGDGTLRKDR
FT                   CIQYWAGTHGIVPDPVKAAWGPTLYGCPHCQAACPYNRRPAPGRRPVLRGRIGPTLPLT
FT                   LLLGTPASLLKALLRSSALQLGWLSPLTLQRNALLAAAATGARPLFHYVEPYLTHPDPV
FT                   LRDAARWALHRLS"
FT   gene            261779..263353
FT                   /locus_tag="STHERM_c02030"
FT   CDS_pept        261779..263353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01177"
FT                   /db_xref="InterPro:IPR035196"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ5"
FT                   /protein_id="ADN01177.1"
FT                   /translation="MSDGIPGTAPVRKGFLGRILDIILGANDPARQKRRALRQIAKEIR
FT                   RSKYRFYNPRSDEALPQLAQFFFQIYQVIGPAQTLLQHADSSKALRRLVVESFLPEEKR
FT                   GILARLDPGALRVRVKEVSLEQLTEEVKGDLVELYDLCSRDRAERMNRVYETILYLVGF
FT                   VKFDFYFLLKKFDASFPEQDPSYTPRFEPISAEYVVDDLKDFLDVIGPLDPALPWQEVF
FT                   PVLRLYKGVEVVDPRLWQRMFNALMAVKRSDILVKIVQHVEKNPAFQPEVRGSRQDIVE
FT                   GVLEELRRDAEAVIRGLREEKRKVKLGQLLRMVFGTDAVARSRYYTEATASAFARHDVG
FT                   TFLYVEPFNYLKAFLLDFYKRDVRMLAELFIVRGKWTAPQVSQELSDAYYRVMDIAQEV
FT                   VELDESLSDEGERGQKIRQYLHRSGSGKEPAVKRVLKQYIDDVNEAVRRMVMETAQNLI
FT                   SIGKIFKSLIEDSQGSKREVILNWREVENAYEGEDLQRDMVETYKKIYYFIQILQLFFT
FT                   RKRQPEE"
FT   gene            complement(263392..264558)
FT                   /locus_tag="STHERM_c02050"
FT   CDS_pept        complement(263392..264558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01179"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ6"
FT                   /protein_id="ADN01179.1"
FT                   /translation="MVTHRSKWIILSTVLLLGVIPLWSEQQIRVIMDTALFGMRIDEET
FT                   WSLFSTGSGELDLQSRGNRNVRARLSLTASLGQEVGTDEGTSSLTGRETATFGIHYAYV
FT                   KVRIPLAERYAVRLSMGKNALTWGVGSLFNAGNIAFNPTATQGASLLAVEGPVREDTAW
FT                   YASLYLPLGTYAFLEPVALVALAPASEAPLFPTPEETSLGARLHTKAGPLLLEAAYLHD
FT                   GREARHVGALTLQGNLGADLYLSVSSSLPGETDDILSSLKEGLIISTGAFWLNPIEVGE
FT                   GLSLRIEALVIPDASWEEGTAGDLSDYGIHLYHELSLAPSDRLTLLFRGLLSPIDLSGV
FT                   GIAGLDWNLDQGLHLYSFFSLQVGEETDLYSPSHPGGIALAGGVRYTF"
FT   gene            complement(264552..265292)
FT                   /locus_tag="STHERM_c02060"
FT   CDS_pept        complement(264552..265292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02060"
FT                   /product="predicted outer membrane protein involved in
FT                   lipoprotein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01180"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ7"
FT                   /protein_id="ADN01180.1"
FT                   /translation="MNTRRIASTLLVFLLAGGLLSALTPEEILDLVEENQTFSTFRGEG
FT                   KMVITDRFGTRTKTFRFYAKGEEQSLIEFTSIDEAGQKILRTEDEIYLYYPDAEELIRL
FT                   QGAALRESVAGSDLSYEDLTGGKELKDKYRVRLEGEETANGRPCYVLVLEAKVKDVAYP
FT                   RQKLWVDKELFVGWKAQYFALSGKVLKEVEVKEIEEIKGHSIPVHYVFRDMLKRNSSTE
FT                   FLISGIEVDIPLDERIFSLEELTW"
FT   gene            complement(265303..266556)
FT                   /locus_tag="STHERM_c02070"
FT   CDS_pept        complement(265303..266556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02070"
FT                   /product="putative permease involved in lipoprotein
FT                   release"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01181"
FT                   /db_xref="GOA:E0RNQ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ8"
FT                   /protein_id="ADN01181.1"
FT                   /translation="MKLSQIAWRNIFRNRRRSLLSVLALAIAAMSLVLLFGLIDWMKDD
FT                   FRTNLFRFYTGQIRIRDREFDTYEHLSPLHLKVEHALDLVEKIEQIPGVRAAAARIGFP
FT                   AMVLEEEGTFLGVYGRAMDMEQERKVANLDEYLLTGEFPKAGSREILLTPSLAEELGKQ
FT                   VGDTLTLMARTATYGTNAMTFTITGLVRFPFSSLDRAFFIPLDTGQRLLRMRSQDGSTF
FT                   DAASEVVVLLEEGVKERDVLPHIQSLLATGSYGDVEARPWQELPTLYSVIRITEITYNV
FT                   IGLLFLLLGSTVIINTTMMVIYERMREIGTMSAMGMEGGQLVRLFFLEALYLALIGAAV
FT                   GVGLGALFAYPLGIYGIDYTAATQDIQWPVSSIYYCTPTWRTYLFVFLFSVVVGAVTSF
FT                   IPSRRAAKLNPIQALRTI"
FT   gene            complement(266567..267832)
FT                   /locus_tag="STHERM_c02080"
FT   CDS_pept        complement(266567..267832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02080"
FT                   /product="putative permease, involved in lipoprotein
FT                   release"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01182"
FT                   /db_xref="GOA:E0RNQ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNQ9"
FT                   /protein_id="ADN01182.1"
FT                   /translation="MKAKTLFSLSLKNLTRYTRRTIITASAVAVGILLFIFVDSILKGA
FT                   ERDSERNLLWYETGSAQVFTGEFWEEKDRLPLNKGIEEPDEVVSFLASKGVKAAPRITA
FT                   LGELVVYKDPYPEDGSLQVRITAVDPVRDPEVFRLEDEVVEGSWFSGSPGEEGVILGQW
FT                   LAEDLGARVGYPVTLVTRTRDGAYQTMDLTIVGIVATPNPVVNRTGVYLPLDTADFYLD
FT                   MGGTVTSIALSLPEHIPVEEQVAALGPELAARFPGLTLKTWKDLAPGYVAIAQAKQGGT
FT                   SMILLLLFVIAAVGISNTMLMSIYERFREIGMMRALGMKESQIGLSFLLEAAGIGFLGA
FT                   LMGVILAVPINYFLVEYGIDYGWLIREMDVGYRIAGAFKGTWDPGSFLTAFVMGVLIAT
FT                   VVAVFPVRRAFKKSIVDCLYYH"
FT   gene            complement(267829..268518)
FT                   /gene="macB"
FT                   /locus_tag="STHERM_c02090"
FT   CDS_pept        complement(267829..268518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macB"
FT                   /locus_tag="STHERM_c02090"
FT                   /product="ATP-binding/permease protein MacB"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01183"
FT                   /db_xref="GOA:E0RNR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR0"
FT                   /protein_id="ADN01183.1"
FT                   /translation="MAIVELSGVKKDYHTGETVVHALRGVDLQVEPGEFLAIAGPSGSG
FT                   KTTLLNIVGTLDSADEGTVIIDHTDIPSLDPKERARFRRGKIGFVFQTFNLIPVLTAYE
FT                   NVAFALDLLDLPEREVRERTMQILKDVGLEGMEDRRPAQLSGGQQQRVAIARALVKNPI
FT                   LVLADEPTANLDSETGEAIVHLMQELNEKYGTTFIFSTHDKMVMDHARRLVLLHDGLIQ
FT                   EDIRRES"
FT   gene            complement(268505..269224)
FT                   /locus_tag="STHERM_c02100"
FT   CDS_pept        complement(268505..269224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02100"
FT                   /product="predicted transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01184"
FT                   /db_xref="GOA:E0RNR1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR1"
FT                   /protein_id="ADN01184.1"
FT                   /translation="MTGSDLHTVRDTRARIIETASRLFWEHGYDRVPVERIIREVGIAK
FT                   GTFYHHFRSKEDLLDAVVETFTDSIIDRLDKTLRDTSIPIEEKLTLLINQSVQFKLESI
FT                   PLMLTILKTWLDPANVTFREKMEQLSLEKFLPLMARFIEEGTEAGIFHIGRMRPRDVAR
FT                   FIMTLSFAITNETAEYLLGLKDHPEYEEKFTTLYESFQYAYERMLGLPEGYLDSRIGEF
FT                   LRATKAYLEKGADNGDR"
FT   gene            269282..270199
FT                   /locus_tag="STHERM_c02110"
FT   CDS_pept        269282..270199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02110"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01185"
FT                   /db_xref="GOA:E0RNR2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR2"
FT                   /protein_id="ADN01185.1"
FT                   /translation="MCFVRIVKRDARNIAIPARTGRHDWTEWTLLCYSYGSRRQEVNVR
FT                   SFLARKRQGKKISMVTCYDASFARVLNETEVDCLLVGDSLAMVIYGYPTTVHATLEMMV
FT                   RHTEAVRRGAPDKMIIADMPFLSMQQGKAHAVHAAGELIRAGADAVKVEGWKGIEEEIA
FT                   HLVQAGIPVMGHLGLTPQFYYAFGGFRVQGRDEASRTYILEGAGRLEALGCFGIVLECI
FT                   PSGLARVVTERISIPTIGIGAGSDTDGQVLVLYDLGGVGLEKPFRFVRRYAEVGLAVKE
FT                   AVDRFVEDVVEGRFPTREESFEDE"
FT   gene            270257..270796
FT                   /locus_tag="STHERM_c02120"
FT   CDS_pept        270257..270796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02120"
FT                   /product="putative pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01186"
FT                   /db_xref="GOA:E0RNR3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR3"
FT                   /protein_id="ADN01186.1"
FT                   /translation="MAKRILLHLTGSVACFKAAALASMLVKDGYEVQATATERALRFIG
FT                   PATFEGITGRPVLTDMFAGRPDFIPHITLAQEWADLLLVYPASANCIARLAAGLADDLF
FT                   GAIFLANNFQRPVWLAPAMNTQMYLHPATQRNLKVLEEWGVVILAPVEGRLACGTVGTG
FT                   KLADPELVFQKIKEEL"
FT   gene            270793..271479
FT                   /locus_tag="STHERM_c02130"
FT   CDS_pept        270793..271479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02130"
FT                   /product="predicted DNA / pantothenate metabolism
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01187"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR4"
FT                   /protein_id="ADN01187.1"
FT                   /translation="MRILVTGGGCREPVDGVRALVNTSTGRTAALVAEEAARRGHEVTA
FT                   LVGVAEVVPEGVEVVRFSCFAELAGRLEGLLRGGVWDAVVHAAAVSDFSVAGVWEEEAR
FT                   EEEEGRLRVVLRRVEGGGKVDSAGPVWIGLARNEKLLAGIKGWAPGVVLVGFKLTVGAR
FT                   DEVMEEAVRRIFEEGADLVVHNDMEEMGRGVRARIFTSPGEAEEVPTTEALASRLVGLL
FT                   EARVLS"
FT   gene            271541..271903
FT                   /locus_tag="STHERM_c02140"
FT   CDS_pept        271541..271903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02140"
FT                   /product="putative aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01188"
FT                   /db_xref="GOA:E0RNR5"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR5"
FT                   /protein_id="ADN01188.1"
FT                   /translation="MFIEVLKSKIHRAVVTETRLDYEGSISVDPELYRAAGMFPHEKVD
FT                   VFNLNNGARFTTYLIDGRPGEICINGAAARLAQPGDLVIIVSYAHLTPEEASSWQPTVV
FT                   LVDDRNTVKEVLKPGS"
FT   gene            complement(271898..275539)
FT                   /gene="metH"
FT                   /locus_tag="STHERM_c02150"
FT   CDS_pept        complement(271898..275539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="STHERM_c02150"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="methionine synthase, vitamin-B12 dependent;
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01189"
FT                   /db_xref="GOA:E0RNR6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR6"
FT                   /protein_id="ADN01189.1"
FT                   /translation="MTHPIEELLKERILILDGAMGTMIQRYHLSEADYRGTLFERGPTV
FT                   DGREVALKGNHDLLVLTRPHVIEEIHRAYLEAGADIIETNTFNATRVSQREYGTEDLVE
FT                   RINREAARLARRVADEYSARTPHRPRFVAGVVGPTSKTLSLSPRADDPAFRELSFGELE
FT                   EDYFGAVRALVEGGADLILIETVFDTLNAKAALAAVARFRRESGRAVPVMLSATISDAA
FT                   GRLLSGQTPRAFLHSVLHGRPLSVGFNCAFGPEMMRPHLKAIQDAPCAVSVHPNAGLPN
FT                   ALGEYDQGPDQMAATLALYAREGLLNIAGGCCGTTPDHIRAIAGTLEGIAPRPIPSPRP
FT                   VAVFTGLEVLDQEVAGFILVGERTNVAGSARFRRLLREERWEEALEVARAQISAGAHMI
FT                   DVNVDDPLLDPPRLMRHFLSLAASEPTVARVPVMIDSSDWEVLRAGLECLQGKGVVNSL
FT                   SLKDGEAIFLERARVVREMGASVLVMCFDEEGQAETFERKIAVAQRAYRLLVEEVGIPP
FT                   WDIVIDPNIFAIGTGMEEHARYGVDYLEAVRWIKEHLPHARTSGGISNVSFAFRGHEGL
FT                   RDAIHAVFLHHARAAGLDMAIVNPQRMMAYEEVPEEVRALIEDLIFARRRDATERLLEA
FT                   AQGLSSAGPRGRGEDRAWRELPVEERLAYALKEGIQGYLGEDLEEAHRKAGSALGVIEG
FT                   PLLTGMEEVGRLFGEGRLFLPQVVRAARVMREAVAILEPRLKAEQGGVGKARGVVVLAT
FT                   VKGDVHDIGKNIVKVVLECNGYRVVDLGVMVPPERVVEAARQGADAVGLSGLITPSLER
FT                   MRETAEALDRAGLAVPLLIGGAATSRLHTALRIAPAYRGPVIHVRDASEAVQVMGRLLS
FT                   EGREEFVREVRAEQARLREQGVKGRGGVLGLGEARRRRLRPGPASPVEPRVRGPQVVRM
FT                   GVAEVRPYLDWRMFYKGWGLPARTPERMREAERAEAVRLREEAEGVLARMEGRVRIEGV
FT                   VGFFPARDVGEDCIGVLGWGGEGVIRRLPMLRQQAVKEGEPTRSLVDFLPHEGHDYLGL
FT                   FVITAGKDIEHFLAEEGPGEPYRELMVRLLADRLAEAASEYLHMLVRTTLWGYAPEEHL
FT                   SPEEVLAGTYRGIRPAPGHAACPDHSLKQDIFELLGAEERLGIRLTESFMMVPPSSVAG
FT                   FYFSHPESRYFAVGRITEEQLRDYARRRERPVDEVRGWLDHIVVADS"
FT   gene            complement(275556..276314)
FT                   /locus_tag="STHERM_c02160"
FT   CDS_pept        complement(275556..276314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02160"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01190"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR7"
FT                   /protein_id="ADN01190.1"
FT                   /translation="MSVEIPPDHPRYRSLLYRERLIEGMEKKVTAPAGLIAHGRGEAFD
FT                   YLLGERTHPHAHTAIRQAAFLFLTSRHPVVSVNGNVAALCPEELVRLSKVTGAPLEVNL
FT                   FYRSREREEAITRVLREHGAERVLGVGAEAVIPELSSERRRVDPEGILEADCVFVPLED
FT                   GDRTEALVRLGKKVITVDLNPLSRTARTATVTIVDNIVRALPLFIEVIERHRDDPSSLA
FT                   VPDYDNKRILAEALSAIVRHLTAIAHELSD"
FT   gene            complement(276311..277216)
FT                   /locus_tag="STHERM_c02170"
FT   CDS_pept        complement(276311..277216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02170"
FT                   /product="predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01191"
FT                   /db_xref="GOA:E0RNR8"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR8"
FT                   /protein_id="ADN01191.1"
FT                   /translation="MQQVTVFCPGHVTGLFHVPPQPDDLLSQGSLGAGFSIDRGVRTTV
FT                   SIEKGEGIEVYIGGTEAEDPQLSVQTVAAFARAAGGLPEGKVVVRHEPEVPVGAGLGTS
FT                   GAAAVGIALGLNALVGGKLSEEEVYQVAHKAEILAQTGLGTVLGLYAGGCKVSVTMGAP
FT                   GRGEARTIEAPETIRVVIGVAGPFPTQTALQDEGVRARVEEAGRALHAALAAEPTFERF
FT                   LDLSREFSRRVDLFSPAVRPLAEACAKEGIHHAMLMFGDGLYSLVEEARAPEVEALYRR
FT                   LLPGATIFVCSITRERGKVV"
FT   gene            277387..278403
FT                   /locus_tag="STHERM_c02180"
FT   CDS_pept        277387..278403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02180"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01192"
FT                   /db_xref="GOA:E0RNR9"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNR9"
FT                   /protein_id="ADN01192.1"
FT                   /translation="MSERMITTTPEWLKEKAVLRLSEAGLPRDQAAVVAEVLVFADLRG
FT                   VHSHGVMRIPHYAERIRRGGINTSSTFPISPRGRVAFLLDAQGGMGHVAANKATEAALE
FT                   LVSKEGLALAGIRRTSHAGAMSYYVQKALDAGVAALVVANTDPAVVPPGGKVPFLGTNP
FT                   LAFGFPGLKDHVLLDMATSEVALGKVLYAREKNTTIPPTWAVDEEGNPTTDPHRAKWLL
FT                   PFGGYKGYGIILMIELLTSVLIGGAFGPHLVKMYGELEKQRNLAMWMLFIDPGLFRAAD
FT                   EVKALCQELVDEIHAQPSVSGEQVMVPGEPEQRTMERYLKEGIPLAEPVWRYLEEGR"
FT   gene            278499..278885
FT                   /locus_tag="STHERM_c02190"
FT   CDS_pept        278499..278885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02190"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01193"
FT                   /db_xref="GOA:E0RNS0"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS0"
FT                   /protein_id="ADN01193.1"
FT                   /translation="MRRPSPLTFVIGLLLLGYAVYHFVVGLTLWAVVKLLIGGGLIAVS
FT                   FTEARWALVLLGHLIMTCGALLVAAGVYYAPIVQRAVEETGRLSLLQILGQPLFWGVFA
FT                   ILGGVCATMHGFCRCVRKEWRLPG"
FT   gene            complement(279007..279525)
FT                   /locus_tag="STHERM_c02200"
FT   CDS_pept        complement(279007..279525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02200"
FT                   /product="predicted chemotaxis methyl-accepting receptor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01194"
FT                   /db_xref="GOA:E0RNS1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS1"
FT                   /protein_id="ADN01194.1"
FT                   /translation="METVQTTTHEVEEFLQAIDEISERINILALNAAIEAAHAGEAGRG
FT                   FSVVADEIKKLAEATAEHTTSISSAVTTLTTTLKTTTTLTPERTLSPLKTRLQELLDRI
FT                   LQLEEDLARPTLEGERGSLTSRLRTLKEELVSLQERTLHSFQETKQRMTHGLRELEDIL
FT                   ETLEDRIQP"
FT   gene            complement(279732..280976)
FT                   /locus_tag="STHERM_c02210"
FT   CDS_pept        complement(279732..280976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02210"
FT                   /product="predicted chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01195"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS2"
FT                   /protein_id="ADN01195.1"
FT                   /translation="MKWYRILFPLYLIILAAFPFLLTLSFPQQDIDHAETLLRSEIRRI
FT                   SDLYTRHYQSVEARIREEKEEIRSELEKRLSIGLAIVETYHELSRVRLLSTKEAQRRAR
FT                   EALRNIRYEDEGYFFADTVTYISLVNPPNPEQEGLDRENLTDITGTPYVKQMIDTAKAR
FT                   GESFQEYYFPHLSGGEPVKKWGYARLFEPWGWVLGTSEYMDTHERRWERLLEEARRALP
FT                   LQSDTEGIRLALLSPDGEVEGVPILSSLSPEERRALIQEALTSPREVHGQLIAASPLPD
FT                   GRTLVAVLPLTPTPADRLPLVLSVSLVLITLPFLRWRTGRREQRAHPASSTAAPPNANP
FT                   SPPPFHSPSPRPRRNPHPLSPPPHRPPPLPLNPPPRLHTPSRNPRHPPPPLLRPYPPPS
FT                   TSHPSPRSLSGNGKS"
FT   gene            281075..283777
FT                   /locus_tag="STHERM_c02220"
FT   CDS_pept        281075..283777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02220"
FT                   /product="putative histidine kinase"
FT                   /note="sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01196"
FT                   /db_xref="GOA:E0RNS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS3"
FT                   /protein_id="ADN01196.1"
FT                   /translation="MKGVSCVLLLSLVVGILSGEEGFVLPHELSSGWTLVPLFPGGGPQ
FT                   DVSLPLDYRPAGPRGEILLRCTFTLPSSPTEPVYLLVDRLPGAYRYILNGVFLDEEGGF
FT                   PPRFAHSRRDIYVRYIPPMQLREENELVIVAYEERSRIRIRRVALVDEREAFLVRNVRN
FT                   VLNARIYGYFAFLSLFVSLYFFGLYANRRRERGFFFYAVSNLGIALYFVRMASPLAFLP
FT                   PVLSYSVSKAGLIVSLGYLFVFYFEFFSLRGSDRLKRYVLTLVWVVGGFMVLVPQTLQD
FT                   AERVFASSLVLGFAFLVSYVVISIIIFRHGAREGGFLLIGTGLLVLLGGHDIVYKVMGR
FT                   EPFVWLQGIGIFIFEAMIFITLASRTMRVYARLEEYSTGIEEEVARRTRELREANRLLE
FT                   KANRAKSEFLANVSHEMRTPLHAIMGFAEALKGEQDPREREGHLQLLLSEAQRLKVLID
FT                   EILDVEKMEQGKLTLDESPFNLHEVVGYVCRVMEENARRKGLSFSFEIEDGVPVWVVGD
FT                   PFRLQQVIMNLVGNAVKFTEEGGVRVRVGCVEEGEGRWIEVEVRDTGIGIPEEMREKVF
FT                   ESFVQADTSTTRRYGGSGLGMTIARELVRLMGGDVWLESEVGKGTRVWFRIPCVEAMAG
FT                   VEAEGGALEEGTRGVLEGHRILVVEDYMPNQKIVSLVLSEAGAEVEVAVNGREALEKVA
FT                   QGRYDLVLMDVHMPVMDGLEATRRIRALVGGDLPIVGLTADAYREDVRRCREAGMDGVL
FT                   IKPIRRKEMVEEVRRLLSGRGGSEGEEDAREGIGAFVEEFGDLRERAFEILEGFLDEAE
FT                   RQWERIEGAWEGRDWEALHREVHALKGGAANLYARSLRDAALAAQEAARQHDEGRMPDL
FT                   LDAVRRELSRLQEEIRTFLAGRGGGEPGG"
FT   gene            complement(283731..284954)
FT                   /locus_tag="STHERM_c02230"
FT   CDS_pept        complement(283731..284954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02230"
FT                   /product="predicted major facilitator superfamily MFS-1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01197"
FT                   /db_xref="GOA:E0RNS4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS4"
FT                   /protein_id="ADN01197.1"
FT                   /translation="MGAPSEKFRLYLLQFFYFFAGGSALPFLTLYLKEVLLYPDGSPAY
FT                   SLIGGLFLVSGLAGLVASPAAGYIADTFHAENRLLSISGLMYALGSFLYMVLWFLPPSY
FT                   YGLAYALVIAGSVLRGIFMRPIIPLLDAQILAYFHHAEGNARNYGTIRWMGSFAWAFSL
FT                   VASGILLQLTGKLVYPIAVHVTGLLLFAFIALPPSGTPRTSEPTRWEHLLKDRLFFGYL
FT                   SVIFLVGFSVMGSYSFTTYLMEESEVSYLLMGLSFAVASLPEIPLMYLGRRLLARWGMS
FT                   SLFLMGVGLHALKLVLFLLIPQGSSALLFVLVQILHGCGYAFYYLGHISIVDGLSHHTL
FT                   RATYQNLQQFAWGLGASIGGLAGGIIIEHTSVRVFFGVDAAILVLAMGIFSSFILPALH
FT                   RRALRETS"
FT   gene            complement(284986..285573)
FT                   /locus_tag="STHERM_c02240"
FT   CDS_pept        complement(284986..285573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01198"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS5"
FT                   /protein_id="ADN01198.1"
FT                   /translation="MGEIKSALEKALERAAAIEPDKGKLEEERWITKGKQSAARFLEDR
FT                   EFDIKKELKGLSAEQRSWFVKGSVETFLANLTLPSREEELERLPLVMEGLRKVLGEAPL
FT                   FGMLEQQLSQFFSQYLATYRQVETALLQQFAPRFREKETLLSQQLGMPVKVAPETDPEY
FT                   QAAFRQHIGQVRAQYEQHLSQVKAQIRKMLLA"
FT   gene            complement(285607..286161)
FT                   /locus_tag="STHERM_c02250"
FT   CDS_pept        complement(285607..286161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02250"
FT                   /product="predicted 5-formyltetrahydrofolatecyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01199"
FT                   /db_xref="GOA:E0RNS6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS6"
FT                   /protein_id="ADN01199.1"
FT                   /translation="MSEEKARLRAVLRARVAGMGAQAREEAGRAIRERIAAWERWREAR
FT                   VVGGFLPLRDEPDVRPLLDEALREGKRVYVPRIAGGRIGWGRYGPGVGLVRQELGFLQP
FT                   EEEGESGVRPEVVLVPGLGFDRAGRRLGRGGGWYDRLLAGEARAVGVCFGCQVVEAVPE
FT                   EEHDVRVAYVVTEQGFFRCYT"
FT   gene            complement(286158..286532)
FT                   /locus_tag="STHERM_c02260"
FT   CDS_pept        complement(286158..286532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02260"
FT                   /product="putative endoribonuklease"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01200"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS7"
FT                   /protein_id="ADN01200.1"
FT                   /translation="MEYVHAEGAPEAIGPYSQAVRAGEMVFCSGQIGLDPATGSLVSGS
FT                   IEAEVRRALENLTAVLEAAGCTREDVVKTTIFLVDMADFEAVNRIYGGYFPHRPARSTV
FT                   AVKALPRGARVEVECIAVRR"
FT   gene            complement(286556..287200)
FT                   /locus_tag="STHERM_c02270"
FT   CDS_pept        complement(286556..287200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01201"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS8"
FT                   /protein_id="ADN01201.1"
FT                   /translation="MPTAEVLREFSLARAKEVKRVFERRGFEVFVASSVAESREVVERI
FT                   VPEDALVAWGGSMTLEESGIKDLLRTGPYRVLDRDRAASAEEVERIYRETFSCDYFFMS
FT                   ANALSLDGHIVNIDGRGNRLAALLFGPRYVVMVVGWNKVVATLDEALARAKHLAAPLNA
FT                   TRLEKHTPCRRSTVCEDCLGDESICSHTVITRRSVPRGRIKLILVGQRLGF"
FT   gene            complement(287286..287807)
FT                   /locus_tag="STHERM_c02280"
FT   CDS_pept        complement(287286..287807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02280"
FT                   /product="predicted anti-anti sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01202"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNS9"
FT                   /protein_id="ADN01202.1"
FT                   /translation="METLEIIHYLKEGDKLIFFLPRHLRAVGAYSLFTHAEKLIQEHNP
FT                   SALLLDLSGTEYIDSTTIGTFLKLRACMLGRQGAFLLANLHPKVARILSDMHLYDYFSR
FT                   FSDEALSRVREKVLDSVPMIDKRFLAPWYLKETHECLVKAAPALKESFLPLLRALEAKI
FT                   ALSCNQRAGV"
FT   gene            complement(287903..288448)
FT                   /locus_tag="STHERM_c02290"
FT   CDS_pept        complement(287903..288448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01203"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT0"
FT                   /protein_id="ADN01203.1"
FT                   /translation="MELVVTGVRLPGNMEALVEEARARLFHEHGILTARSAFPFYALRV
FT                   DEEPLPVSVLEGARKVGFLPFRGGLVRREGDFLVLPTLPPDPWDRLRRWLEGTAGAQGP
FT                   WPHWVPGTGFFIAVREKAPPPLEPLAGRTIKAPILFSALFDWEDGEEPWRAVRWKVLWQ
FT                   KPLFKHHVRKGVLPDEVV"
FT   gene            288523..289323
FT                   /locus_tag="STHERM_c02300"
FT   CDS_pept        288523..289323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01204"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT1"
FT                   /protein_id="ADN01204.1"
FT                   /translation="MGVPMRMKIEAVLERLVEVLSRWDAVDTVCFLDRDREDIYDPYFF
FT                   ISLDVYFSGELPSYKERMEELSFTGAFESAPGNRKDRFLVGDLPVRLEYKSIPDVEAVL
FT                   GAEPGAFELVEDRVSYMFYRLVNGTILFSRSDWLASVRERLEDLPSSFWRVLRDEARAK
FT                   MEHFLSDLCAAAALEDEYFFLVSASGFIQSVCAVLFAVNRRFEPGGREMERHVFSLPQL
FT                   PYSFKGYFQQFVRYSHDFPMEKKREIAENLARHVVKMCLADEGS"
FT   gene            289320..290249
FT                   /locus_tag="STHERM_c02310"
FT   CDS_pept        289320..290249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02310"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01205"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT2"
FT                   /protein_id="ADN01205.1"
FT                   /translation="MRSSFPSGLLGACLLALVPMGVSLGAQPPEPASVPRVSLDRVLEM
FT                   PQSQPVHVFRWEVLPDFLILVFDSYGRQDRTLKRLAFFAEKPGYRGRIPSWEEVASLHG
FT                   WNAHDYEDVVLARFFSMARERGVPLLEEEEWLREVLVSAGVLVPLRAGYAPGGGGLISV
FT                   SRESPPALLSMLLTHESLHALYYADPRLRMATYRVWEGFSEETRRVFRGFLSWMGYDVG
FT                   SYGLVVKELFAYLLQQPLPELPWYIRARILPRAGAVGMGPEQPPERVVGELLQGAAALE
FT                   ESLERGFGFGAGATSGRVAGGATEDPLQ"
FT   gene            290267..291205
FT                   /locus_tag="STHERM_c02320"
FT   CDS_pept        290267..291205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02320"
FT                   /product="putative efflux carrier"
FT                   /note="auxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01206"
FT                   /db_xref="GOA:E0RNT3"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT3"
FT                   /protein_id="ADN01206.1"
FT                   /translation="MSPEVMVGIHYPFLLSLSVIVLGYGLTRAGVLSLEMGRSASRLVI
FT                   NVTLPAVILTTLPEVELVPALLSFPLICLGVGMLNLLLAGLLFGRLERPFLGNALLVVV
FT                   GYNIGLFAYPLVEGLYGREGLAGMAMFDVGNAFLTFGLLYLVSWYFGGEGEKRISAGRI
FT                   ARTLLGSIPFMSYMVGAGMNLSGLSFPGPVEEVLGLLARANNGLVLLVLGMTLRFRFPR
FT                   EVRRLLGRTLLFRYGVGLAAGLLLWVILPLDVFLRRLVLMGVVLPAPLVVIPYAVEHGL
FT                   DVEYAGTYANVSVVVSFFLLWGIAAVTAGWG"
FT   gene            291661..292203
FT                   /locus_tag="STHERM_c02330"
FT   CDS_pept        291661..292203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02330"
FT                   /product="putative methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase, active site"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01207"
FT                   /db_xref="GOA:E0RNT4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT4"
FT                   /protein_id="ADN01207.1"
FT                   /translation="MVLEGKRTDAWRDRRVWYGTAECGLGWVLAAATERGVCRVAFGEG
FT                   EGELVGLLVREFAGALLEEGGEGFREGVLAGVLEAVEEPGGEVGMDVDLVGTPFQLAVW
FT                   DALRGIPAGQVRTYGEVARAVGRPGAARAVGAACGANRVAVLVPCHRVVGAGGSLGGYR
FT                   WGVWRKRVLLEREGWRG"
FT   gene            292362..295724
FT                   /gene="nrdJ"
FT                   /locus_tag="STHERM_c02340"
FT   CDS_pept        292362..295724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdJ"
FT                   /locus_tag="STHERM_c02340"
FT                   /product="vitamin B12-dependent ribonucleotide reductase
FT                   NrdJ"
FT                   /EC_number="1.17.4.1"
FT                   /note="ribonucleoside-diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01208"
FT                   /db_xref="GOA:E0RNT5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT5"
FT                   /protein_id="ADN01208.1"
FT                   /translation="MKIARRFTEGLSDPYDGITWETRVSEIRDVEGRVIFRQENVVVPS
FT                   FWSQIATDILAQKYFRRRGVPVEVSPDGREYDARQVFHRLAYTWMWWGKEAGYFDSEED
FT                   ARVFYDEVCYMLAHQMAAPNSPQWFNTGLHAVYGIEGPPQGHYYVDHRTGELKKSANAY
FT                   SRPQPHACFILDVEDDLVGEGGIMDALHREARIFKYGSGTGSNFSKIRAEGEPLSGGGM
FT                   SSGLMSFLKVFDRSAAAIKSGGTTRRAAKMVVLDVDHPDILTFVRWKVEEEYKVASLVA
FT                   GSRLVARHAREILSAYRSEGDVGAAAVRDAVGRALEAGVPEQFVHQVLRLAEEGMGPEE
FT                   FPVYTTDWEGEAYATVSGQSSNNSVRVPHEFMLAVQEDREWPLTARTTGEVVRTVRARD
FT                   LWNEIVLAAWRCADPGLQFDTTINEWHTCPADGRIRASNPCSEYMFLDDTACNLASLNL
FT                   LAFYDEEEGRFDVESFVHAVDIWTLILEISVVMAQFPSAEVARRSYLYRTLGLGFANLG
FT                   SLLMVMGLPYDSEEGRAVAGAIAAIMTGRAYHMSARMAAEWGPFPRFEANREHMLRVIR
FT                   NHARAARHAPPEEYEGLSVTPMGLDPDHTPGYLLETARRVWDEALEWGERHGFRNAQVS
FT                   AIAPTGTIGLLMDCDTTGIEPDYALVKFKKLAGGGYFKIINRSVPPALRRLGYSAEQVE
FT                   EIVRYCVGRGTLKGAPGVSYEALREKGIPEEELEAVEERLRGAFSLRGVLGVWAFSPGT
FT                   LDRLGVPEEARKDPSFDLLGFLGFSEEEVSAAEEWACGAMTLEGAPHLREEHLPVFDTA
FT                   TPSGRKGSRAISWRGHILMMAAVQPFVSGAISKTINMPQSATVRDVEEAYLLSWRSMLK
FT                   AVALYRDGSKLSQPLVGAGSARDRAAEVIAETERGVGTARPAGRVEDGGLPRGKRRVLP
FT                   PRRTGYTQKAKIGGHSLFIRTGEYEDGTPGEIFLDMYKEGAAFRSLLNSFAIAVSLGLQ
FT                   YGVPLEEFVDAFVFTRFEPNGMVQGHPYIKMATSVIDLIFRDLAISYLKRYDLAHVTPE
FT                   DLSSTELRREVSLEEPLHRGEEVPRSRKDVLREEARRRGYEGDPCPVCGNFTMVRNGTC
FT                   LKCETCGATTGCS"
FT   gene            295847..296038
FT                   /gene="rpmB"
FT                   /locus_tag="STHERM_c02350"
FT   CDS_pept        295847..296038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="STHERM_c02350"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01209"
FT                   /db_xref="GOA:E0RNT6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT6"
FT                   /protein_id="ADN01209.1"
FT                   /translation="MARRCEICGKQTRSGFTVSHAHNRSKRTFKPNIQKIQIVDGKRVR
FT                   TIKICTRCLKSGKVVKAV"
FT   gene            296401..296796
FT                   /locus_tag="STHERM_c02360"
FT   CDS_pept        296401..296796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02360"
FT                   /product="neelaredoxin"
FT                   /EC_number="1.15.1.1"
FT                   /note="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01210"
FT                   /db_xref="GOA:E0RNT7"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT7"
FT                   /protein_id="ADN01210.1"
FT                   /translation="MALGEWIKSDDFKTEKHVPVIELPREVKKGEAVLVTVTVGKEIPH
FT                   PNTTEHFIQWIRLYYKDVDGKFAIDLGCAEFNAHGATTAGPNTGPAYTEPVAVFKVKLD
FT                   TPGTLVAESYCNIHGLWESSVEVKPEA"
FT   gene            296918..298204
FT                   /locus_tag="STHERM_c02370"
FT   CDS_pept        296918..298204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02370"
FT                   /product="phoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01211"
FT                   /db_xref="GOA:E0RNT8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT8"
FT                   /protein_id="ADN01211.1"
FT                   /translation="MKTFVLDTNVLIHRPDAILSFKDNEVVIPIWVLEELDKLKTFSDE
FT                   RGRNARAAIRFLDERRKRGNLSEGVAIEHGIVLRVLLGFWKDEKGFLSERPDNQILLAA
FT                   YHLQKHGKEVFFVSKDINARVKATALGLKAVDYEKQKVNIESLYSGYVEQDAKEETLDE
FT                   LDREEAVPAPGAFYPNQFVVLKGAHSGREMLTRYHHETNTLRYVIPRPSSVWGVKPRNR
FT                   EQEMVFDLLLDDEVQLVTLVGKAGTGKTLLALAAGLKKVLEEKAYKRLLVTRPVVPMGK
FT                   DIGFLPGDKEEKLSHWMQPIFDNLDYLVSVYSRGHVKSVEELLAQDVIEMEALSFIRGR
FT                   SLPYQYIIIDEAQNLSPHEIKTIVSRAGHHTKMVLTGDPFQIDSPYLDANSNGLTYLVE
FT                   AFKGEEIFGHVTLHKSERSTLAELAAELL"
FT   gene            298252..300534
FT                   /locus_tag="STHERM_c02380"
FT   CDS_pept        298252..300534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02380"
FT                   /product="putative polysaccharide deacetylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01212"
FT                   /db_xref="GOA:E0RNT9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNT9"
FT                   /protein_id="ADN01212.1"
FT                   /translation="MWRRLLVSLGLLCSFPLVAEEVVFSDLVLSPLNTVLFTASLSVPG
FT                   VGAYRTAFWAEPGTGTLQQLSFFPERMRFLPALGKVQIYNRYGLFRIPLEGGRVEVVEG
FT                   FPAFVKGAEIATTSPLPIATSPDGRYLVHFEKDSPAYGSLVMVDLETGEEAVVAEGIEL
FT                   SYREIPVSWAPDSSLFLYAHDGMVYYFSISQWREGRVLSPERRVIGRGKIGSVFWGGGG
FT                   RLYFVEGTVIKVFRKEEIFTHGFYYGVVKVGRVVGKLPFHFDPNFDRLWIGPEENFVLL
FT                   CRAGRDIFLYPLDREDYEGGALQEPSLVLPRRMYLEDVVWDDEGKLTLFVKEVHDGTVE
FT                   RRLFWMVVGSQRAFEEREERPQVWALSEDGSYLALAMEDGIRLYRYDSWTEVGRIDHPE
FT                   PVVLAWAGDDLVVGGRWSVSRYGRDGRLKALLCISQPEGLGFTVGDYRPVVWAGEDTVQ
FT                   WDVDRAVFEVREDRPAAGAPVLSTSAYRVYLQDLPEQPYRNIVMVRDLQGLSTYPLFPP
FT                   PERSYEPFPEKDEPVDFIYFTHGSRLRRREVALVFNAISSAEGLARVLELLKEYGVKAT
FT                   FFLNGDFMRENPGATRQISTFAAEVGSLFYTHFDMSDSRFSLSEEFIQQGLARTEDEYF
FT                   EITGRELALLWHAPYYFVREDLLKAAAAMNYVYVGCDVDSLDWVPQFTREGESRLYAPA
FT                   AQLVERIVRMKKPGSIVAFTVGRPDEKDPVRRREDYLFQKLDVFLNELIARGYRFVTVS
FT                   ELMEHAR"
FT   gene            300605..301000
FT                   /gene="fliS"
FT                   /locus_tag="STHERM_c02390"
FT   CDS_pept        300605..301000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="STHERM_c02390"
FT                   /product="putative flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01213"
FT                   /db_xref="GOA:E0RNU0"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU0"
FT                   /protein_id="ADN01213.1"
FT                   /translation="MKPQNAINAYKQTSIKTASQGKLIVMLYDGAIRNIDTAIELLEQG
FT                   TRQLDRVHNAVIKAQDIVAELASSLDLDRGGDLAKNLLSLYLFFDEQLMEANIRKDPEL
FT                   LRKVRDMLASLREAWAQIAHMAPEAQV"
FT   gene            301009..301473
FT                   /locus_tag="STHERM_c02400"
FT   CDS_pept        301009..301473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01214"
FT                   /db_xref="GOA:E0RNU1"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU1"
FT                   /protein_id="ADN01214.1"
FT                   /translation="MADMLTMEELDARVALLRRLRDYLVKQRERLVDYLELLDREEEAI
FT                   TSEDVERLHIHVEMEHRILKDLFSLQRVIVPLKEMYRAMYPTGHREIEHLERSVGELTR
FT                   KAFAHNEENRKLLQLQMASLKERIEALRIPQFRKNLFASSHTSHSVDILT"
FT   gene            301476..304169
FT                   /locus_tag="STHERM_c02410"
FT   CDS_pept        301476..304169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02410"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01215"
FT                   /db_xref="GOA:E0RNU2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU2"
FT                   /protein_id="ADN01215.1"
FT                   /translation="MKPLFLIDAYGLIYRAYFALIRAPMRTKDGRNTSAIYGFFRMLFR
FT                   FVKEYDPVYCGVVLDSLTPTFREKTFEAYKATRQKTPEDLHPQIPVIEEILEALGFATV
FT                   RMNGFEADDVMGTLAAMAQAEGRPCFVVSGDKDLAQLVTKGVKIVRMDKDDFVVLDEEG
FT                   VKEKWGVRADQIVDFLALVGDASDNIPGVEGIGEKTAQRLLAEYGSLEGVYAHLDELSP
FT                   SLRRKLEEGRERAFLSRDLATIRTDLDLSLTIGDLRRREPEVQRARELFLAYDIRSLAQ
FT                   EVGGSPSVGEKPTLEVEGPSRAGVSYEVVTDRASLSRWVEEALERGAVAVDTETDGLDP
FT                   LTCRLVGVSFAVDEGRACYVPLAAPDVRPLPADVVREVLSPLLVSTEVVKVGQNLKFDY
FT                   HVLRRWGVRPEGPFFDTMVAAWLLESDAGRYNLDRLAEKYLGWRTIHYKDVVEKGASFE
FT                   TVPVAEAGVYAAEDADIALRLSRVLKERLEAEGLGRVFYEMEMPLLSILARMEEWGIGL
FT                   DGEALSAFGRELEERISTIEKEIFELVGHEFNVGSTKQLQEVLFVERGLPPVKKTKTGF
FT                   STDTSVLEELAARDPVAAKVLEYRSLTKLKNTYVDVLPGLVNPGTGRLHTWFSQVGTAT
FT                   GRLSSKDPNLQNIPIKTEEGRRIREAFVPQRGWWFLSADYSQIELVILAHLSEDPALCR
FT                   AFREGEDVHRATGSLLFGVPPEAVTPEQRRIAKTINFGVIYGMSAFRLSRELGIPRKEA
FT                   ERFIDAYFTTYAGVRAFIERTIAEAEEKGYVTTLFGRKRPLPYITSRNKTQKTGAERIA
FT                   VNTPIQGSGADIIKLAMIDLDAQMRRMGLASRMILQVHDELIFEVPPEELEVMKRLVRE
FT                   RMEGVVRLSVPLRVEMGVGRNWGEAH"
FT   gene            304178..304795
FT                   /locus_tag="STHERM_c02420"
FT   CDS_pept        304178..304795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02420"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01216"
FT                   /db_xref="GOA:E0RNU3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU3"
FT                   /protein_id="ADN01216.1"
FT                   /translation="MGEGVRPPVIGVTGPAGAGKSLVARMVAELLGGEVVDVDEVGHKA
FT                   LDVCRGEVVRIFGEGVVREGRVDRWALGRLVFGDGRARERLERVVHPWMREEVIRRVGG
FT                   RRGPVVVDAALLGRMGLEAVCDRVLVVRAPWWVRVWRLVRRDGRSVCEAVRILRAQRGL
FT                   FSQPFSCGVDTEYVINVGSKRHLRQKIATLLVRWGYLREGVS"
FT   gene            304799..305473
FT                   /locus_tag="STHERM_c02430"
FT   CDS_pept        304799..305473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01217"
FT                   /db_xref="GOA:E0RNU4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU4"
FT                   /protein_id="ADN01217.1"
FT                   /translation="MDRERILVVLVGVSVFLLVVVLVGMWWLSPREEKPVQVVTAGEQP
FT                   QQSGFDAVEWVREGEGFPGLLEGEEPLEDEFIVTETLFGSESATPSPAPVAVQAAPSPT
FT                   PVRPVSRGDRAPVPAPTRTPAPRVETRAVEHTPTPVVREEFWIQIASFTSQARAAHVVE
FT                   DLREKGITARIVTKTMDGVTYYRVRLGPYEKKAEAEKFLASIRNLEGYEKSYISLVYRR
FT                   DP"
FT   gene            complement(305475..306398)
FT                   /locus_tag="STHERM_c02440"
FT   CDS_pept        complement(305475..306398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02440"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01218"
FT                   /db_xref="GOA:E0RNU5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU5"
FT                   /protein_id="ADN01218.1"
FT                   /translation="MGARLEKITGMLISSYEREGGINYTDECNLPSKMGVIRILSDIEA
FT                   LLFPGFRENDGIRRDTVRLFTQEILTRLFRDLSEEVEKSIHFSERRTRGGLSREHRIKV
FT                   REEAEEITYRFLERLPEVRRLLMYDVKATLEGDPAAKSEEEVILSYPGIEAILVYRVAH
FT                   ILWTEGVPLIPRMMTEYVHGKTGIDIHPGATIGEGLCIDHGTGVVIGETTVIGNNVKIY
FT                   QGVTLGALSVKKSEANVKRHPTIEDNVTIYAGATILGGSTVIGHHSIIGGNVWLTSSVP
FT                   PYSKIYNQPSRYVIKPGKEEPHDFQI"
FT   gene            complement(306374..307327)
FT                   /locus_tag="STHERM_c02450"
FT   CDS_pept        complement(306374..307327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02450"
FT                   /product="patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01219"
FT                   /db_xref="GOA:E0RNU6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU6"
FT                   /protein_id="ADN01219.1"
FT                   /translation="MSIFYCDPGGDMAKRWALVLSGGGAKGLAHVGVLEALEELGYRPS
FT                   LVVGTSMGAIVGGLYATGIGPARMRDFLEDFDIRDYLTGFSFQLPENLPFIRILQAGEA
FT                   LGNLLKDTGMEPGTKIYELIRDLTQDLSFEELALPFRCNAVDLISGIQQVFSEGRLADA
FT                   IRASMSFPGVFKPWKIGEGLYVDGGIVDNMPVWIARMMGYSPVIAVNVAPKTPVKEVHI
FT                   QNGIDVIMRSFSLVASRIPRHYQNVPDLEIVASDGTSPFDFSRKDVLIRLGKDLTLAHR
FT                   DRIKALVRPGLSRLIHLPDRLISYIRRKRWVPDWRR"
FT   gene            complement(307335..307451)
FT                   /locus_tag="STHERM_c02470"
FT   CDS_pept        complement(307335..307451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02470"
FT                   /product="putative chemotaxisprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01221"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU7"
FT                   /protein_id="ADN01221.1"
FT                   /translation="MPPAYPILLRIVLLQYSIKPYIYCVQLVYDRSLTPALY"
FT   gene            307439..309739
FT                   /locus_tag="STHERM_c02460"
FT   CDS_pept        307439..309739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02460"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01220"
FT                   /db_xref="GOA:E0RNU8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU8"
FT                   /protein_id="ADN01220.1"
FT                   /translation="MRVAFLINRLMNDYQLALWEGVQEEAEKLGVQCIALPGELIDSPD
FT                   PEDRVVNTLYDFLRNPSWDGCIVATSTYATHGDPARILSYVRERTSVPLVSIGVEYEGL
FT                   PVVGVDNEAGMRLLVEHLVRHHGVRELAFIGGPHHNPEARTRWRVFESVLDAHGIPVRE
FT                   EWVGKGSFEKESGSAAMEAIWEASDRKPRAVVAANDLMALGAYEYLVKRGVGVPDDVLL
FT                   AGFDDIPAARSNEVPLSTVYQPVKEQGMEALRLLHEWISSGERPGSKVAVAQARFRDSC
FT                   GCFSRNVEMAGGEMAFTFEKGEEERPEEVLIRFCEERLDISFTPVEESLLSTLVGHLDA
FT                   YLDLPDRDHLEACLRTAFAVFVHERRENQDMERWLRILGAIASSYQHYRPERYSQFTIF
FT                   LQKAYVLFIEAVSHEAQSHLMSTTEKFLRSQDLLRAIRSSEDMGMLKSSLLELKERLAI
FT                   SDLHLVLFPSEKWESCYTGAVLPETSSLLVSGKTGGEGDVGFNTLELLPPRILPPERPG
FT                   AFSIFPLLIGQRYLGYMMVSAGEIFTGFYHSLASQVASTVLSIRTLVMMRKTADQLQVW
FT                   ADEIRTTVSSLFDALESVGAISGEQVQEMTRITEEISRKSGMFEQNLQLTTSIAEHTRF
FT                   MQDLLSLIDDVTQRINLLAINASIEAARAGEHGRGFKVIAEEVRKLADTTARRAKETTE
FT                   VLKQVVANIETSRTLGENLYNTYAGLKEEMDKFKTALTTIEAHLSRFSDQGRRLASLVE
FT                   QPEGAPNPLPHGS"
FT   gene            complement(309714..311837)
FT                   /locus_tag="STHERM_c02480"
FT   CDS_pept        complement(309714..311837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02480"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01222"
FT                   /db_xref="GOA:E0RNU9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNU9"
FT                   /protein_id="ADN01222.1"
FT                   /translation="MPKRKLGPGKLFIRLTLAMLLVMGIAGAVTLVLTYGNVRDYVLAV
FT                   QKENLTEIVEEGGTLLRIYISQMRLLLQLSSQNPNVLSAFRNPTPSILDEVETTISLQT
FT                   EGVCKDVIFLSPSGEALAARDRSTVSQLGLSPSSIASNYSRTRSPVLLDTYLPTQGGVL
FT                   AYLVTPVFRPGSEELEGYLAWGLDLYFLFVRFLYHSQGKTGGTILIDDEGTVLGYRDAT
FT                   QLLTSFRDTPLFQALSTERTNKGSTAGSLSLKGERGNIVVAYYWIPQEDMPWAVAFSIE
FT                   EADLLSTLRRSFTYSAGIILLGLAGAVVLILLILRALVGRRIELLQTYFTRASQGDLTV
FT                   QPRVRGDDEIAYIFHLLREFLATLRNLLLDVRRRMGALEHTGITLEEIAEETSTAVEQI
FT                   QRTMEQLTQHAHSQTTSVVETSAAMEQMAKNIETLTRAIEHHTSTIEVSSASIEELVAN
FT                   IDSLAEVANRLMKGVEDLHQASDTGKEKLSSLIDLTGLVQEASAKLQDANTVIATIASQ
FT                   TNLLAMNAAIEAAHAGERGKGFAVVADEIRKLAEEAGSHSKRIRLQIKDITGAIEQMAA
FT                   ASGEADTAFGTILGRINELTGLIQEIQAALTQQRTGSQEIVSSLVEMKDLTHQVRSGAR
FT                   EMEQGNRQILEATTNLKEITEEVKQAIREVEEGTSRIVDSILKVRAQSEENRTHIQALS
FT                   QALSQFKIHEEGD"
FT   gene            312182..313261
FT                   /locus_tag="STHERM_c02490"
FT   CDS_pept        312182..313261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01223"
FT                   /db_xref="GOA:E0RNV0"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV0"
FT                   /protein_id="ADN01223.1"
FT                   /translation="MVCKEHRREGDYALCHADGTAMWGGKGRGMCISRQDKAKEWWRRR
FT                   KGWHDSCLLISETPHGGYTMKHRDKRTLVIGSMLLVLLGLLLTVGCANPVNSDIERIAA
FT                   SVTSEDGSQSTDDVDLSADTPQTGNESSEDLTAEQSGEDPQPTVSQSSGEAAAEVSADG
FT                   QGADEGTGVVAGGDAAEAESAAGSASGSEDVVAEVSADGQGADEGTGVVAGGAAAEAES
FT                   AAGSASGSEDVVAEVSADGQGADEESGAVAGGDAAEAEEDSLLAALEEAVAASKDLTGK
FT                   VVIDGAGYLVISTDQGTYELAISDDPEELRDDLQDLWKEHKKDKELKRIAQELRKILAS
FT                   VTEASEREQGKKEKDKKRK"
FT   gene            complement(313318..315747)
FT                   /locus_tag="STHERM_c02500"
FT   CDS_pept        complement(313318..315747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02500"
FT                   /product="beta-mannosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01224"
FT                   /db_xref="GOA:E0RNV1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV1"
FT                   /protein_id="ADN01224.1"
FT                   /translation="MKYIDLSGTWNLSCITRDLPEVPMEVPGDVHSALIQAGIIPDPYQ
FT                   GTNELEVQWVGREDWRLSTTVSLSEIPRGPVFFRAESIDTICEVLINGHSAGRGENMFL
FT                   PVELRIGEYLREGENTIEVLIRSAERTAVERAGRLPYPIPHTSHPVQSPHRNLVRKAQC
FT                   HAGWDWGPCLMVAGIYGGVGLIDASEGYIRCVHTDQRWEGDDCLLDIHVEFLSSEPGAI
FT                   PLSISCAGVRHEAHVEVGEGSSTITRTLRIRSPERWWPAGYGPQRLYDLDVTVGSHQVH
FT                   KRVGFRTVRLITDEDTHGSRFVFEVNGVEVFCKGANWIPQDALPSRETPARARYLLQSM
FT                   REAHMNMVRVWGGGKYEPEYFYDLCDQLGIMVWQDFMFACAMYPSDHGFLRTVEEEARY
FT                   QVKRLKDHPSLVLWCGNNENLGAIGWFEETRANPARYLVDFDRLYEATIGRVCDTLDPG
FT                   RPYWPSSPSAGRDVYDYNWHDDSRGDMHYWDVWHGGKSFDAFYLVRPRFCSEFGFQSFP
FT                   SPETIRTFCPEDQMNPTSPVMEHHQRSPKGNRVIIESMARYFRFPESPEAFLYLSQVQQ
FT                   AYGIQHAVEYWRALRPRNMGILYWQLNDNWPVASWSSIEYTGRWKPLHYVVGRAFAPVH
FT                   TAAFMKTPGILTVVVYNDTREPLPGKLSATFYDFEGKERKGIEWEVCLEGEASSIIEQV
FT                   PLDRQGIDPHNTFVRLELELENGMRTSNTHFLSLPKQCPLARAAVHATVEGDRITLTAD
FT                   APAFFVVLDHPGGRFSDNCLHLLPGEERTIRFIPREEGITLDPSRLSVMHLRETYR"
FT   gene            315879..317078
FT                   /locus_tag="STHERM_c02510"
FT   CDS_pept        315879..317078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02510"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01225"
FT                   /db_xref="GOA:E0RNV2"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV2"
FT                   /protein_id="ADN01225.1"
FT                   /translation="MNGKRRTKIENMGLILQQIWYEEGISRIEIAKRVGLNKSTVTNLV
FT                   AELIELGLVEERAQKNVVSTGGRKPIALGLNKEYGVVIGVGVQAEAMRAVTVDLAGTVL
FT                   LKWQKDTGPITRRNFIPLFLEAMEELSRILEEKGYVHVLGVGIGAGGIINPEDGSIVYS
FT                   IPLSIYEPFQVCAELAEFLDVPVFVENDSNSCAWGELAFKKGESYKDFIFVLVEFKEER
FT                   SHIKDFGGVGVGFGIVLDGRLHYGHTFSAGEFRSVFSEGTMPSQFSLSPEELAQLPHNR
FT                   VLLNKFLHELFSNLACIVNTLNVSHVFFGGDIEGLGEEICDTFMSYVRRNWMYPLPIPC
FT                   NVSLSSLHDFAVAYGAAGMILDRIFRNRLHQSFWDKRGDKAFLPVLVRHTLPLVKRSRA
FT                   "
FT   gene            complement(317088..318284)
FT                   /locus_tag="STHERM_c02520"
FT   CDS_pept        complement(317088..318284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01226"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV3"
FT                   /protein_id="ADN01226.1"
FT                   /translation="MSHRRVILLALLFKCFTITAENIRVPEDYPTLQEALDRARDGDRI
FT                   LIAGGTHRGPFSIRTSVSIEGEKGTLPILYDDTSPVRIIPLLLVQNAGEVRLSNLIIQG
FT                   GDPSQGVGATSVGILAIQSRIRLSEVSFRNILQYGLLQIGGEFEAEAVSFLTPSLPGRL
FT                   TDTGLAFFGVSGVTTEHLVCDDPILRQGITINSGLPFGARTSLSRPFIFHPSTGAPLTL
FT                   PSPPSDPTQARLSGIRLRIPSEEETAGVVVGGPTTLTIEDSYFYMGPTRPRPLSPTAVI
FT                   ARGNPRIVIRNTTFSGVTRGILLTTGSPSLLLEDDTFTQLGTALTLRENPGSVLDLGGG
FT                   PLGSRGGNRFQGNTSDILLDPLSVPLPIPARNNLFSPSPLVHSTREDGGLPERILLTE"
FT   gene            complement(318354..318426)
FT                   /gene="trnP1"
FT                   /locus_tag="STHERM_c02530"
FT                   /note="tRNA-Pro-GGG"
FT   tRNA            complement(318354..318426)
FT                   /gene="trnP1"
FT                   /locus_tag="STHERM_c02530"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCC"
FT   gene            complement(318468..319508)
FT                   /locus_tag="STHERM_c02540"
FT   CDS_pept        complement(318468..319508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02540"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01227"
FT                   /db_xref="GOA:E0RNV4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV4"
FT                   /protein_id="ADN01227.1"
FT                   /translation="MKLNLNAWIREHTFHHSQFADLAALVQEKERQGLSISLCIPTLNE
FT                   EKTIGKEVVIFKSELMHRYPLLDEIAVIDSGSTDKTREIAASFGADVYLSSEILPHLGE
FT                   RKGKGENLWKAIYQLKGDIIVYIDADIKNIHPRFVYGLVGPLIYNPSLKYIKAFYDRPL
FT                   AFSQGIRPTGGGRVTEILVRPLFSLFFPELTAIIQPLSGEYAVRREVLEQIPFPIGYGV
FT                   ETAHLIDVYRIYGLEVFGQTDLDQRVHRNQETRALGKMAFGILQTFLRRMEAYELLTPN
FT                   TEFSTILRQFQVKEDQFELVEYRIQEEERPPMNTIDEYIEKRPTSSPRKKRRSKKAGSP
FT                   SLPEDT"
FT   gene            complement(319492..320667)
FT                   /locus_tag="STHERM_c02550"
FT   CDS_pept        complement(319492..320667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02550"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01228"
FT                   /db_xref="GOA:E0RNV5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV5"
FT                   /protein_id="ADN01228.1"
FT                   /translation="MHPGMKEILELLPLIQEKTRVANEILLSNLIMISEIPAPTFQEEK
FT                   RTEFLLWRLSEHNLINCSTDEIGNALAILPGTEGTRNILITAHVDTPFPESVDHTINVL
FT                   PGTVTGPGVGDNGLGVAALATLPVYLEHLGFQLSSNLILMGSVKSLGKGNIAGMRFFLD
FT                   HTNYPIHAGICIEGVRLGRLSYSSIGMLRGEIANRVPEEYDWSRFGAGGAIVNINEVIN
FT                   RILEIPIPRRPRTSIIFGSIEGGSSFNVIPTTATLRLEIRSESDEMVERLKEEIQNIAA
FT                   EVSSQTGTEVEFREYARRRPGGLRFSHPLAENARTILESLGTIPRISPSTSELSAFIDH
FT                   KIPAVTIGLTHGENLNEVNETIEIEPITQGIAQLIALILAIDRGYCDEAQP"
FT   gene            320700..321827
FT                   /locus_tag="STHERM_c02560"
FT   CDS_pept        320700..321827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02560"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01229"
FT                   /db_xref="GOA:E0RNV6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV6"
FT                   /protein_id="ADN01229.1"
FT                   /translation="MHDNSVEYSSPLCNGGWGDMIYGARKRSRRRSMQVDKKTFGTTRD
FT                   GREVYAYTLDTEKGFSCTVISYGATLLSFRMPDREGRVGEITCGFDSLSDYEERNPYFG
FT                   STIGRFANRIGGARFVLDGVEYRLVANEGANQLHGGPGGFHAVVWESEAFSREDAATVV
FT                   LSYRSPDGDQGFPGNLEVTASYTLTEEGHLILEYAAETDRPTPVNLTNHAYWNLSGPGS
FT                   GLVLDHLLTLRASYYLEVDEGLIPTGRMIPVEGTPFDFREEKPIGRDFDEVKGGYDHCF
FT                   VVDGEGFRQVAVVREPSTGRRMEVWSTKPGVQFYTGNHLNDIEIAGGVTVPSYGAFCLE
FT                   TQYFPDSPNKPVFPPCILRPGETYRHRTELRFSVE"
FT   gene            322058..323239
FT                   /locus_tag="STHERM_c02570"
FT   CDS_pept        322058..323239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02570"
FT                   /product="putative phosphofruktokinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01230"
FT                   /db_xref="GOA:E0RNV7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV7"
FT                   /protein_id="ADN01230.1"
FT                   /translation="MKGAALVGQSGGPTSVINASLAGIIEGVRERSGGRIYGMRFGIEG
FT                   FLEGDLLDLSSLPDQEVGLLKATPGSALGSTRRKLTDEDLPRVRELLEKYDIRYLFLIG
FT                   GNDTMETIHRVEAYCRRTGYELFGVGVPKTVDNDLVGTDHTPGYPSAARYVALSVLQGG
FT                   RLAADMQRVDKFAIYQTVGRDTGWLAAASVVAKRRPDEAPHLICVPERPLTLDRFLADV
FT                   ERAIASYGYCYIVVGEGVVWEDGTPVSASQEKDSFSNIEFGAMGGASAALTLHRILKDR
FT                   LGLRGEFQIPESLAMCASDRVSAIDREEAYACGRKAVTYASEGRSGIMVTIERSSSKPY
FT                   RFTLGSIPLGEVARKTKPMPDEFLTPEGHFVSEAFEEYIRPLVGDIERFARLF"
FT   gene            323279..324268
FT                   /locus_tag="STHERM_c02580"
FT   CDS_pept        323279..324268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02580"
FT                   /product="putative glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01231"
FT                   /db_xref="GOA:E0RNV8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV8"
FT                   /protein_id="ADN01231.1"
FT                   /translation="MRFSLVKEMAETPEVIRRFPVDEVREEFSLVGERGRLLLTGEGSS
FT                   RIFPAGNVRASLLREGSPVRVEVEGAMQAREYTLDGWGVFVASNSGKTAEGVRLLASLR
FT                   EKARDVVVGAVVGRKDSPIGRGADAVYELRCGPEEAVAATKSVVEQAFFYDVVLRGEKA
FT                   AARRDELAALIEEVFWMDLPEELVRPLVGAPVLYFAGRNNGVAEELTLKTNEITRKKSD
FT                   YLEGTYAVHGIEEVMSPEEVVVLIDPFEEEEDKFASVLEEGVGVKVLAIAHRETRFPTI
FT                   LLPQVEQGCAPYLQLVAGWNLLVEVGVRSGIHLDKPQRARKVGNEFVG"
FT   gene            324273..325082
FT                   /locus_tag="STHERM_c02590"
FT   CDS_pept        324273..325082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02590"
FT                   /product="putative deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01232"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNV9"
FT                   /protein_id="ADN01232.1"
FT                   /translation="MQVKIRDERTGKVVVHERLAEAFPRWQPQERWLFISPHDDDVLIG
FT                   GGILLQRALEEGVDVHVLVTTDGAQGYCDLSLRDSIVEVRREETALAYRAIGVHQVHLL
FT                   DFPDGSLHLFKGRRRAQDGDPGMIEGYTGLQNALTFFYRKLLPSRVFLMSLNDYHPDHK
FT                   VVHEEAIISLFHAHNPIWAELGPPTGGFPRVYELAAYGDFVALPSIRVEGTKELKERKL
FT                   RALDLFVSQKEIIASLVSILRERPAVEYVREYGFKLYDPAVYEAFFS"
FT   gene            325063..325992
FT                   /locus_tag="STHERM_c02600"
FT   CDS_pept        325063..325992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02600"
FT                   /product="putative aldose-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01233"
FT                   /db_xref="GOA:E0RNW0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW0"
FT                   /protein_id="ADN01233.1"
FT                   /translation="MKRFSLDCGVEVVRLEGERCAVEVIPGLGGIVRQMWWVFGGEPHR
FT                   LLVEDAPEELLANPWFRGRLLFPFNDRIPGGVYCFEGREYAFPCTEGDDALHGFLWQRP
FT                   MRVRRGGETREGEWLECEYVTDGSDRGYPFEVGLRVRYEVGGDGFSLRAHVWNAGGVAA
FT                   PVSIGWHPYVSPGAGMQVDDLVLRIPAEAVLEVDERLLPTGRILPVGGTPWDFRAGRRL
FT                   GSTPCDMGFFLFGKERMIAVSADRYRLIMRLGGIFSYVQVFVPPQRDGVAVEPVASLTD
FT                   GFNHPEWGAPVLKPGEHRWGEVWIRAER"
FT   gene            326192..327478
FT                   /locus_tag="STHERM_c02610"
FT   CDS_pept        326192..327478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02610"
FT                   /product="putative sugar ABC transporter sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01234"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW1"
FT                   /protein_id="ADN01234.1"
FT                   /translation="MKRVLCLMLTLFLLAGTIFAGGEKEGAVAGKVTLDVLAYGDAANV
FT                   EGQQWINIVEGFMSENPNIEIKYELLYDEAYHQKRTARIAAGDVPDLAYLGADARWGKD
FT                   WMEAGLLVDHREWLDPEYYDLSLIPSMGPNGEVWYVPLGTSNITTVLYMNRALVEQLGF
FT                   SAPKTYEDLVAMVPAARAKGLNVVEIAGADGWVWGSCLMSGIVGRVTGDPAWVQKAVKG
FT                   EKKFTDPEFVASLALLKKMVDDGVLSSKSLLVNYGTALSNFNNQKALFMIDGQWRAGGI
FT                   DPTLAENVELLPIPTLPGEKSNVAGSAAAAISVGYGLTKVGAEDPAKREAGLRFLQYFN
FT                   SPMWVEQRLRDGAIVAPILKNFPLPDDLPTIVKRKVVFAQGVKVITDVIDAHLSGAAND
FT                   ALNAGMQKIVGGQATPEEVAAQVEKLARQ"
FT   gene            327561..328475
FT                   /locus_tag="STHERM_c02620"
FT   CDS_pept        327561..328475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02620"
FT                   /product="permease protein"
FT                   /note="putative sugar transport"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01235"
FT                   /db_xref="GOA:E0RNW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW2"
FT                   /protein_id="ADN01235.1"
FT                   /translation="MTVRERRELMGYFSLVGPALLLYTLILAYPVVFSLGLSFTDYNPN
FT                   VEGTGKFVGVSHYLRMVRDPLFWHAFKNNLIVVAVSVFGQIPIGFVLAYILYRKMIRSP
FT                   RFFQSVIFLPQFLSTIVVGILWKRLFEADGPVARLIQWFTRDPSAQFDYMLRPETVMYP
FT                   IAFVLLWMYTGFYMVVFLANLQKLDAQLIEAAKIDGATEPQIFVKIIMPLLSGTILVSS
FT                   ILAIAGSLKSFDLIFAITDRGLTRQNALVLSIYMYQVGFHNYDDPLRFAYGATIANSII
FT                   FISVGLILLANFISRRFASRGVE"
FT   gene            328475..329611
FT                   /locus_tag="STHERM_c02630"
FT   CDS_pept        328475..329611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02630"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01236"
FT                   /db_xref="GOA:E0RNW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW3"
FT                   /protein_id="ADN01236.1"
FT                   /translation="MTGTNGTHIVEGKRSLPERVLIIVSRVFAYVFLGSWALVTLLPLF
FT                   WLSYSSFKSNEELNRDIFAFPYELFANSEDEYVVIRPSPTLRYPYDPKKDTRERLIIES
FT                   TSIAPQRRIHVFFLPKDELPPHIASLEPGDTLRVRDLPPKFQREIHWKTVFFNYISAIS
FT                   YGKLAGKFVNSVIYAGVSTVLIVLLSIMVGFGLSKFPFRRLSQIIGGYFGLGYLLSIPS
FT                   IIIPLFLLMRSLHLVDTRIGVILVYTAFGLPLGVMLSTQFISGLPSSLVESAAIDGASV
FT                   FRTFWSVILPMSMPVAVTIAIINGLGIWNEFVLVLVLASSEATKSLPVAVYAFTSLTST
FT                   QLGWQLAALVLVTLPVVILYLAFNKRITEGVVAGAIKG"
FT   gene            329618..331423
FT                   /locus_tag="STHERM_c02640"
FT   CDS_pept        329618..331423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02640"
FT                   /product="glycoside hydrolase, family 20"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01237"
FT                   /db_xref="GOA:E0RNW4"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW4"
FT                   /protein_id="ADN01237.1"
FT                   /translation="MEEQILRRLVHRPRRLVVRGGVLEVPAGEWAGLEGGRYGPPPAGP
FT                   VSFTRSSGLPPEGFRIAVGAGGISIEAGGDPGAFRAVQTLRLLADREKECGMVWVPFVE
FT                   LEDWPDLPRRGLMIDVSRDKVPRLSTLFWLIDVCALLGINELQLYTEHTFAYLGHERVW
FT                   KDAGAYTPEDVSRIVSYAAERGITVIPNQNSLGHMERWFAHPEYRILAEKPEGFMDPWG
FT                   VWREIPTTLCPVDERVFPFLEGLFSQLLPLFPAGLCNVGGDEPFEFGTGRSADEVKRKG
FT                   AVKVYLAYMMRLKGMVERFGKRMQMWGDFVLSHPEILGELPRDVEVADWGYEADCPFER
FT                   NAALLAEAGIPFSTCVGTSCWLSLGGRWPNARENIRRGVQAAAAHGGEGVLLTEWGDQG
FT                   HFQQWVAMLLPLVAYALASWHISILDGVEEWEDETTRVLSSHIYRDGSGALAEAHLLLS
FT                   SLPAIEKARFHNSSPFAVLLIDHVYPYYRKEYPRLAAMSFDEDGEQIERASSLIAGVGG
FT                   GGILREELAFTARMLEFAVEFARHFLATPDFSVVEIPREVRRSLAEHLDTLLFEYEVRW
FT                   KLRNREGGFADSVGRLRALKVLLER"
FT   gene            331448..333310
FT                   /locus_tag="STHERM_c02650"
FT   CDS_pept        331448..333310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02650"
FT                   /product="putative protein involved in chemotaxis signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01238"
FT                   /db_xref="GOA:E0RNW5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW5"
FT                   /protein_id="ADN01238.1"
FT                   /translation="MSIRQRLGLVLGLIVVSFVVVLVVGRFKDRVVEEVREVQVQALRV
FT                   LSLAHEVMVENVDLIAYEIDLRPNNYLHLVVKEWEEKVGAFERAFTDLMDMRGIVWLPA
FT                   ELRDNLMKASRFWEEARKGLPEISEGIARIVRSELLPLEQTRGLMEVHRYLMALPEPPS
FT                   DLVWSVQNTWTKLKGLNATFQDFVGRQLAPLSEEITHYVGTLSRTASLVQIGVSVAVLL
FT                   SSGVFVFLVIHALGQGISSISQGVVHVVEEKDLTASLEGARSDELGRIREGFNTVVREF
FT                   RGFLTAVSNLVEKVAELHRALSTSSEEVVASVEEINRNLASLQEVARGVDRSSQQTLDA
FT                   IDRIHKEMATITEETATYAARVDESTAALEKVHALVRRVSELSSDYREQVLHLVRQLEV
FT                   SGEKVRESASVVGDIHSEVHKIQEIIEIINTIASQTNLLSINAAIESAHAGEYGKGFSV
FT                   VAEEIRKLAESSSQYASRIEGSLRKIVEEVSLALKQSEGSEQAYHEVSDLMRRVEDALG
FT                   EIMEAIHQLADSTGTVHEVLRLFSEGARRITEGVRTITKETEGIHVAAQDARSRAETLS
FT                   RGMDEIALGGREILQAVTHTRELAQQTATVVASLRDHLSLFRIE"
FT   gene            333364..335037
FT                   /locus_tag="STHERM_c02660"
FT   CDS_pept        333364..335037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02660"
FT                   /product="glycoside hydrolase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01239"
FT                   /db_xref="GOA:E0RNW6"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW6"
FT                   /protein_id="ADN01239.1"
FT                   /translation="MKKQVFISHAGYPREGMKYVVVESEVPVEGVFRVVDTRGEVVYEG
FT                   RFDPPVKVPGWRRGWFARGEFSEVREPGEYAVCLEDGVRSEYFPIVEGFPSLFLEDIVF
FT                   YFRGQRCSGVYDRKDRGVPLFGSDRKVDVHGGWYDAAGDFSKYLSHLAYTNFMCPQHTG
FT                   LVVWAFLHGHDLLKSRGFPEFSLARIREEALYGADFLVRMQDPEGFFYLTVFDRWSHDP
FT                   EEREVCSYETQQGMKTADYKAGLRMGAGAAIAALARASLLGEASDYTPEVYLATAERGF
FT                   AHLRAHNAEYLPDGTENIIDEYCGLLAAVELYRATGKVAYRKAAEEFFSRLEGRLTPEG
FT                   VLMADERGQRSFFHAVEAGFPYVSVLRMREVLDEGGLGARAEEFVARGLSAEVERTHEV
FT                   PNPFGYPRQYVKLPGREGRVQFFIPHENESGYWWQGENARLASLAAAAFWAAGEGIGDG
FT                   ELWAYGEAPIYWILGLNPFDVCMMQGKGRHSPAYERGFPNAPGGICNGITSGVEDEEDI
FT                   AFLPEPYASDMAHRWRWAEQWIPHAAWFFLALSIYAHYRG"
FT   gene            335049..336404
FT                   /locus_tag="STHERM_c02670"
FT   CDS_pept        335049..336404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02670"
FT                   /product="diphosphate--fructose-6-phosphate
FT                   1-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01240"
FT                   /db_xref="GOA:E0RNW7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW7"
FT                   /protein_id="ADN01240.1"
FT                   /translation="MQEGGLPAIVTGMEKMSFEIATLGTPKIPSPIGLSTVVGDSIANY
FT                   VSDEEGVLHRIEVRKGEQVAADETVVLEKAGPRERLYFDPKHVHAGIVTCGGLCPGLND
FT                   VIRSIVRCLWLRYGVRRISGIQFGYRGLLPEYQYPVIPLDPEVVDDIHKLGGTILGSSR
FT                   GGGERTEELVDALEQLNINVLFTIGGDGTQRGALRMAKEIERRGLKIAVVGVPKTIDND
FT                   IMYIDKSFGFETAVALAAQAVSAAHTEAHSAINGIGLVKVMGRESGFIAAHTALAVHEA
FT                   NFVLIPEVPFDLEGENGLLAHLERRLARRNHAVIIVAEGAGQDLMGPSEERDESGNVKL
FT                   RDVGAFLKDRIKEHFSRRGIPINLRYIDPSYMIRSAPACASDSVYCSRLGTNAVHAAMA
FT                   GKTRLVIGLVNNHFVHLPMEVVVSQRKRIDPEGSLWRDVLEATQQPLRMKND"
FT   gene            336414..336818
FT                   /locus_tag="STHERM_c02680"
FT   CDS_pept        336414..336818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02680"
FT                   /product="predicted hydrolase"
FT                   /note="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01241"
FT                   /db_xref="GOA:E0RNW8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW8"
FT                   /protein_id="ADN01241.1"
FT                   /translation="MGWRRIVVVGDLHGLYREAVGLLSHAGVVDGEGRWCAEGVCLVFL
FT                   GDVCDRGYDSASLYRAIQRWQGEAPECDSRVVFLVGNHEALNLAGISPYMTVEEMEGYV
FT                   NGDEDPRVAVRRAFGKGGGCGSGWSGSTRW"
FT   gene            336902..338068
FT                   /locus_tag="STHERM_c02690"
FT   CDS_pept        336902..338068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01242"
FT                   /db_xref="GOA:E0RNW9"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNW9"
FT                   /protein_id="ADN01242.1"
FT                   /translation="MGQVREVGEVRGWGSSGRGRGCSTRRGACCGAGMRRWGRRLRSRT
FT                   GSPRSWRGTKVCVTSAATPLSRRGVSSWGTKGGTSVWTPGWSTPGSMAWEASPTSSSKK
FT                   GRDGGSISRMKGRSGSSSSTIRRYEVAIRNPMRYDDRSGTERSRNMKRITAGCLLVVCV
FT                   ALPFFGQEAVSVVDEPGVATVLLREYVAHKQLEAASQVDEFASFMTGLVLIGAGSSLFI
FT                   WLDDVTSLMASGNPSWSYGTTYTAAWVLTGGGIVLTTVGLHGLAVPRPAVEAAYAEVLK
FT                   VSDPATREVLASGVLRDVAEAARQRRTRQGTWTILTPVVALGTLIGVNLVQGKDWGEGV
FT                   DGYWLTGSLGAVVSGIRMLSTPSYEERLYERYLLTSTYDIQSGAVPGP"
FT   gene            complement(338126..338779)
FT                   /locus_tag="STHERM_c02700"
FT   CDS_pept        complement(338126..338779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02700"
FT                   /product="putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01243"
FT                   /db_xref="GOA:E0RNX0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX0"
FT                   /protein_id="ADN01243.1"
FT                   /translation="MYQQETGRFPLIGEAFPEMEVQTTHGPKRLPSDYKGKWVVLFSHP
FT                   ADFTPVCTTEFVAFAKRYDQFKELNAELVGLSIDQVFSHIKWVEWIEEKLGVQIPFPII
FT                   ADDQGRVAQRLGMLHLEAGSNTVRAVFLIDPEGTVRLVLYYPPEVGRNIDEVVRVIRAF
FT                   QLSDKLKVAIPANWPNNELIGDKVIVPPPTSQKEAKERLKKYEGYDWWFCYRDA"
FT   gene            complement(338893..339297)
FT                   /locus_tag="STHERM_c02710"
FT   CDS_pept        complement(338893..339297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02710"
FT                   /product="putative sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01244"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX1"
FT                   /protein_id="ADN01244.1"
FT                   /translation="MDLSSYLRDVVETIVQIGHTAPHLIRRDLHLTSLQLPPEKAVPLA
FT                   LILSECLLNSLTHAFGRTEKGHIRVELLEESDRGHLTYEDSGPGVPEGTPRRFGFTIME
FT                   SLARSQLKGTIEFSSSPELGGWKVSIEFPL"
FT   gene            339601..341730
FT                   /locus_tag="STHERM_c02720"
FT   CDS_pept        339601..341730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02720"
FT                   /product="putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01245"
FT                   /db_xref="GOA:E0RNX2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX2"
FT                   /protein_id="ADN01245.1"
FT                   /translation="MSRFTVGLFLDWLSSPYHVNVVKGAAAGCRARGWDLMCVVSGRIG
FT                   CRNPLEWSRNIFLQFLDSPRFDAFLFLTPSLISWEGDARLQELVSGLSRPAVSLGAPLG
FT                   TMPYVAFDNREGFSALLRHLFRDHGYRRVAFLRGPLENPEMEIRYRLFMEEAKEVGIAQ
FT                   SDVWVFPTSLVMEDGVGVARSLLEERERRSRFPVEVIVGSNDLVALGALSALWEAGVRV
FT                   PEELAVTGYDDLAPSRFVGLTSVRQPPELLGKEGCELLHLLCEGGEARPRIIPTGMVMR
FT                   DSCGCRWREDVAEQGYRSSYLEEVVEMGVVSYAYEKAKSLEEEIISSTSIPQIHEKLRT
FT                   HLPELGIDCCAVATYDAPSDPLKGASLRFFSVDERRREYGEGEKGLDSRLLLPDEEWET
FT                   LPHPFVGVLHALFKGEEHIGYILFDFSWENVHVYEGIRHGVSVGYAVARLVRELSEKTR
FT                   ILEVKSEALARSNETLNREIDKRRQVEEELRKREHYFREMALFLPVLIWELDEEGMVSF
FT                   ANHTARRLIQKKGLESPFPFLMLVEDLDQEHVEEFLERIKAGREVSSTQFRIATPEGVV
FT                   HHVLAQGGPIVHEGRCGGVRVVGLEVEPFLSSIIMPEEIFFSHYHFTPREKEVLLLYIQ
FT                   GYSRKEIAKRLGISENTVKVHLSSIYNEVGVSNRDDFFKVLKEYQVAQVGYHSFLFSVL
FT                   SSLIKGDDGVRELST"
FT   gene            341738..343471
FT                   /gene="proS2"
FT                   /locus_tag="STHERM_c02730"
FT   CDS_pept        341738..343471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS2"
FT                   /locus_tag="STHERM_c02730"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="proline--tRNA ligase; ProRS"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01246"
FT                   /db_xref="GOA:E0RNX3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX3"
FT                   /protein_id="ADN01246.1"
FT                   /translation="MTSRVYIPHNTRMRYSQLFPHTLRTLPREHEGTPYGLLVKGGYVR
FT                   GLGQGLYSFLPLGLRVFYKLKRLIAGEMKRLGGQEVLAPLVNPMELWERSGRDLLVGGD
FT                   LVKFSDRAGRQMVISPTHEEAMVELLRQSMRSYRMLPVFLYQFQTKYRDEERVRIGLLR
FT                   SREFIMKDGYSFHRTYADLNNFFPKVFHAYERVFRTCNVPYIVAEAGVGYMGGERSYEF
FT                   LVPSERGDNVVIRCPSCGYTANQDIAIGIKPLRTQIPLPMEEVETPGCVSMDDLVTHLS
FT                   VPKSGLAKTMAYHTGKGLVLAVVRGDYEVSTEKLSQVLGTPVFGLASSTELRERGLVPG
FT                   YLSPLDRRDGIVVVVDTAVADSSNLVIGSGREDHHYVNANFGRDFEGDLVADIAKVWAG
FT                   HRCYYCGTPMQEERAVEIGHIFKLGDFYSQRMGLSFVDERGREIHPYMGSYGIGMGRLI
FT                   SMIVETNSDEHGIVWPPQVAPFMVFLMSIGNSLSMKRKVEALAEALGDRALLDDRHLSP
FT                   GRKFLDADLLGIPYRILLTQELLEEGKVEVKERSTGKVWKLAYQRVEDFVHYLEEQYGP
FT                   V"
FT   gene            343458..344354
FT                   /locus_tag="STHERM_c02740"
FT   CDS_pept        343458..344354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01247"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX4"
FT                   /protein_id="ADN01247.1"
FT                   /translation="MARFDLTPEIIDLIVYGMENQERALCFDTETCTLCPVEGREEGED
FT                   RYVDLPPWGPVQGYRLMESFVASLRNRVVKERLRRILSSREKVFRRFKDALKEFPLVER
FT                   RWFAFKDRWMRREVVQWYNALRQSWGLSSLPLEMEDDLEIEGLLEGEFSFFDLKGESLS
FT                   HAVTPLVDGAWTELFPGGRGVIGLRMKEVMSALEGEDRYLVCLTPSDEIAGLCWYKVAG
FT                   DSLHHLLLLHVFPEFQGLGLEKALWRRWWEGVERRGGTALVELPGKAKELEDEVKMAGF
FT                   QAASTTYLFIPEEDRSP"
FT   gene            complement(344326..345222)
FT                   /locus_tag="STHERM_c02750"
FT   CDS_pept        complement(344326..345222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02750"
FT                   /product="putative glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01248"
FT                   /db_xref="GOA:E0RNX5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX5"
FT                   /protein_id="ADN01248.1"
FT                   /translation="MKGPISKVYAHLIEEMLDKTRHPQRITPETVWQPANLEIRPYIHR
FT                   IIEELLLPGSRIEGLEHLYTLHKEARKGKSCLLLVEHYSNFDLPVLVYLLERQGGERGR
FT                   QVADAIVAIAGLKLNEANPLVKAFTEAYSRIVIYPSRSLSRLDPLKMPQELLKSRAINR
FT                   AAMHELIRRKHSGYITLVFPAGTRYRPGKPETKRGVKEIDSYLRSFDLVSFVGIAGNIL
FT                   RINPDDERMEDDLVVEDKVVILVSPPEDAQQFRSSVRETAPHLADKKQWVADKIMERLE
FT                   ELHTEAEALRASDPPRG"
FT   gene            345389..346969
FT                   /locus_tag="STHERM_c02760"
FT   CDS_pept        345389..346969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02760"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01249"
FT                   /db_xref="GOA:E0RNX6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX6"
FT                   /protein_id="ADN01249.1"
FT                   /translation="MRRTLLIGVGLVLLITVAVFTGCAKKEAKAVEFILNNGAEPESLD
FT                   PHLISGVPEHRIYMALFEGLVAYDPETARAVPGLAESWEFSPDRTSITFKLRKTTWSDG
FT                   TPITAQTVKDSWIRMLDPETAAPYAWFPAMFLKGAAEYNSGEAGPEALGVEVIDDYTLK
FT                   VDLVGPLPYALDAFAHYSFAVVPLHAIEKYGNEWTRPENFVGNGPFVLEAWNPQEKITC
FT                   VPNEKYWDRDAVKLDRVAFLPIDDNNTSYNMYLNGELDWQTTVPTDRIKEAQLRADYHV
FT                   NPILATYYYIFNNKRKPLDDPRVRKALSMAVNRKELVERVTQAGQIPAYGIVPPMEGYA
FT                   GVKGLGEDLERAKALLAEAGYPNGEGFPELTILYNTSEGHKKIAEFIQQQWKVNLGIEV
FT                   KLMNQEWKTYLATRRAGDFEIARAGWVGDYQDPNTFLDMFVTGGDMNDAFYSNPEYDAL
FT                   IHKAATMEPGPERFDVLMQAEELLITQDHAIMPLYFYVTINLIDTDKWGGWYPNVMDIH
FT                   PVKNIYLKQ"
FT   gene            347091..348026
FT                   /gene="oppB"
FT                   /locus_tag="STHERM_c02770"
FT   CDS_pept        347091..348026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="STHERM_c02770"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01250"
FT                   /db_xref="GOA:E0RNX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX7"
FT                   /protein_id="ADN01250.1"
FT                   /translation="MGKYIVRRFLGLIPTLFIIVTLSFFIIRFAPGGPFDAEKALPKQI
FT                   LENIEKKYHMDETILMQYLRYMGDLVLRGDLGPSFKYQDHDVNYYIFTSLPNSLILGAV
FT                   SLLIAVVLGMGTGAVSALYRNTWVDYTSMSIAIIGISVPLFVTGPVLMYFLAIKWKVLP
FT                   TSGWITGREGLKTLIMPALTLAFPYYANIARLFRASVLEVLQSDYIRTARAKGLSTPVI
FT                   LFRHVFKGASIPVVSYLGPAFAGIVTGSVVVETIFRIPGLGRYFVQSAFNRDYTLILGT
FT                   VIVYSVILVLMNFVVDIIYGLLDPRISYRE"
FT   gene            348031..349134
FT                   /locus_tag="STHERM_c02780"
FT   CDS_pept        348031..349134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02780"
FT                   /product="oligopeptide ABC transporter, permease protein,
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01251"
FT                   /db_xref="GOA:E0RNX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX8"
FT                   /protein_id="ADN01251.1"
FT                   /translation="MAQERVSTSDTAAQAEEHGLSNIPSKGTSLTKDAWRRLKKHRMAM
FT                   VGLGIVTFYVLISLLAPILPIHRYDFQVPVHQNLPPSLRPAGEVWYDTEYEYLLKKAAA
FT                   EGRSELTEEEKAHLEEIRYRIEHDRIVVDGKEINPHTRVYVLGTDYLGRDMLARIIYGG
FT                   QISIAIGVIGTLTSVLIGILVGAIAGYLGGRVDYILMRIVDVMYGLPYMLIVIILMAIF
FT                   GNNMFNLFFALALVSWLTVARVVRGQIISLKNAEFVEAARAMGAPTSRIIFRHLVPNTL
FT                   GVIIVFSSLRIPSFIMMEAFLSFLGLGISAPYASWGSLIRDGVEGMTLYPWRLFFPALA
FT                   MTLFLFAMNFLGDGLRDAFDPKSKNAL"
FT   gene            349146..350132
FT                   /locus_tag="STHERM_c02790"
FT   CDS_pept        349146..350132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02790"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01252"
FT                   /db_xref="GOA:E0RNX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNX9"
FT                   /protein_id="ADN01252.1"
FT                   /translation="MSDTVLQVEDLRTYFRTDDGVVKAVDGVSFSVRAGEIVGIVGESG
FT                   CGKSVTSLSVMRLVPSPPGKIVGGRILFQGKDLLELPEKEMRGIRGKDISMIFQDPMTS
FT                   LNPFLRISTQMIETIRLHQGLEAKAAREKAVEMLSLVGIPSPHKRIDAYPHQFSGGMRQ
FT                   RVMIAMALSCNPKILIADEPTTALDVTIQAQILDLMKDLAHRFGTSVILITHDLGVVAG
FT                   MCNRVHVMYAGRIVEEAPVDRLFASAAHPYTSALINSVPRLDKPRGRRLFSIPGQPPNL
FT                   IDLPECCPFYPRCPKAMDVCKRAYPPETVLEDGHTVKCWLYAEEGSR"
FT   gene            350132..351193
FT                   /locus_tag="STHERM_c02800"
FT   CDS_pept        350132..351193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02800"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01253"
FT                   /db_xref="GOA:E0RNY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNY0"
FT                   /protein_id="ADN01253.1"
FT                   /translation="MDRSESLLTVENLKVHFPLQEGIIVKKTVGYIRAVDGVSFSLGSG
FT                   ETLGLVGESGCGKSTTIRAINQLYRPTAGKVIFEGKDLTSLSLKDLLAVRKDIQMIFQD
FT                   PYASLNPRMVVRDIIAEPLEIYVQRGLLSMSKKEIDERVEGLMDRVGLSPLYKNRYPHE
FT                   FSGGQRQRIGIARALALNPRLILADEPVSALDVSIQSQILNLLKDLQEEYGLSYLFIAH
FT                   DLAVIEYVSHRVAVMYLGKIMEVARSEELYRNPLHPYTQALLSAIPIPDPQVEAKRKRI
FT                   ILSGDVPSPDVERKGCYFYDRCPRRMDVCRERIPRLVDREEGHQVACFLYGDEAEEEPA
FT                   PGRPQSLARSSAH"
FT   gene            complement(351121..351633)
FT                   /locus_tag="STHERM_c02810"
FT   CDS_pept        complement(351121..351633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01254"
FT                   /db_xref="GOA:E0RNY1"
FT                   /db_xref="UniProtKB/TrEMBL:E0RNY1"
FT                   /protein_id="ADN01254.1"
FT                   /translation="MDVSLVYRRPDASTRTLSVPLWLRMSAGAALAVLGAMLLLFPPPT
FT                   WISGPLGLLLLFTLGYRETWRFNGHTGTVHHLHGWGPLLWRRLAFRFSEIESIEVELSP
FT                   YPSSLSDRHRIPPRRYGRLVLTRSGGERHILDVRSSRDHGLLFQWAEDLARLCGLPGAG
FT                   SSSASSP"
FT   gene            complement(351611..352285)
FT                   /locus_tag="STHERM_c02820"
FT   CDS_pept        complement(351611..352285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02820"
FT                   /product="predictive hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01255"
FT                   /db_xref="GOA:E0RP61"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP61"
FT                   /protein_id="ADN01255.1"
FT                   /translation="MKGMIRHILLDLDDTLYEGSEHLSSVVDARMTEFVARLLEVPEDQ
FT                   ALRMRRYYASRYGSTLTWLSEGCGLPAPLLDAFLEYVHPEDIRPFILRPEVDETWLAGL
FT                   EAPFSIFTNAPLEHALRVLSAIDVSPGLFTRIFDVRACGYRGKPHASAYQHVLSSLGIP
FT                   ASASLLVDDREENVRALAGLGGYGVLLLRDGQEGPYPFPTIRSLRELPRILEELDGRLA
FT                   RL"
FT   gene            complement(352378..353802)
FT                   /locus_tag="STHERM_c02830"
FT   CDS_pept        complement(352378..353802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02830"
FT                   /product="glutamine synthetase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01256"
FT                   /db_xref="GOA:E0RP62"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP62"
FT                   /protein_id="ADN01256.1"
FT                   /translation="MIPAKTPKELMAFVEREKVEIVDFRFMDFPGLWQHFSIPARELSE
FT                   KTFEEGLGFDGSSIRGWQAINESDMLVIPVLESAFLDPFTQHKTLVLICNIHDPVTHEA
FT                   YTKDPRNIARKAEAYLKSSGIGTTAYFGPEAEFFVFDDIRFDQTVNAGYYYIDSMEGRW
FT                   NSGREENPNLGYKPRYKEGYFPVPPTDSLQDLRSEMTLILESIGVPIEAQHHEVATGGQ
FT                   CEIDMRFDSLVTMADKLLKYKYAIKNTARKYNKTVTFMPKPLFGDNGSGMHVHVSIWKD
FT                   DKNLFAGNGYAGLSETALYAIGGILKHAPAILAFTNPTTNSYKRLVPGFEAPVNLAYSS
FT                   RNRSAAVRIPMYSDSPKAKRIEFRCPDPSCNPYLAFSAILMAAIDGIQNKIDPGQPLDK
FT                   NIYDLPPEEAAQVPQTPGSLREALKALEEDHDFLLKGDVFTEDVIETWISYKMQNEVLA
FT                   VETRPHPWEFALYYDI"
FT   gene            complement(353985..354977)
FT                   /locus_tag="STHERM_c02850"
FT   CDS_pept        complement(353985..354977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02850"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01258"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP63"
FT                   /protein_id="ADN01258.1"
FT                   /translation="MRPPYRRALHRVKYSLYGKAGFSYCIDMAEYTGSLTSDIQTEVPS
FT                   YPEWGPLDLSMRPLLHPRLVMIPEGISEFTFADLYLFRHTYSYRITMLPGGTFAISGHK
FT                   EGKRFFMLPCGLPEWDVLEDLFRTHDFLKNLSESHCREFRTRLEEKGYVVEEDRDNFDY
FT                   LYRREDLADLSGRKYHKKRNMIKAFINNYTYEEVPITKARIEDALAVLEAWKEEKGEEG
FT                   DYEAAREALILCRTLRLRGYLYYVDGRPAAYTLGEPVARGRMFAVHFEKALSGYKGIYQ
FT                   FINHAFAATLPKHYRYINREQDLGLPGLRQAKMSYHPCGFVRKYKVTKK"
FT   gene            354976..356262
FT                   /locus_tag="STHERM_c02840"
FT   CDS_pept        354976..356262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02840"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="tripeptide aminopeptidase; aminotripeptidase;
FT                   tripeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01257"
FT                   /db_xref="GOA:E0RP64"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP64"
FT                   /protein_id="ADN01257.1"
FT                   /translation="MNGNRFHKDIEDIEIDSQRLLERFLTYVRVGTSSDRKSASSPSTP
FT                   SQWDLLRLLERECEGLGLEISLSDRGCLYAELPPTPGCEDSTPLCFFTHVDTSEDAPGE
FT                   GVTPVVHRGYRGGDLRLPHGRITLEEAPELARYAGAPIVTSDGTTLLGADDKAGIAEVM
FT                   SAVETLVRHPEVAHGPVMLVFTTDEEVGRGTEGLDFDRIVGRVCYTVDGGEEGSLETEC
FT                   FHAWKVVAECTGRPVHPGTARGKLVNAVSMASLLVSLLPRNESPEATDGEYGFYYPLGI
FT                   EGEVHRARVEILLRDFESGEMDRRKEALRALARAVEAAFPGGGVSLSFEEQYRNMGEVE
FT                   GGDPRIVDYARRAVEDVCGEVKVRRIRGGTDGARIAERLGQPVPNLFTGAMLMHSTHEW
FT                   VALPVMERAAAVVLRLISLWTDSENSGTL"
FT   gene            356275..357606
FT                   /locus_tag="STHERM_c02860"
FT   CDS_pept        356275..357606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01259"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP65"
FT                   /protein_id="ADN01259.1"
FT                   /translation="MKGRARGYSAFLVAGLLLLVGAGGGCSYGFLQESKVEISGVSDGE
FT                   VVSHQGVSVLVLVESAEEETSPPERELSIELLRIDGEILLSSTQVLPENDEHQWALDVA
FT                   FPDDMEEGWYRLRFVYLENGVRGEEVERWIFYASSPEEYGILRIEAHPPIARPKAEVLV
FT                   EGRVRLPEDADAWIRWKAGEKVVQEGWYSEGAQVLRWQVPEEEGAYTLTMELFPLWSEE
FT                   AYPEFSSSLSSRGSIVVGEVGEALPGELGPNADYLFLYHFRGDFVNDGSAGDEPDGTAL
FT                   QVEGKPLLSYEDGTLGYLIGGDSRLVFPISSSLQSSAWKFEMRGLVKAAPEGEERAPFV
FT                   LVEGSGARLEVWGGGGTLVLRQRDPSGTNDLATLTMAGSSLVLDFAYSTGDYVVSLEGT
FT                   EEVKARVPGFRPRRVVLQDGGTRFLVDELGLRMENSSHSSTETP"
FT   gene            357655..359004
FT                   /locus_tag="STHERM_c02870"
FT   CDS_pept        357655..359004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01260"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP66"
FT                   /protein_id="ADN01260.1"
FT                   /translation="MIDRRPKFSLCVVLLLAGIISLSAQELSTRQEVAVFKVYNAAGNV
FT                   PEEVIASLSEMVRATVVKMGRFDVIGYSQSISSGDLDSFIARLKEYKEAAAEIPEEVLM
FT                   GHEAFTEADFRRLLGSFMVIVPQLSLFELERTRAGYKSYLRLDVTVYNVADDSVESQFS
FT                   IEADGASKTRTEALTEALDMVPTFLEYELRKAFVVRTTVLEVEGGEIYLEFGRNMGLQV
FT                   GDEFVLLLADISPLGRERVRESGLLLVKEVQEDYSVAIPLYAARRPTVGDQLQEVPRVG
FT                   VEVLPYLNYVVSPQSAERDENVASFGVRATVSRGFFDFRPTVGFEFPFRMWALVAMIFD
FT                   YIPIQTYVGAEITNWYLGRLQIAPTLVVGAGGLFPLEEEERDEGFLVMTHFGGKAFLSL
FT                   SYLVSRDVKLTVEPGFSLWFGLADEALGDLIDVARTYYGPSFSLAVTFKQ"
FT   gene            359030..360331
FT                   /locus_tag="STHERM_c02880"
FT   CDS_pept        359030..360331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01261"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP67"
FT                   /protein_id="ADN01261.1"
FT                   /translation="MRKVSTIGGVAFLLVFGIVLTAGCASQRASGGAPAQVPRDVVEAH
FT                   GEGATLGEALSAAKVDAIRRGVIVLLGPEVEQAHRARLEEVLYRTSNPNAFLHMETLEN
FT                   LRKENVGSIDEPRYVYDLRVRVKLDAIQKVLDANGIPGGSGAPAAEAPRPSTGEVQGTA
FT                   SGGAGLTPEEQRFLEQYLERLTYMVYFSEDSKEDPFLMKSAVSMANSYLASQGFSLIDI
FT                   DQIERLKEEQRMVYEEETGEAVSIIQWIAQRLNADVYLEIDAVTEGETKGENHYGSAKV
FT                   TVKIFDPSTGALLGSVPYSSPRTFSRVSQFDAVSNALQSTIYKAMPVAVGQAKQLLARA
FT                   YSRGIRYDLVLEGTPDARVVAAFRSALRKEERVKDIQTVYQTREETKFAVYFLGRTEEL
FT                   EELVYEVADTVAGLEYLEPVLIRGKSLTFNTGLE"
FT   gene            360368..361045
FT                   /locus_tag="STHERM_c02890"
FT   CDS_pept        360368..361045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01262"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP68"
FT                   /protein_id="ADN01262.1"
FT                   /translation="MRRGVMVMLAVLALVVLAVAGCKGAPEEKPQEPKPQVEVKPVAKK
FT                   PDIIDHKNYKWGKDVPDWVLMDVAELEQLPEYKDLYLFKFESPRAKDLEGARLYVENMQ
FT                   AATEIARQVSLRVQQKFAGAAAGDLDRLETYMETVVKTLAQATIVGFKKLDDYWVLMRY
FT                   YREDGSVEEDAYTYVALYGVERRTLDELVRRALENADEQVKPRSEEEKTARDRVKEAFE
FT                   EGF"
FT   gene            361144..362604
FT                   /locus_tag="STHERM_c02900"
FT   CDS_pept        361144..362604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01263"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP69"
FT                   /protein_id="ADN01263.1"
FT                   /translation="MRHVSGWFYAALAVLFFSACTSPGSARKEAPPDWVLSPPQGDDRY
FT                   EYFVGYAVDPSSRVKAEDAATQALISEIMRFMGVRITAETTGEAQASLEEFSVALGRTV
FT                   KEEGSARVSGFKVVDRYWYEDENGITVYILARYERDALLEEKARLEALFKEAEEAISGP
FT                   ERRGERLLMEGRYAEAAVAFLDAARAAASSSLENREVRFQRNLDKAVRALQPLEIEVLR
FT                   DNLTTYVGEAFPAEFQGRVVREGEGVVGATLLVSYRETTSAGRMRVRTVPVVTGDGGGF
FT                   SFSLPVMQVPGSGEITVRLDLSSALELLEDLPGTFREAADAVKKVVLSKQAVFHYRVES
FT                   RSKTVPTGVLILDLDSSGGLLKERGTERGLMRLLSQEGFSLKGIPEGVETLSKQGDEAF
FT                   VSWARARRDIARVIVGNARIDEFSEDGDGVMVRVSGYVKVVDLVTGRVIATAEAFKRAR
FT                   GRSVEAALAAAFASLGEVLGEKVLASLP"
FT   gene            362668..364017
FT                   /gene="trmE"
FT                   /locus_tag="STHERM_c02910"
FT   CDS_pept        362668..364017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="STHERM_c02910"
FT                   /product="tRNA modification GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01264"
FT                   /db_xref="GOA:E0RP70"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP70"
FT                   /protein_id="ADN01264.1"
FT                   /translation="MYRLDDRIVALATPWGRSAIAVIRTSGVGCLEALDPLFRGRKRPS
FT                   SMRGYSLAHGALVDPGTGEMLDEVLLAVFRAPHSYTGEDAAEISCHGSPAGVERIMRTL
FT                   LAHGFRAAEPGEFTLRAFLNGKVDLTEAEAVHEVVSARTANAHTLALHRLEGRLHARID
FT                   AIKEKIASVVAEVEVQLDYPEEDVEHPVSAHLIQEALHEVDGLLATYRVGRLYREGVRV
FT                   VLAGRTNAGKSSLFNLFMREDRAIVSEVHGTTRDYLEGWISLKGVPVLLYDTAGIRDGG
FT                   DPVETEGIRRTREILSHADAVIYLVDGTEGFSEGEEALIAELGAERPLIPVWNKVDASA
FT                   VLPPPEGFIPLSCRTGEGFARLEETLHRVFPEAEGGGAEVVIDSERQRDALVRCRDSLE
FT                   GGLDALSRGAPLDALAVYLHDAMEALGEITGEVTREDILERIFSCFCVGK"
FT   gene            364024..365883
FT                   /locus_tag="STHERM_c02920"
FT   CDS_pept        364024..365883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02920"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01265"
FT                   /db_xref="GOA:E0RP71"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP71"
FT                   /protein_id="ADN01265.1"
FT                   /translation="MDADVIVIGGGHAGIEAALAASRLGCSTVLITQLLDTIGKMSCNP
FT                   AVGGLAKGNIVREVDALGGEMGRLIDRTMIQFRMLNRSRGPAVQCPRAQADKQAYAQRA
FT                   KWSLEQQKGLFLFQDTVVDFVLDEAGREIRGVVTERGRRFHARKVVLTTGTFMEAKIFI
FT                   GEYETPGGRLGEPAACGLGGVLRRLGFTVGRLKTGTPARVLRSSLDFSKMQEQPGDEEI
FT                   IPFSFSHDTLEVRQVPCYITFTTPETHRIIRENLHRSPLYGGRIVGRGPRYCPSLEDKV
FT                   VRFPDRDRHQVFVEPEGLSTEEMYLNGISSSLPEEVQEAFIHTIPGLEHAVIMRPGYAV
FT                   EYDYVEPTQLYPTLETKRIRGLYIAGQTNGTSGYEEAGGQGLVAGINAALACRGEPPLV
FT                   LGRDEAYIGVLIDDLVTKGTKEPYRMFTSRAEYRLALRHDTADIRLLEKAYRIGLQSRE
FT                   MFERLQEKIHVLDAIKELLRQRRLAQEEAEQRRLPQLAPHVGKPLYQVLKDPRVTLDDL
FT                   AFLVPELSKYPRPWVRTAEIDVKYEGYLLREQQMVEKFRKMEDMRIPDHFDYSEVEGLS
FT                   SEAREKLSTIRPLSLGQASRISGIRSSDIAVLMVYLSRSRKAR"
FT   gene            365883..366527
FT                   /locus_tag="STHERM_c02930"
FT   CDS_pept        365883..366527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02930"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01266"
FT                   /db_xref="GOA:E0RP72"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP72"
FT                   /protein_id="ADN01266.1"
FT                   /translation="MQDPASLLDRGLALLGLSPTPSQRAALLSYLHLLAEWGARIDLVA
FT                   DPSPEALAVHLLDSLAPLPHLRALLSSPLADLGSGAGLPGIPLAIMNPHLEVLLVEARG
FT                   KRAVFLEHVLLSVDLARCTVLHARLEDLPLHVPCAVARAFLPLSPDTLPLYLHPLSPGA
FT                   HLLLYKGRLETAQEEARLLRPHFEEVEVLPVSVPFLDAPRSLIAARGRLLV"
FT   gene            complement(366538..367986)
FT                   /locus_tag="STHERM_c02940"
FT   CDS_pept        complement(366538..367986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02940"
FT                   /product="putative TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01267"
FT                   /db_xref="GOA:E0RP73"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP73"
FT                   /protein_id="ADN01267.1"
FT                   /translation="MNGDTCAFRGVRDFLDLPGVRHDNGLMGALPLLLPAAIVLVGLVI
FT                   LTVYFNLYVLSDPEKKAERKKRRDRQTILKKAQRRLVQNPRDPEALVVLAEAYFEDQEW
FT                   EKALKLYQVLAEGVTDRTKVDEYEVQVRRGVCAFRLGRHEEAYQAFAVAYSLKPEAFEV
FT                   RFHMGALEYLRGAYEHAVKLLSAAAAQQPEHPETRRYLSLALHRSGKYKEALPSIRAIL
FT                   NEMPDDKELLFAYADCLANLGQKEQALSIFTHLRVDEQWGPQACFRAGLINLGLHRYER
FT                   AIKDLEIGVRHRGMDNQLRLEMEYRLAQAYIHQKEIRKAVEHLRAVQRTNPHYKDVEAL
FT                   LKKYGELQQNQNLQTYLLASPPDFLTLCRKLVVAFFPGAYVRILNMSIERSEYADLLCE
FT                   VETSQWQDTVLFRFVRTTGTTGELAVRDFHARLKETRADRGICVSAGSFSDEAKRFVEA
FT                   RLIDLVGKEDLMGYLRKVDSLNPV"
FT   gene            368023..369459
FT                   /locus_tag="STHERM_c02950"
FT   CDS_pept        368023..369459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02950"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01268"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP74"
FT                   /protein_id="ADN01268.1"
FT                   /translation="MTLSEVEQTLRDHGVPDAVVQHILKTLVAAKRTKDALEKLKEEYR
FT                   QVRRLVDQSPDTGLPVRKGLEQDFSRLTEEASREGKKLALFLIRLDEKYERIENSRDRS
FT                   RVLLFKTARRIRRVLPGLYQGDRPEEFLGARLVSGGEEAVSLGKEISDVVMVPQDPPAE
FT                   DIQFGCYVGIVLFPDHGEEWPALFEMLHIAVAEAMREKERAVLYTGEIGRRHFEEELVL
FT                   EHMRRVLRDGFEEFHLAYQPIVDRSLSIVGAEALIRWDNPALGSVSPARFIPLAESTGD
FT                   IMAIGQWVLYRACKQLSLWHARGFRELFISVNLSPPQFKLHDLAFRVAGILKSLAFEGK
FT                   FLKLEVTEGVLMDHPEEAVEKMNELRAMGVKLCIDDFGTGYSSLGYLRRFPFDTLKIDR
FT                   SFVVGVEDDPSLQGIVRAIIGVARALGISTLAEGVENERQLDFLMAEGCEMFQGFYFAR
FT                   PVPPEDFERLLREGVRVARA"
FT   gene            369481..369948
FT                   /locus_tag="STHERM_c02960"
FT   CDS_pept        369481..369948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01269"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP75"
FT                   /protein_id="ADN01269.1"
FT                   /translation="MVKVMSVRSPWVICLLVVGVAGAWAQGGPDPVGMLGWDLARAFEE
FT                   LGVPERVEAVRGEEAWQDDVAFVYGEGLVLFFWRERVWQVFVGEGYGGGVAGIEVGMAW
FT                   EEAEASVEGRLLQEEGEIAVFELPDRGFPVRMQVLRKAGRIEGVYVYRADF"
FT   gene            370005..371480
FT                   /locus_tag="STHERM_c02970"
FT   CDS_pept        370005..371480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02970"
FT                   /product="3-dehydroquinate dehydratase, type 1"
FT                   /note="putative/shikimate 5- dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01270"
FT                   /db_xref="GOA:E0RP76"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP76"
FT                   /protein_id="ADN01270.1"
FT                   /translation="MRGGVCLSLTGRTRKEAETQLARWREEVDLLEVRADCMDEGEWEG
FT                   LGEWASGLGLPAILTLRSDRDGGFFEGTEDVHDEALGELIRQGGWAYVDVEAWAADWLV
FT                   DEARRRGMYVIRSRHVMDGVPEDLEDWMVETVGQGLVPKAACMLGGTEDLLRLVRLHRR
FT                   LTARGLPPGSYILLGMGPYGVPTRILSLAWGSLLTFTSDPGRTAAPGHLDPGVMADLYR
FT                   VRELSESTVLFGVIGNPVLHSRSPHLHNPVYRREGMDAVYLPIQVDELASFMDLADELP
FT                   LQGLSVTIPHKEGVIPFLTVCDPVVQAVGSCNTMVRRDGGWFGTSTDVEGFLRPLREEI
FT                   ARGGDPVMKAAVVLGAGGAARAVVYGLVQEGFRVLVLNRTEERARVLAGEFGVDWGALS
FT                   PESAERMREFRGLIVQTTSVGMEGKEPASPVPWYRFEGDEICYDIVYTPRITPFLEAAR
FT                   RAGCRIITGDRMLEAQAEEQMRLFAARYRELRG"
FT   gene            371569..372762
FT                   /locus_tag="STHERM_c02980"
FT   CDS_pept        371569..372762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02980"
FT                   /product="putative saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01271"
FT                   /db_xref="GOA:E0RP77"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP77"
FT                   /protein_id="ADN01271.1"
FT                   /translation="MARVLIIGAGGVGRVATHKCAQYPEIFSEIMLASRTVSKCEKIAS
FT                   EIERPIRTAQVDADYPEQVQALIKDFKPDIVINVALPYQNMAIMEACLREGVHYVDTAA
FT                   YEPKDEKSFSYDWQLKAYKEPYRGQGLVGLLGCGFDPGVTNVYVAYAAKHYFDEIHELE
FT                   IVDVNAGDHGLPFATNFNPEVNIREITLPARHWEGGEFKVTPPLSEKRDFECPEGLGTY
FT                   PVYLMYHEELETLVRNFPTIKKATFWMKFSDEYLQTLRTLQRIGMTSIEPVDLGPVKIS
FT                   PLDFLRKVLPDPAELGPRTKGKTCIGNIMTGIKDGKKRRIFIYNICDHQEAYKETGAQA
FT                   VSYTAGVPPVLGAALVLDGAWKKPGVYTPEEFDPDPFMERIGEYGLPWKVVELDPEA"
FT   gene            372759..373916
FT                   /locus_tag="STHERM_c02990"
FT   CDS_pept        372759..373916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c02990"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01272"
FT                   /db_xref="GOA:E0RP78"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP78"
FT                   /protein_id="ADN01272.1"
FT                   /translation="MREGAFQGFDPQAVPSPCFVVDRDAVEENLKILDRVQREGGARVL
FT                   LALKGFAMWSLAPLVSSYLSGTCASGVWEARLGRECFGGIVSTYGPAYKEDEVRELLTL
FT                   TDHLIFNSFSQWERFGPLVGSAPRRVEAGIRVNPERSGAPAAIYDPSGPNSRLGVVRSR
FT                   FRPELLDGISGLHFHTLCEQNVDALEAVLQAFEERFGEFVPRMRWVNWGGGHHITRPDY
FT                   DVDRLIDLVRDFRSRYGVDVYLEPGEAIALGTGVLVAEVVDIVENGMRIAVLDTSATTH
FT                   MPDVLEMPYRPEVWGAGLPGERPYTYRLGGISCLAGDVIGDYSFDRPLEVGDRLVFDDM
FT                   AHYTMVKTTTFNGVKLPSIGIWSSKEQSFTLVRSFEYEEFKRRLS"
FT   gene            373945..374820
FT                   /locus_tag="STHERM_c03000"
FT   CDS_pept        373945..374820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03000"
FT                   /product="putative agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01273"
FT                   /db_xref="GOA:E0RP79"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP79"
FT                   /protein_id="ADN01273.1"
FT                   /translation="MRYPHFLHSEIPNASPEEAFFHVIPVPYERTTSFGKGAARGPSAI
FT                   LEASGQLEVWDGRGIPAEVGIHTGGPVKARTPERMAREVAARMRPVLRSGRVPVLLGGE
FT                   HTVSVGAWEALKEVYGPGQVGIVQIDAHADLRDTYEGSRFSHACVMRRALDHGFSIFQA
FT                   GVRSLSPGEVALRRELAGRQVFWKDAPELRRTGAPLALPPDFPSNVYLTIDVDGFDPSV
FT                   VWETGTPEPGGLFWYEVLDFIERVAEAHTVVGFDVVELAPAKGSHVGAFVAARLVYQVM
FT                   GIVFRHPPRR"
FT   gene            374889..376712
FT                   /locus_tag="STHERM_c03010"
FT   CDS_pept        374889..376712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03010"
FT                   /product="AMP-binding enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01274"
FT                   /db_xref="GOA:E0RP80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP80"
FT                   /protein_id="ADN01274.1"
FT                   /translation="MVHIERKTLSDLVLAAAREYAERPAFDLFWNGRIEEPVTYAQLGA
FT                   RSAGVASVLRDLGVGPGDRVMILAENRPGWPVAYFGISLAGGISVPVLLDFSTDQVREV
FT                   ASHAGVRVVCATERSLEKLREAGLLEGDLPVLLIDRMDDAGLEVLEGGDRKHREYAPDF
FT                   TPVFPDPDETASLIYTSGTTGHSKGVMLSHASLIFEVEASRSIFKVYPRDRFFSVLPLA
FT                   HTYECTIGMLIATASGARTTYLGRPPTASVLLPALREVRPTVMLTVPLIIEKIYRTKVK
FT                   PSLESHPLYRFPLTRPLATKIAGRKLLASLGGAIRFFGIGGAALAPDVEAFLKASGFPY
FT                   AIGYGLTETAPLVAGSSVGKTVLRSTGPALKGVEVRIVDQEGRVVGGVGAPRDARPGAE
FT                   GEIQVRGPNVMKGYYRDPERTREAFTEDGWFRTGDLGAMDRKGRLFIKGRLKSVIVGPS
FT                   GENIYPEEIESLLNLSDYVEESLVYEGEKGELVALIVLSERAKTLYAALEDGIKEAGRA
FT                   AQEGVHEVTREVGELVQQVASAAKEGTEQVRKGVEDVVKELVAMVNRRLPGFSRIRKVE
FT                   IREEPLEKTATHKIRRFLYTRQRDGNGRQTG"
FT   gene            376914..377654
FT                   /locus_tag="STHERM_c03020"
FT   CDS_pept        376914..377654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03020"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01275"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP81"
FT                   /protein_id="ADN01275.1"
FT                   /translation="MKRVVFSLLLLCLASSVITAEAWGGVGYVMASGVMEGLPGDTLPL
FT                   NGTLSAHGYDELSPFTFGMGGGGGAFLGSVYIGGWGGGEGFFAESKGPDGKLLSRTSGY
FT                   GGLEVGVPLSLGQVIFMPVGTVGAGGTEIELIDPPGGSASFDDLLDDPRVGVRLTSSEI
FT                   RVGVGLQFLWMPGVAGFLVKAYYFYVPYQSWSIMGPGEYTYPVEGVPSSSPHRFFLGVG
FT                   VGFGGVFSERGKVNDRGWAEWEEE"
FT   gene            377697..378200
FT                   /locus_tag="STHERM_c03030"
FT   CDS_pept        377697..378200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01276"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP82"
FT                   /protein_id="ADN01276.1"
FT                   /translation="MQRIIRILGLVLGLASPFPEVWLSEPSFHMEEGGLFVKVRASGVI
FT                   NDQLFSLIDAYVPVTVVTRVEVWVDERLVRRFAVSQRVERVGEFYAVEGERPLSREDVE
FT                   DVFSLCEVRVLEEVERYRGSEVRVRISLALYSSVFSPVQDLWGNNPMTEGRWVVPEGGD
FT                   DGGD"
FT   gene            378187..379098
FT                   /locus_tag="STHERM_c03040"
FT   CDS_pept        378187..379098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03040"
FT                   /product="putative ATP-binding ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01277"
FT                   /db_xref="GOA:E0RP83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP83"
FT                   /protein_id="ADN01277.1"
FT                   /translation="MVVIEVRDVVKRYGEREALAGVSLMVQEGEVCGIVGPNGAGKTTL
FT                   LECMEGLRRPERGLIRVWGVVPWSREGRGVRSTIGCQLQDDALPRGMKVREAVRLFAAI
FT                   YGSEDRAWWEEVLSVCGLGGREDARWEELSGGLRQRLLLALALLHRPRLVFLDELTSGL
FT                   DPHGRREVWHLIRRVKEMGTTVVLTTHYMEEAEVLCDRVVLLHQGRVVAMGSPGELVEA
FT                   YGGGYVIAPEGEVGDVVKGMGMDGVEWRDGVVVCRGGKEQVVEVVRRLVHAEGIGGLSI
FT                   RRPSLEDVFLSLTGRYEDERGV"
FT   gene            379082..379813
FT                   /locus_tag="STHERM_c03050"
FT   CDS_pept        379082..379813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03050"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01278"
FT                   /db_xref="GOA:E0RP84"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP84"
FT                   /protein_id="ADN01278.1"
FT                   /translation="MRGVYELAKVELSLFLREPVAVFFTFVFPSLLLVLYGAMFGSYEG
FT                   YLEYEVPSLFAMVILTMGMMGIPSGIGQEKEEGVLKRLRMTPLPSWGYPVAWSVVYLVV
FT                   TVLGGLLLYVVAMVGYGMRGPVNGVGFGVGFFLGALCFLMWGAVVGLVFRRARTASIVG
FT                   MVCFFPQLFLSGATFPWDMVPPGLRAVGELFPMRHLVVVLQGAWRGEVGWGRAAWGLVV
FT                   WCVVGFVGAVGAWLRVRGDER"
FT   gene            379828..380886
FT                   /locus_tag="STHERM_c03060"
FT   CDS_pept        379828..380886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03060"
FT                   /product="putative nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01279"
FT                   /db_xref="GOA:E0RP85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP85"
FT                   /protein_id="ADN01279.1"
FT                   /translation="MLLVVVLVLLLWVMATGVVVAVYDRVEGALMSAIEGVKGRFSDED
FT                   ARLLSGVLEGVRLLQERRRVEVLRAMFAVLAGEVVLSGLVVFFYVRRVRRPVLELARLM
FT                   EEFRGGEVPAGGGVYEVRRLVAAYTGMLRRLERYEQEVGDLARFRGWKEMARVCVHEVR
FT                   NLLSPVRMVVEQGLSVGEGLCGERLGFVLRKLGEVDGVLARLRDLAHLPEARPGRVVVG
FT                   EVVREVVGEFPGMGCEVCGEVVVRADGVLLAEVVRNLCANARDTGAPAGVRVWGEGEEG
FT                   VVEVWDRGPGIPEEEQERVWEPGVSGKEGGMGLGLALVRLLVGEMGGRVVMWSRVGEGT
FT                   RVEVRLPGWEGV"
FT   gene            380883..382208
FT                   /locus_tag="STHERM_c03070"
FT   CDS_pept        380883..382208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03070"
FT                   /product="putative two component, sigma-54 specific,
FT                   transcriptional regulator, Fis family nitrogen
FT                   assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01280"
FT                   /db_xref="GOA:E0RP86"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP86"
FT                   /protein_id="ADN01280.1"
FT                   /translation="MTVLVVDDERDVVEGFRMAFPEWEVRGAGSGAEALRVLEAEPVDL
FT                   VFLDVRLGREDGLALLGRIKERWPELPCVMISAYGTVERAVEALRRGAVDFLEKPLSLQ
FT                   KVRIVAERTASEVFARKVVEQERERYALLGESEAIREVRRLVEKAARVEVPVLVTGESG
FT                   TGKEHVARLLHLLSRRARGPLVALNCAAVPADLFESEIFGHEKGSFTGAERRRKGRIEE
FT                   ARGGTLFLDEVGELPASQQAKLLRVLETGEYYPVGAERPRRADVRVVCATNRDLEAMVR
FT                   EGSFRADLYYRLGVLRIHVPPLRERREDIPLLAQVFLRRVCEELGQGRSFSRETLSVLM
FT                   EGEYPGNVRELQHLVWRAALLSEGPVIGPEVVGKVRDEGRKAFVEDLLLAPRPLGEARR
FT                   EFERAYIAYHLSRCGGNVSRTARKLGMAPSNLMRRMRELGMR"
FT   gene            382258..383232
FT                   /locus_tag="STHERM_c03080"
FT   CDS_pept        382258..383232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03080"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01281"
FT                   /db_xref="GOA:E0RP87"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP87"
FT                   /protein_id="ADN01281.1"
FT                   /translation="MRPFCVFVWLVSVGVGGLWALDGWAFSSSLETSWFTGEAHELVYQ
FT                   KWDEGDHLLSRLVWPAEGWLLEAEAGLSWWRVGIEGWYAFLVGGREPGAWMEDYDYMNL
FT                   GDPDPTHFSTHPVELGPYREIGGGLSFRIVDRSAVRISLGAGWEYLHRYWSAHDGYAQY
FT                   PSGVGDPYDPSSGTGWPYPEWTGDEPKSSFDGEVITYEQEVMGPVLLFRCGMRPSTRLE
FT                   AETSVMWSPYPLAVTLDEHVLRDILFLDKMAGGVLLDVSGELQVFLWKGLSLYGRGWYR
FT                   LVSMAKGDSYFKEEGTWYQAADGKSGMESTEWGLGMGMRVMVE"
FT   gene            complement(383235..385208)
FT                   /locus_tag="STHERM_c03090"
FT   CDS_pept        complement(383235..385208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01282"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP88"
FT                   /protein_id="ADN01282.1"
FT                   /translation="MERRRADIDRFTAYLLTLPDRDFLRLIRNYLGRIETPYHKPQLVE
FT                   RLYRFLESPRIQEAILALLTPHDRAHLSLIAALGEPPPEVFTSFLEEEGEEDPHLILHR
FT                   LRDRLLVYLDTADEPPRIRFTPPLRPLLETRVLSLEAVLPPEGPTPPSSPPHPWLTDPL
FT                   LGALLSLLTDDPSLLDTRDGTPTSRARTRIASRIPHFSHHPDHLPLLVRALTRLSLIPA
FT                   PTPAALLARFRALADLPPSTRLPLLWAAAIAPDGADPHPLAAALLALPDLLPPTHTYTP
FT                   STITRALRLALTLHTQPHTQPHTPPPIEDLASLGLLVPHETTLSLTPHIPTLLNPPETP
FT                   PFKVEASGHLIVHPHAVLSDLLVPCAALSLIRHDTVSRYELTKPALRRGLETGIEIAEL
FT                   RLALTVGSGHPVPQPVAATLTLWQEEAERARHLRGIVAILEPEYARIVRQSPQFSACVW
FT                   ETLGETIFLVREERWEEWKTLLEHAGIGLLGPVEEETPPSEGPLPLPTHLAPPVVPVLP
FT                   EALTAPPPDLRPALLEALERTPLSEEARHLLKARIEEGYILTPAQLSGETADTELLESD
FT                   GLDYHGKLRVLEEALSHAGDLVEVCILGHKDPTTLLVRPLALKKKGASHYLEAIPEGEE
FT                   APLHIPVRTIQHVRRIPRTLTG"
FT   gene            complement(385184..386950)
FT                   /locus_tag="STHERM_c03100"
FT   CDS_pept        complement(385184..386950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03100"
FT                   /product="putative DNA-helicase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01283"
FT                   /db_xref="GOA:E0RP89"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP89"
FT                   /protein_id="ADN01283.1"
FT                   /translation="MPHPPPPVQPHPPCPPPPPWATLTPMSGPLIVQSDGTILLEVSHP
FT                   EADEARNAITPFTELLTSPEYIHTYRITPISLWNAASAGLTYDQITTRLSRYARYPVPP
FT                   TLLDTIRHTLKRAGTLTLLPTPSPHTLLLSIRPPASRQELLSYRQLARLLEPSTPDLPP
FT                   RDDALYVPLIHRGTIKQLLIDLGYPVTDLVPLQEGEPLPLSLRTTTRSGRPFALRPYQE
FT                   AAVKAFTGDDGPGTGYGTIVMPCGAGKTVVGLALMAHYRTSTLILTPNVAAAHQWIDEI
FT                   LDKTTLTEDQIAEYTGESKDIKPVTVATYHILTWRPDQTQEHYPHFDLFLARNWGLIIY
FT                   DEVHLLPAPVFRITAELQAKRRCGLTATLVREDGKERHLFALVGPKRHDIPWKEVEAQG
FT                   WIAEALCYEIRIPLPEDLRLAYIAADQRKKHTIASTNPLKDRVVAVLLERHPDLPTLII
FT                   GQYLDQLERIARTLGLPLITGRTPNRERERLYREFKEGRITRLVVSRVANFSIDLPDAA
FT                   VAIQVSGTFGSRQEEAQRLGRILRPKHHHAYFYTIVTRDTLEEHFAANRQRFLTEQGYR
FT                   YQMELWSEDELT"
FT   gene            386971..387855
FT                   /gene="lipA"
FT                   /locus_tag="STHERM_c03110"
FT   CDS_pept        386971..387855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="STHERM_c03110"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.-"
FT                   /note="Lip-syn; sulfur insertion protein;
FT                   lipoyl-acyl-carrier-protein synthase; lipoate synthase;
FT                   lipoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01284"
FT                   /db_xref="GOA:E0RP90"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP90"
FT                   /protein_id="ADN01284.1"
FT                   /translation="MDERRKPEWLKIELGLSPEHKKVRRELARHGLHTVCEEARCPNLH
FT                   ECWGRYRTATFLLLGEVCTRRCRFCAVGHGRPCPPDPEEPARVAQVVARLGIRHVVLTM
FT                   VTRDDLPDGGAGHVAAAVREVRKASPGVRVEILTSDFRGDLAALETVLESRPEIMSHNV
FT                   ETVRRLTPRVRSGASYERSLAFLREAGLRVRAYGGFLKSSFMVGLGETEEEVKETLRDL
FT                   RAAGVQMVNIGQYLQPTKEHLPVARYWSPEEFDRLRDYALSLGFIACSAGPKVRSSYHA
FT                   EETVRMLGDVGPA"
FT   gene            387983..388918
FT                   /locus_tag="STHERM_c03120"
FT   CDS_pept        387983..388918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03120"
FT                   /product="NADH:ubiquinone oxidoreductase, Na translocating,
FT                   B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01285"
FT                   /db_xref="GOA:E0RP91"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP91"
FT                   /protein_id="ADN01285.1"
FT                   /translation="MDLKIFQKQPPMRKVLLSLVPIFLWAAYFYGVRLAALALVVFPVG
FT                   VAVEYLMERRRGRKVSEAVLVTCSLFLLSLPPAVPLWVAAIGIAFGVFMAKEVYGGFGR
FT                   NVFNPAIAGRLFVYITFPTLMTRSWLKPGAFGLLPDALTSATPLDALRAGTLPPLPDML
FT                   LGLHPGSMGESALPLILLAGIYLVATRTASWRIMLSTLGGALLLSAGLYYAGVPGAVPP
FT                   HYTLLAGSLLFVAVFMATDPVTAPNNPRAHWLYGLLIGAVVVLVRTFSLFSEGTSFAVL
FT                   LANAVAPLLDELLPRRPAAARRPAPKGGAA"
FT   gene            388915..389583
FT                   /locus_tag="STHERM_c03130"
FT   CDS_pept        388915..389583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01286"
FT                   /db_xref="GOA:E0RP92"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP92"
FT                   /protein_id="ADN01286.1"
FT                   /translation="MNRNSLPYVVLFSFIVTALFVTILAAAHLGTRERVLLAEERRLRE
FT                   AVLHALKTPASGEEARRTFARLSVAALPDGTRIYRTPEPRSYAVELSGPGLWGTIRAVV
FT                   GISGDLSRILGLAILEQNETPGLGGRITEPWFLSQFEAERIGPDGIAVRQTGRSGDPDP
FT                   DNSQVDGITGATRTSQAIETLVDRAVITLKEALPTLSEEDFAPVEAPRPRTSPDDERSR
FT                   "
FT   gene            389583..390185
FT                   /locus_tag="STHERM_c03140"
FT   CDS_pept        389583..390185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03140"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /EC_number="1.6.5.-"
FT                   /note="NQR-1 subunit D; NQR complexsubunit D;
FT                   Na(+)-translocating NQR subunit D) (Na(+)-NQR subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01287"
FT                   /db_xref="GOA:E0RP93"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP93"
FT                   /protein_id="ADN01287.1"
FT                   /translation="MAATPRRILAENTWTNNPIFIQILGICSTLAVTNNLTNTLIMTLG
FT                   VTFVTGFSSLTVSLLKTLIPHRVRMITQTLIISFYVIIVDILLKAYLPEIHKSLGPYVG
FT                   LIITNCIIMGRAEAFAQSNPPLLSLWDGLTSGLGYMWVLMLIALIRELLGFGTLFNIRV
FT                   LPEGFEPWTIMVMAPSAFFILAMVLWAAKTLMNKEAA"
FT   gene            390182..390775
FT                   /locus_tag="STHERM_c03150"
FT   CDS_pept        390182..390775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01288"
FT                   /db_xref="GOA:E0RP94"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP94"
FT                   /protein_id="ADN01288.1"
FT                   /translation="MTPDISPLALFVASIFTSNILLANFLGMCSFISISKDLSSSNGLG
FT                   LAVTVVLTITSAINWLVLHYVLIPLDLVYLRFIVFIIVIAAVVQILEMIIDRISPSLYM
FT                   ALGIFLPLITVNCAILGVALFIEIRGYSLLQSVVYGLGSGLGWWLAIMLLAAIRKKIER
FT                   APVPAGLKGPGITLITIGFMAMAFIGFSGMVAVQ"
FT   gene            390787..391893
FT                   /locus_tag="STHERM_c03160"
FT   CDS_pept        390787..391893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03160"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /EC_number="1.6.5.-"
FT                   /note="NQR-1 subunit F; NQR complexsubunit F;
FT                   Na(+)-translocating NQR subunit F) (Na(+)-NQR subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01289"
FT                   /db_xref="GOA:E0RP95"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP95"
FT                   /protein_id="ADN01289.1"
FT                   /translation="MSALVIAPLAVGGITAALALLIWLTDRVVNNYGTVTISINGGKKT
FT                   LTVKGGSPLLLTLAQEQIFIPSACGGRGSCGACKVRVETDIGPHLPTEVPYLTEEERAR
FT                   NVRLSCQVKVKHDLSIEVPEELFLVRRVVAEVSSIRDLTHDIKEVRFRLPEGERIPFKP
FT                   GQYVQLEVPPYAKIKEPTQRAYSISSLPDEEEIELLIRKVPGGIATTYVHEHMKEGERL
FT                   ALIGPFGDFYLRETDAVMLCVAGGSGMAPFKSILLDMYRRGVNNRQVWFFFGARTRRDL
FT                   FYVDLWRDLEEKWPVFRFVPALSEDPDYEGEKGLITEVLARYIETTMDREAPKEGYLCG
FT                   SPGMLDACMNVMRRYGIPEDKIYFDKFA"
FT   gene            391904..392356
FT                   /locus_tag="STHERM_c03170"
FT   CDS_pept        391904..392356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01290"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP96"
FT                   /protein_id="ADN01290.1"
FT                   /translation="MKTDPHYAKAYENMKPGVITAEGFLGDDPRTLADIIEADEEEFAR
FT                   LGLSFEEVAARLKALRDEGKKGLGEPVTVEGKWLVRVDDARGHLPSPFEDGIFRKVNTE
FT                   VTNLRNGETLVFTDLNLHLLERYHFLEGKGSPFRLEPERIKRVLEG"
FT   gene            392398..392793
FT                   /locus_tag="STHERM_c03180"
FT   CDS_pept        392398..392793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03180"
FT                   /product="putative hepn domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01291"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP97"
FT                   /protein_id="ADN01291.1"
FT                   /translation="MNRAFDWFVQAKRDLEQAEDSRKAERHEWACFAAHQAAEKAVKAL
FT                   HLYHHQEGWGHVVAKLLEDLPPLCAVPEELIEKAKVLDNFYIPTRYPNGHPEGAPFEHY
FT                   GPLQSEEAIRYARDILAFVGKAMALEG"
FT   gene            392741..393127
FT                   /locus_tag="STHERM_c03190"
FT   CDS_pept        392741..393127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03190"
FT                   /product="putative nucleotidyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01292"
FT                   /db_xref="GOA:E0RP98"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP98"
FT                   /protein_id="ADN01292.1"
FT                   /translation="MPVTYSRSSVKRWPSKDEVDRAVREWADRVAREKEGVVRIGYFGS
FT                   YARGDWGVGSDVDIVVIVEASSLPYERRGTEWDVLDLPVPADVLVYTLEEWEALSSGGA
FT                   RMWRTIMEEAVWVWQAGRASDPSG"
FT   gene            393201..393722
FT                   /locus_tag="STHERM_c03200"
FT   CDS_pept        393201..393722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01293"
FT                   /db_xref="UniProtKB/TrEMBL:E0RP99"
FT                   /protein_id="ADN01293.1"
FT                   /translation="MKAYVRALVFGMVAVVLLAGCELLFYDPEGVWKVTEVEIGSSVTS
FT                   LPQMTTKDVDGDGTREDVLKEEYIRISFLTVAYYEIYTLLEDSSDGGMYTKGEVVYTIR
FT                   SENVSDLDKSMKRITFEDGREASYTFEDENLVLTVEEYLTDVLVEVSYTCEPSSTDELD
FT                   EALAGATKIN"
FT   gene            complement(393781..395376)
FT                   /locus_tag="STHERM_c03210"
FT   CDS_pept        complement(393781..395376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03210"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01294"
FT                   /db_xref="GOA:E0RPA0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA0"
FT                   /protein_id="ADN01294.1"
FT                   /translation="MSDRFPLRRYGAAVFSAVLFSLAIPNEVFQWGMPLLSPFILTPLF
FT                   WGLEGASLPQARRMLVLFGLVFTLTSNYWLAFFGDYSIWTIGGVTLGYIPYYLFLSHFL
FT                   WDAARRPLPLRPLLLAAVWTVFEYCKSSGYLGYPWGLLPYPLHGILPLIQVSDLLGIWP
FT                   LTFLLAWMSALLADILSPPAPPTPSRPTPSPLPQLAAAGLLLAVFLAYGLVRMYLIPLP
FT                   ERGAFTAALIQHNADSWDESPDADEESILTAERLSLEAIRTTPEVDLVVWSETVLTYPY
FT                   NYRPAFYERRPAEKPFFAFLVELNRPLLTGSPYREKVGEEVRYYNSVLLIGPDGAIQGA
FT                   YKKKHLVPMAEHIPFWDVPLIQHFFRGTIRLYGTWEPGKENTVFTLPLEDGTLVRFGTP
FT                   ICFEDAFTVINRALVRAGAEVLINLTNDSWSRTVSAQVQHFVAARFQAAALKTTMVRST
FT                   NSGYTCVIDPWGRVRADLPMFTPAYLTARVPLYDRPPTLYALAGDLLPRLLFLWVIALL
FT                   LWERGRGGMRTPHG"
FT   gene            complement(395369..397219)
FT                   /locus_tag="STHERM_c03220"
FT   CDS_pept        complement(395369..397219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03220"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with AtoC"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01295"
FT                   /db_xref="GOA:E0RPA1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA1"
FT                   /protein_id="ADN01295.1"
FT                   /translation="MEDEIRLLMRTIHYHEGNQEILKGVDFELRKGEIHALVGEHRCGK
FT                   STLMHLLVGEKRLQKGEILFNGRRIQPQDPSDAYRLGIAMVHQTPQVIPSLNAVENIFA
FT                   TRLPPFWSGLPQYYRYIRETRRLLALLGKEFDVLIPLKLLPATDQQAVDIARALSYDPD
FT                   ILILDEISNRQTPEELERLFAILKDMTSKGKSIIYVTPHIDEIFSIADRVTVLKNGYRQ
FT                   STEDVHQISSLRLFRLAYSLISEIEPDESAISHPLISSRLYSEHFLRELPVGIILLNET
FT                   HSVYYLNPAAESILDLPAHDVSGRPIHTVITPEQCPHATALLSAVYHGKKRKWRGVPFG
FT                   KALYSEVHIYPLREGDELVGTVIMIEDRSLDHHIKEYLSSTERRIATAEVAAEVAHEIN
FT                   NPLGIISAYIEVLKLQDLSPEISRKLEKIQNEITRIQNFVSSLGRLADASRMEWGTVDL
FT                   VEMVKDVLLLFQHLFQEKRITVYTDLPETPVKIEGDAGRLKQLLINLVLNSVEALLHGG
FT                   WIRIRLERKEGKIVLSVSDNGHGIPKEIQDRIFRPFFSTKAGKQSTGLGLAICEHIAKL
FT                   HGGEIGFTSTPGEITTFTVTFPARPVLSPPGKVGYHRPDE"
FT   gene            complement(397219..398739)
FT                   /locus_tag="STHERM_c03230"
FT   CDS_pept        complement(397219..398739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03230"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01296"
FT                   /db_xref="GOA:E0RPA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA2"
FT                   /protein_id="ADN01296.1"
FT                   /translation="MPSCASSTITLPCKQKETRRTPRNAPECALSATFSSPIVHESTHS
FT                   GLHPKNLHKIPFYAIIFVMGEQKRFSLLIVDDEAALCESLSEYFSALGYETYTAQRVED
FT                   VRRILSRIHVDLILMDIRMPEKDGITLLRELKTSHSSTPVIMISAYVSVENIVRSMKYG
FT                   AINFYEKPLDLRRLSREVAQIAAARAARAPQGPTVPLIHESAAMQDILATIEKVAPTDA
FT                   PVLITGESGTGKELVAHAIHHRSERARGPFLKLNCAAIPETLLESELFGYEKGAFTGAV
FT                   TQHKGKFEQAQSGTIFFDEIGDMHLGTQAKLLRVLQEKEFQRLGGSEVLYADVRIIAAT
FT                   HQYLPGLIEEHRFREDLYYRLSVITIHIPPLRDRRDDILPLTRYYIDYFSKLYGKRVEG
FT                   LSPEVERLFLSHSWPGNVRELKNTIERAVIFTEGERLTMDDLPPQYRETVFLEPVPEGD
FT                   LSTAMDHLSREIILKALEKAGGKKQKAAELLGIHRKTLYNKMKKLGLL"
FT   gene            398752..399870
FT                   /locus_tag="STHERM_c03240"
FT   CDS_pept        398752..399870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03240"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01297"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA3"
FT                   /protein_id="ADN01297.1"
FT                   /translation="MVYTYILFSGGPMKRILLSALILLIAVTGLFAQGQGQGDDRIVIG
FT                   VSFSDFATERWPNEAALFTKLGQENGVQVIVQVANQDPKLQNDQIENMVLQGADVIVVI
FT                   AQDGDAAATAAEAAAREGVPVIAYDRLVKTDKIAAYLSFDNVEVGRAQARGVLKVKDRG
FT                   RFVLLGGSPTDNNAILFRKGQMEVLQPYIDKGQIEIVADQWVENWDPANALKIMENILT
FT                   ATDNKIDAVVASNDGTALGALQALKAQGLAGKVPISGQDATLAGCKSIVEGELTMTVFK
FT                   DIRKLTPLAFELALALAKGEDIRQKYPEIKDYDLADLTLDESFRGKKVPCYFLPVVEVD
FT                   KTNVYEEVIKSGFQPYDEVYRDIPEDQRPPRP"
FT   gene            399934..401466
FT                   /locus_tag="STHERM_c03250"
FT   CDS_pept        399934..401466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03250"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01298"
FT                   /db_xref="GOA:E0RPA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA4"
FT                   /protein_id="ADN01298.1"
FT                   /translation="MGDDYILRIEHVTKDFPGVRALDDVSFSVRRGEIHGLCGENGAGK
FT                   STLMKILAGVYPHGTYEGNVFLDGEEIRFEQGAIRQAIEKGIAIVYQELALVPKMTVGE
FT                   NIFLGREPRTPAGTIDWDRLYADTKALLDEFGLDIHFSAKVEDLSVGKQQMVEIARALS
FT                   ENAKVLILDEPTSALSDAEVETLMRILATLKERGVTCIFITHRLNEFFRITDSITVLRD
FT                   GKVIDTLKTSETNVEHLISLMVGREMKERFPSRSVIPGEEIFSVEGWTVEDPERPGKVV
FT                   IHDVSFSLRKGEVLGIAGLMGSGRTELVMSLFGEYGRVVRGRVFLEGRELFIRSARDAI
FT                   SHGISLVPEDRKKQGLILRQTILQNMALPNMEMFSGFGYIDKNKELKLCSEYSTRLTVK
FT                   TPSLHAPVDTLSGGNQQKVVISKWLMKEPKVLILDDPTRGIDVGAKYEIYKLINQLVAS
FT                   GVSVILISSELEEVMGMSDRILVMCEGHATGILEREEFDQERIMSLATKLFH"
FT   gene            401487..402692
FT                   /locus_tag="STHERM_c03260"
FT   CDS_pept        401487..402692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03260"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01299"
FT                   /db_xref="GOA:E0RPA5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA5"
FT                   /protein_id="ADN01299.1"
FT                   /translation="MNDLMNRLKRAVQVNAKTYTMIIALLLIWFLFGVLTGGIFFSPRN
FT                   LSNLFRQMTIISFLATGMVLVIVLGNIDLSVGSVTGFISAVTAFLQARILANVLPSLFP
FT                   SLPQGTIGILSTVIAIVVALLVGIVIGLFQGGLIAYGGIPAFIVTLGGMLIFRGGVLGV
FT                   TEGKTIVPVEESLVYIAQGYLSPTVGLLLAAVVVVLIFLSTLTSRRKKVEYGFEVPPLW
FT                   KDLAKAGFFSFLVILYVVLMNMYRGVQLPVLLLAVVALIISYVANNTRFGRYVYAVGGN
FT                   REATRLSGINIRKTVFQVHVLMGLLAGVAGVVLTGYVAAGTVNGGINYELDTIASCVIG
FT                   GTSLMGGEGTIFGALVGSLIMASIVNGMSVMNMPIFWQYVTRGLVLIIAVYLDVASKRR
FT                   KE"
FT   gene            402787..403287
FT                   /locus_tag="STHERM_c03270"
FT   CDS_pept        402787..403287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01300"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA6"
FT                   /protein_id="ADN01300.1"
FT                   /translation="MGDKEGEVLEVCFALLAYLSLPDGGMEEVLVAQGGSVVRYEVMVS
FT                   GGGVEFVPVEEGGVGAGSGEEGAVATGSGEPGGGEGEAPEGGWMGGRVRVEPLAGRAHV
FT                   LVVEREGAFATVDLAPLLESERTGEFSEARMEAGGVVWYRGGEVVVCAAEGLVVVGVLR
FT                   SAP"
FT   gene            403321..405480
FT                   /locus_tag="STHERM_c03280"
FT   CDS_pept        403321..405480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03280"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01301"
FT                   /db_xref="GOA:E0RPA7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA7"
FT                   /protein_id="ADN01301.1"
FT                   /translation="MKKKRLITSALPYVNNVPHLGNLIQVLSADVFARYCRSAGYETLY
FT                   VCGTDEYGTATETRALEEGISPKELCDRFHAIHTEIYEWFEIQFDKWGRTSTPEHTRIT
FT                   QDIFLKLDRNGYIKERTIQQLYSEKSGMFLADRYVRGTCPHCGYEDARGDQCEHCGKLL
FT                   DPTELIEPRSAIDGSTPVLRETKHLYLDLPALLPKLKAWMEKASVEGRWATNAIRMTES
FT                   WIRDGLRERCITRDLKWGVPVPKPGYENKVFYVWFDAPIGYISITATYTDRWEEWWKNP
FT                   DGVELYQFIGKDNIPFHTVIFPSTLLGTGEGWTLLKTMSSTEYLNYESGKFSKSRGVGV
FT                   FGNDAKDTGIPADVWRFYLFYNRPETSDYTFTWKDFQEKVNGELIGNFANLVNRTLSFI
FT                   HRFYQGRIPEAPVDTALWGRVRELEGQITEYLERAQLRDAFRTMFALSDLGNKAFQAGE
FT                   PWKTRTERPEEAEKLLRNLAYLVRDLAILVAPYLPATSRRILGFLGNPPATWAQLGRLE
FT                   GLSEVRKPEILFERLEDDRVEALRIRFSGTQAEREESSQPRSEDVFRDKVRLVVAKITE
FT                   VRRHPNAEKLYIEKIDLGGRESQIVSGLVPYYKEEELLGRHVIVVENLKPAKLRGEMSH
FT                   GMLLAAEAEDSVEVLFADHAAPGTRVVLKGDDPASYGEAGEITIDEFFGVPITVKGGVV
FT                   RVGETPLVADGREITTSLVKEGKVG"
FT   gene            405484..406473
FT                   /gene="femA"
FT                   /locus_tag="STHERM_c03290"
FT   CDS_pept        405484..406473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femA"
FT                   /locus_tag="STHERM_c03290"
FT                   /product="protein FemA"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01302"
FT                   /db_xref="GOA:E0RPA8"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA8"
FT                   /protein_id="ADN01302.1"
FT                   /translation="MRRVRLEELEGASLLQSGFWGALKQAFGWRAWGFEGEGGQVLVLT
FT                   RRLPGGMDLAYLPHPWEGVETRFRTGGWMVARLREIASLMELKPLFFRVDLPWEERPAG
FT                   GVLRKAPIDIQPPSTVLVDLCLSDEDLLSSMHHKTRYNLRLAQKKGVVVREEGEEALPL
FT                   WYRMYEETARRDRIAIHSFEYYAHLFRLARTWEGPKPRVVLFMAYHEGEPLAGNIMALY
FT                   RERAVYLYGASRSQKRNLMPTYLLQWEAMQWAKGEGALTYDLYGIPPTPDPSHPMYGLY
FT                   RFKTGFGGRIVHRAGCWDLPLSPLYGLYRTAERVREVYYKRVRKLFRR"
FT   gene            406484..407713
FT                   /locus_tag="STHERM_c03300"
FT   CDS_pept        406484..407713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01303"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPA9"
FT                   /protein_id="ADN01303.1"
FT                   /translation="MRFVRPLFLMLLCISSLSAITLSLKVFPQDALLLEDGRPLTPTGR
FT                   KETVAYYWLPAGDHLLELWAPGYHSKFLHLSLTKSVFIEEKLERKDSRLRLVGEFPTGR
FT                   QPKGIVFSPDGRFFYVTLLDDEGVEIFSADPLAYVGRASPPPYFAGQRGFVEGYILHGI
FT                   LWISQMTANRVHAFSLDGTYLFTSDRVGIWPKVIAGTHRGDLLFVSNWESNDIAFLDPV
FT                   SGRVVGRVPVSATPRGLAVTPDDRFLYVCNYDTGVLEKIDIPHQQVVKVIDWEFGAKRH
FT                   AVVDRQGRFLYLSDMYLGTITKFDLGSEAPVKERYIGPKLNTIALSPDGRYLFVSSRGH
FT                   NNPETYLKKGPDHGKVFVLDTRTLEVVDWVWGRNQPTGLAVSPDGRYLVFSDFLDHNIE
FT                   VYDVSRLRAE"
FT   gene            complement(407732..409111)
FT                   /locus_tag="STHERM_c03310"
FT   CDS_pept        complement(407732..409111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03310"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="D-glutamic acid-adding enzyme;
FT                   UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01304"
FT                   /db_xref="GOA:E0RPB0"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB0"
FT                   /protein_id="ADN01304.1"
FT                   /translation="MYSDVRSLLEGKKVLVMGLGAHGGGAAAARFCVEEGAIVTVTDLR
FT                   TEEELAPSLEALAGYDIRYVLGTHREEDFLEADVVIKNPAVPRTSRFLSLARHVETDIS
FT                   LFLKACRSPILAVTGSKGKSTTASALHHILSAAFPGARLGGNITTSPLTFLRELSEESP
FT                   VVLELSSWQLGDLGGRISFTPQVAALTNIYPDHQNAYASMEAYVEDKFWITATQDPSQT
FT                   FLYPASDPWGRWMAANTPATALPFFEERPTSPPPRAAFLTEQEGLFLDHGKEIPLLPER
FT                   LLVPGAHNRLNLLLAGAMAYTFGTDPALIRTRLSSFPGIPHRLELVREKGGVSFYNDSA
FT                   ATIPDAVLAAVSAFECPVHLITGGTDKNLDLSPYRGLAGMPVTIYLLEGSATRRLIPLL
FT                   HESGIPYLGPYRSLEEALAEAHHRASSGEVVLFSPGAASFEMFRHEFHRGEVFRDLVRR
FT                   L"
FT   gene            complement(409092..410048)
FT                   /locus_tag="STHERM_c03320"
FT   CDS_pept        complement(409092..410048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01305"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB1"
FT                   /protein_id="ADN01305.1"
FT                   /translation="MEVATQVLPLTWSDPEINAVLASASEAFPPVSRHFTQNEDFFLLL
FT                   PREFSVPHLPVHHDIREARPSREYLRRLLPVVRELVGICPGLFHGLTHLFDPASILRPA
FT                   FFRLYRMGEALYLYLLRIDLSYHPHDHTLVEQGTNDTTPSYRTRKLMLEADLIPLEDLH
FT                   TEEGRPRGFLIRQVISRTWIGETGRGYFVQGIWLDRDLSKFFSSVFLPEGARTYPYYPL
FT                   TCKYRSICLMPPSYDPASRKAYLPFLYRAQRILEPYVDEILEVLRKEKFSPDLPLVKEI
FT                   RSTVPREMIAQWEGISIARYLNEHQMREYRLDVQRRA"
FT   gene            410253..411302
FT                   /locus_tag="STHERM_c03330"
FT   CDS_pept        410253..411302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01306"
FT                   /db_xref="GOA:E0RPB2"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB2"
FT                   /protein_id="ADN01306.1"
FT                   /translation="MRSRILCVLFVHLMAMVLQAEAAVGVILYAEGGTFSLYRGQDALR
FT                   FDVGRNPVVGLAVRSGDLFQTDAESVLEVQVLGSQVMVKVGRNTTCEIRAEGEGVRLRV
FT                   AYGTVRVRTGAEAVPVVVEGRGARADFSEGDVVYRFVSSSEGMRITTTSVEVRAGSVRV
FT                   VPLAEGRTGEEVRVGPGERVEVAEEVDERGRIGITATKGRATVGGLPSLTFVHEPLSPD
FT                   LIARLFPHLETEGGAVQGSVVQREGRAIQSVSLDAAQESRMLTASDQVDIEAGLLEARR
FT                   QRAWGGALFLSGMFFTGLGVFVGYGEDVASPYWPYQDRPDLALSLFSVGGVAIVSGIVS
FT                   YIAGSSVSY"
FT   gene            complement(411296..412726)
FT                   /locus_tag="STHERM_c03340"
FT   CDS_pept        complement(411296..412726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01307"
FT                   /db_xref="GOA:E0RPB3"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB3"
FT                   /protein_id="ADN01307.1"
FT                   /translation="MPGNPQTPNSLVLPRRCSVNATTNRNTPHLTTIEGEEKLAIPTGI
FT                   VDYTPAVAKQYTLADRTCRLVIGNAVYPMTCEGLRMEEGQGYLVFRAARPIASLKEIAD
FT                   HPSPSHLPLLHQAGEALETLRAHDFPLPPAALEAIVLLDEGILVLNDDLLQLMREHRPP
FT                   AADHPLQEEIEDTSWSYTLAFLSYLCITGRSPFGSGTREERLFRRTRKRFPRISPAGET
FT                   ARPFIQWVHQALEGPDRLLLPMPAPPATTVGTVSFDPLEEARIHRAFRVHRFFRRYGAI
FT                   LGGGAAVLGLILLVLISTIQNANRPPATIGLDPLEVARLYYESINRIDPETLRDCLISD
FT                   DDPVYRELTHLFVIVRVRTAVERTLPLVSPEQWVEEGMPPLPEGTVLYGVADLRLSTLQ
FT                   ETSEQATVEAAYLRWTLEPGDPETGTPATSSPSRIEEILELVFLGDRWAIRQKKVIEET
FT                   PLSQEEALEALSARAPAQ"
FT   gene            complement(412653..413201)
FT                   /locus_tag="STHERM_c03350"
FT   CDS_pept        complement(412653..413201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01308"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB4"
FT                   /protein_id="ADN01308.1"
FT                   /translation="MRHTDEERKTLLSAAREVITAATEGRTPRLPEPPPRLLEPGGAFV
FT                   TLHKRGALRGCIGHILADRPLWEVVQEMAYESAFRDPRFPPVTGPEVPLLDIEISILSS
FT                   LFPIAPEEVEVGTHGLLIRKGWHSGLLLPQVPVEQGWDRETFLAHTCLKAGLPPDAWKS
FT                   PDAQLFGFTAEVFGERDYE"
FT   gene            complement(413188..414069)
FT                   /locus_tag="STHERM_c03360"
FT   CDS_pept        complement(413188..414069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03360"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01309"
FT                   /db_xref="GOA:E0RPB5"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB5"
FT                   /protein_id="ADN01309.1"
FT                   /translation="MDQGRNALTQTEELVREPIVEGIFYPDAADALEARLDALLSRPSP
FT                   ESPPPRPFALIVPHATWDYVGGLLGTAFAHVVPWREHFRRVVLWGPTHREPFPSLFLPA
FT                   STLFATPLGPLSLDLPATQEALASSTAFAVDDLSHMEEHCLEVVFPFLRSILPHAPILP
FT                   VLVGAPLFTLVETLARALYLIYAAEWEHTLFVVSTNLTPFAPRKDNARRAEELIHTLLS
FT                   TPSHTLLSRIRTQHNPEKPLLLIWPLLMLAEALELPLSFHLLGRETSPPEDGHTVEYAS
FT                   FLVTGGNDHETH"
FT   gene            complement(414133..415578)
FT                   /locus_tag="STHERM_c03370"
FT   CDS_pept        complement(414133..415578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03370"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01310"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB6"
FT                   /protein_id="ADN01310.1"
FT                   /translation="MSFNWKEVDYALKALSLRGALVQDIFQPDFMHLGLKLYLPGRPFT
FT                   LLFRMDQSGVAFFPLTTKLPRLPHPQRFTQFLRAHIRGGKITGAYQVGRERLIRIAVAR
FT                   EGTTTLVWIRLWATAPNIIVTDQEMTILDCMFRRPRRGEVSGERFDPWPQLMRTYEDED
FT                   PRFSVRFLDETSSSEEWFSRMEASYLETDRGARVEKLRVDLARLLERRITTLRATLTEL
FT                   TSRRERIRDAERYKEYGDLIITNLWQISRGQKWIEVEDYFRGGTVRIPLDPALGPQENA
FT                   ERYYREHRRLLQQEQNLAARMEEVSRDLTHHERLLEQIPSMGEEALEALSRTFQKEARV
FT                   REKDTEVPGLHVLSQGFLIIVGRNAKESDEVLRHHARGNDLWLHVRDWPGGHVIIRSQK
FT                   GKEIPHPVILDAAQLAIHFSKAKHEEVVDLYCTHVKYLRRAKHGTLGTVIPTREKNITV
FT                   RRDPARISSLLQREEAQEEPPST"
FT   gene            complement(415648..415728)
FT                   /locus_tag="STHERM_c03380"
FT   CDS_pept        complement(415648..415728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01311"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB7"
FT                   /protein_id="ADN01311.1"
FT                   /translation="MRYDLDRHESSCECMGFGISRIIRIN"
FT   gene            complement(415935..417374)
FT                   /locus_tag="STHERM_c03390"
FT   CDS_pept        complement(415935..417374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03390"
FT                   /product="folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="tetrahydrofolylpolyglutamate synthase;
FT                   tetrahydrofolate synthase;
FT                   folylpoly-gamma-glutamatesynthetase; FPGS"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01312"
FT                   /db_xref="GOA:E0RPB8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB8"
FT                   /protein_id="ADN01312.1"
FT                   /translation="MQLRLRTELLPAPIHPEVEEAFRYLERFANFERRPGEVRAFRLER
FT                   VRTLCGLFGHPEEGLAFAHVAGSKGKGSTCLFLARVLEESGFRTGLYTSPHLVSYTERI
FT                   SRAGRPWPPEVYLDALAFLRGRLEGTAEGRALLDEVTTFELLTVLGFLVFREMGCEWVV
FT                   LETGMGGRLDATNVVRPRVTVITHLELEHTEHLGETLEKIAFEKAGIIKPGVPVVVAPQ
FT                   EAGAWGVIEGRAREVGAGVVRVERGLGASAGGVGGEVRGAQAGGGAGGSPSEVVRWEGV
FT                   VRREGVGVCVEWEDGLVARSVLSTPLLVQAENAALAAAAWRVCVPEGKVGALEQGLAGA
FT                   VLPGRLQPVAEGPELWVDGSHTRDSVRAVVEALGRRYGWGEVVGVFGCVAGKDARGMLG
FT                   ELGRLCREVVVTRAGRFRESRPEEVGRVAEGVVRAVVVPEEEAALGEALRRAEGRRPIL
FT                   VTGSFYLAGEILTILSRWAAS"
FT   gene            complement(417319..418839)
FT                   /locus_tag="STHERM_c03400"
FT   CDS_pept        complement(417319..418839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03400"
FT                   /product="histidinol dehydrogenase 1"
FT                   /EC_number="1.1.1.23"
FT                   /note="HDH 1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01313"
FT                   /db_xref="GOA:E0RPB9"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPB9"
FT                   /protein_id="ADN01313.1"
FT                   /translation="MSHSRIGGSGGCPQSDRICTRSLRLLTERLPRLLTSHVPYVHTDL
FT                   PCRLVLTGERGACEHGGMADLKVNVYVWGDLSPEERRRLLSRSEEDIARLEEVVRPVVE
FT                   AVRTEGDAALIRFTKEFDGVVLSPERLRVSEEEFEAAEAALPEEIRESLDYVIENVERF
FT                   HRTQVPEPSPMREVRPGVMAGERATPVPSCGLYVPRGRGSFPSMVYMLAVPAHLAGVPR
FT                   VVMTTPPEKDGSVNPACLYAARRCGVHEVYRVGGAQAVAALAHGTESIAPVAMITGPGS
FT                   AYVAAAKRLVAHLVYTGLPAGPSESVILADESADPWKVAIDLLVEAEHGADSAALLVTP
FT                   SRELAGRVEAHLLSCIPRLPSPRREFVQAVFAGYGGIILVDSLEEGVEVVNEWAPEHLQ
FT                   VRTHDPFATLKRISYAGEVLLGEHAPFSLANYAAGPNAVLPTGGKAKVFSPVSVRDFLR
FT                   FSSVIHVTEEGLAELGPHVARLAEYEGFPAHAAAITYRATPGSYSPRG"
FT   gene            complement(419047..420111)
FT                   /locus_tag="STHERM_c03410"
FT   CDS_pept        complement(419047..420111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03410"
FT                   /product="homocitrate synthase 2"
FT                   /EC_number="2.3.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01314"
FT                   /db_xref="GOA:E0RPC0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC0"
FT                   /protein_id="ADN01314.1"
FT                   /translation="MRIGIVDTTLRDGEQAAGFAFSSEEKFLLARRLLDAGVDEVEVGF
FT                   AAVGRAEKVAIRRIVDGLPPQRVLGWNRALPRDVLESLSLGLVRLHVSVPVSDILIRIR
FT                   FGGDRGRVRSLLREAVLCAREKGGMVSVGAEDASRADLSFLVEIACVAEEVGAFRFRYA
FT                   DTTGTAAPWETYERISFLARHVKIPVELHMHNDLGLAVANTLSGIRAGASWVDTSICGM
FT                   GERAGLCPLEEVVVAIRVLTEGETSVDPSRLPGLASLLERITGVRMPPWKSVVGENAFS
FT                   HESGLHQKGVMRDPGTYEPFSPSLVGRVRRVLAGKHASREAFGEILASQGVRLPPPVED
FT                   LLFRIMKGEVGLEG"
FT   gene            complement(420108..420299)
FT                   /locus_tag="STHERM_c03420"
FT   CDS_pept        complement(420108..420299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01315"
FT                   /db_xref="GOA:E0RPC1"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC1"
FT                   /protein_id="ADN01315.1"
FT                   /translation="MIAGNIPGRTQTLSLGIYQEVMMGDAEFAGLYALILFVLATGITA
FT                   VVHVIEDRIAEPSGRGRG"
FT   gene            complement(420315..420800)
FT                   /locus_tag="STHERM_c03430"
FT   CDS_pept        complement(420315..420800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03430"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01316"
FT                   /db_xref="GOA:E0RPC2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC2"
FT                   /protein_id="ADN01316.1"
FT                   /translation="MDRMMLMDTIVLSLKIASIATGISLLAGVVLAQVFAGKRQRGVIL
FT                   VEVCISVPMFLPPAVTGYFLLLLLGSHGPIGGVLERWLGVEIVFTQAAAVIAAVMVTVP
FT                   IVFKSMKGHFESIEEDVLHAARMDGADEVLVLLLVKLPMAMRGLSSSVMLAFLRAMG"
FT   gene            complement(420804..421568)
FT                   /locus_tag="STHERM_c03440"
FT   CDS_pept        complement(420804..421568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03440"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01317"
FT                   /db_xref="GOA:E0RPC3"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC3"
FT                   /protein_id="ADN01317.1"
FT                   /translation="MRGRVATTLLVAALAVRGVSAESGGHVTIGAAAVFTDAVDELARS
FT                   WEDRSGVAVRITIGSSGALRAQIMQGAPIDVFLMGNEEEARELVKTGHADERWVTPLCR
FT                   NSLVVLVHTGHPVESPGSLACLLSPGMGRIAVPNLQTTASGKYLRRIFEHEGALYERVR
FT                   EKFFFAETVRQALLWFQMGNADAAIVFRSDVAGIEGVEVAHEILLVEGRPILQVCGLTR
FT                   RGLASTRAKDLYAFLTGREAGQILSRHGFIVE"
FT   gene            complement(421577..421882)
FT                   /locus_tag="STHERM_c03450"
FT   CDS_pept        complement(421577..421882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01318"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC4"
FT                   /protein_id="ADN01318.1"
FT                   /translation="MKRPERQILMCGGYRTGGGATGTCARRGSLPLAGYLQSAVEDRGM
FT                   GDVVVTLTGCMNLCEKGPVVVIQPDNLWYGGIEGEEDIDEILDALLEGRTVERLLL"
FT   gene            complement(421900..423171)
FT                   /gene="nifB"
FT                   /locus_tag="STHERM_c03460"
FT   CDS_pept        complement(421900..423171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="STHERM_c03460"
FT                   /product="FeMo cofactor biosynthesis protein NifB"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01319"
FT                   /db_xref="GOA:E0RPC5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC5"
FT                   /protein_id="ADN01319.1"
FT                   /translation="MPTSPCEECVMDTARHPCFDDEARSRYRRVHLPVAPRCNIQCHYC
FT                   NRKFDCVNESRPGVTSGLLDPDEACEVVDLLKERFPDLTVVGIAGPGDPFANPDETLST
FT                   LRGVRSRHPDLLLCVATNGLALPEYVEELADLRVSHVTVTVNAVHPEVGERIYPWVRYE
FT                   RRVRGGREAARLLIDRQQEAIVSLKAKGLVVKVNTIVIPGVNDTHVREVAKETAAWGAD
FT                   IINPIPLYPVEGTRFAHIGEPDPRFMSELRRDVARILPVMSHCVRCRADALGFLGEEGS
FT                   VMDLTKDHRVETRPPERIAVTTMEGMLINQHLGEAEEVYVYERGDQGYVFLERRETPER
FT                   GGGEERWRLLSRIIGDCEVLLTSGVGGNPSRILGEAGISVVVSGGLIQEVLDEVFRHGV
FT                   TSRVERPFWGCGPSCAGSGTGCGV"
FT   gene            complement(423152..424507)
FT                   /locus_tag="STHERM_c03470"
FT   CDS_pept        complement(423152..424507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03470"
FT                   /product="nitrogenase associated protein N"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01320"
FT                   /db_xref="GOA:E0RPC6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC6"
FT                   /protein_id="ADN01320.1"
FT                   /translation="MEASYRPTVNPCAQCAPLGATLVYRGIERCFPLLHGAQGCATYIR
FT                   RYLVGHFREPVDIASSSIHEDSVIFGGRDNFLTAVENVLQQYRPAVVGVATTCLAETIG
FT                   EDVSMFVHEYRRRQGGDEGPVFVLAPTPSYRGTHQDGFLTAIQASLAALVPGEGGGGHP
FT                   RTPYVNVLNTQLLSCEDLRFLKELFSQAGFTPIVFPDYSESLDGPAWTHYVGIPPGGTP
FT                   LFLMRRMGSALCTVEMGVFHGDDSPGRMLEDVHGVPLVSTGVPVGVCATDEWIGALERI
FT                   GTKALSERYRQVRGRVLDTYADGHKYVFGKRVMVYGEDELVYALARFCMEVGMIPAICA
FT                   TGRQTPGFRERLQVLGGDRDILVLSGASFDDMEMAAKDAGIDLLMGNSKGYKIARGLGV
FT                   PLVRVGFPIHDRLGGHRIRILGYEGTLSLFERVVNALIEREQERSPYAYFTM"
FT   gene            complement(424491..425444)
FT                   /gene="nifE"
FT                   /locus_tag="STHERM_c03480"
FT   CDS_pept        complement(424491..425444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="STHERM_c03480"
FT                   /product="nitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein NifE"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01321"
FT                   /db_xref="GOA:E0RPC7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC7"
FT                   /protein_id="ADN01321.1"
FT                   /translation="MPQGGTRERNTGLSRALGGIQGHQERWIPGRLRCALQDRLLGGER
FT                   PTLPCSINIIGEFNIAGETWLIRRYYEEMGIRVVSTITGDSSIEEIAQAGSAALNVVQC
FT                   SGSTTLLAKKMEERYAIPFIRVSYFGVEDTAEALYQVARFFEPSAPGMLTRTRELVASK
FT                   VSEVYAELERYRRDLEGSRAAIYVGGAFKAFSLIKALRLLGISTPVVGSQTGSREDYET
FT                   IAGICEEGTVILDDSNPAELAHFLKEKDVHLLIGGVKERPLSYKLGVAFCDHNHERKLP
FT                   LAGFEGMVNFAREVHASLMSPVWRLFREGVDHGSVL"
FT   gene            complement(425882..427264)
FT                   /locus_tag="STHERM_c03490"
FT   CDS_pept        complement(425882..427264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03490"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="dinitrogenase; nitrogenase component I"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01322"
FT                   /db_xref="GOA:E0RPC8"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC8"
FT                   /protein_id="ADN01322.1"
FT                   /translation="MLMRHTTEKIVERKNLVVNPVKTCQPIGAMYAALGIHRCMPHSHG
FT                   SQGCCAYHRSMLTRHYKEPVMATTSSFTEGASVFGGMGNLMDAIANIFSLYDPDVIAVH
FT                   TTCLSETIGDDIPQIVKKAKDNGLIPRGKHVFHANTPSYVGTHITGYASMVKAMVDYFA
FT                   VPSRKRSDQINLVPGFVDPPDMEELRRISSSFGVAVVMFPDTSGVLNTGLTGAFKMFPR
FT                   GGTRVSELVTAGEAIATLGLGRFAAGPAARALDAKCGVPCEVLDLPLGLAATDRFVMAL
FT                   SRHTGVPVPEDIAEERARVVDLVADMHQYLYGKRVAVAGDPDHLFPLVEFLLDLEMDVR
FT                   HIVTGMQSKKIERRMEELFREKAPDKRPNFAAPGDLFLLHQWIKNDPVDLIIGNTHTKY
FT                   IARDENIPSVRVGFPILDRVGHQYFPIVGYRGAVRLLEMILNAFLERVDATVPEESFEL
FT                   VM"
FT   gene            complement(427242..428912)
FT                   /locus_tag="STHERM_c03500"
FT   CDS_pept        complement(427242..428912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03500"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="dinitrogenase; nitrogenase component I"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01323"
FT                   /db_xref="GOA:E0RPC9"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPC9"
FT                   /protein_id="ADN01323.1"
FT                   /translation="MEGLERFDLEKIREEILERYPAKVARKRAKQVVINRKDPETGTPP
FT                   EIVANVRTIPGILTMRGCCYAGCKGVVLGPTRDILQITHGPIGCGFYSWLTRRNQTKPR
FT                   TEEDQNFLPYAFTTDLTENEIIFGGEKKLKAAIEEAIAAFHPKAIGIFATCPVGLIGDD
FT                   IHAVAKEMEEKYPEVNIFAFSCEGYKGVSQSAGHHIANNKLFTDVVGLNDEVKEGRFKV
FT                   NLLGEYNIGGDAFEVERLFERCGITLVSTFSGNSCYEDLTRAHTADLNLVMCHRSINYM
FT                   AEMMEKKYGIPWVKINFLGAAATAKSLRRIAAFFDDPELTARVEEVISEEMAEVEKVRE
FT                   EVYPRTEGKIAMLFVGGSRAHHYQALFEELGMRTVAAGYEFAHRDDYEGRRVLPYIKID
FT                   ADSRNIEELEVGPDPVRYRPRVTQEQAEKLKALGIEFMDYRGMMPEMDEESLVIDDLNA
FT                   YEAEVLIERIRPHIFCAGIKEKYVIQKFGLPMKQLHNYDYSGPYAGFKGAINFYREIDR
FT                   MVNSRIWQMVCPPWEKTAPLEGAYVKEREEESYAHATHD"
FT   gene            complement(428923..429300)
FT                   /locus_tag="STHERM_c03510"
FT   CDS_pept        complement(428923..429300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03510"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01324"
FT                   /db_xref="GOA:E0RPD0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD0"
FT                   /protein_id="ADN01324.1"
FT                   /translation="MKEILAVIRMNMMNRTKEALSEAGVASLTATECLGRGKGLVDFKV
FT                   LKGAEQGYEEAIAQLGSGQRLIPKRLLIMVVPNRLVPKVVKTLISVNRTGKPGDGKIFV
FT                   LPVEDAVRIRTGENGDGVLDD"
FT   gene            complement(429297..429653)
FT                   /locus_tag="STHERM_c03520"
FT   CDS_pept        complement(429297..429653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03520"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01325"
FT                   /db_xref="GOA:E0RPD1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD1"
FT                   /protein_id="ADN01325.1"
FT                   /translation="MVMIKAIVRPEKVDNVLEELMAAGFPAVTKLSVHGRGKQRGIKIG
FT                   NVVYDELPKELLLIAVKDSERDLVIKTIIRAARTGDKGAFGDGKIFVAPLEEAYTISSA
FT                   IRELPDGRVEEVKL"
FT   gene            complement(429672..430496)
FT                   /locus_tag="STHERM_c03530"
FT   CDS_pept        complement(429672..430496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03530"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="nitrogenase reductase; nitrogenase Fe protein;
FT                   nitrogenase component II"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01326"
FT                   /db_xref="GOA:E0RPD2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD2"
FT                   /protein_id="ADN01326.1"
FT                   /translation="MRKVAIYGKGGIGKSTTTQNTVAALSEMGKKVMVVGCDPKADSTR
FT                   LLLGGLHQETVLDTLRMEGEDVELEDIRKIGFKGTICIESGGPEPGVGCAGRGIITSIN
FT                   LLEQLGAFSESVGLDYVFYDVLGDVVCGGFAMPIREGKANEIYIVVSGEMMAMYAANNI
FT                   CKGIVKFAEAGGVRLGGLICNSRKVEREEDLIKALAERLGTQMIHFLPRDNMVQKAEIN
FT                   RMTVVEYAPDHPQAEEYRTLAKKIEENTMFVIPKPLRNDELEELLIKYGIMN"
FT   gene            430648..430791
FT                   /locus_tag="STHERM_c03540"
FT   CDS_pept        430648..430791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01327"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD3"
FT                   /protein_id="ADN01327.1"
FT                   /translation="MILHLCTIKGCFLLSRGKMGSEVFLSVPGSYIEVVPAFLWGVSLI
FT                   GL"
FT   gene            431328..431663
FT                   /locus_tag="STHERM_c03550"
FT   CDS_pept        431328..431663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01328"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD4"
FT                   /protein_id="ADN01328.1"
FT                   /translation="MKRHVILGVCVLFSLTQMSASDEKIGFLLYGPDFMISIPLPSYWE
FT                   VDMEFAHRNRIDGFFFIKEAGIRNSPVGIMVVLARKPNEEATLQDYIEYDKRKLMGYYP
FT                   NYVLKNS"
FT   gene            complement(432171..434234)
FT                   /locus_tag="STHERM_c03560"
FT   CDS_pept        complement(432171..434234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01329"
FT                   /db_xref="GOA:E0RPD5"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD5"
FT                   /protein_id="ADN01329.1"
FT                   /translation="MAARRLPRALKRPLTPKALSSMTRFLEIPADREFFSSCFTETDGR
FT                   FLLRGDLTPGERERLARLHREIKANRRLISAGPLILLGLLAGVILVFTLFLAGPLLERS
FT                   LERGLELAFGAQAEVTGLRLSPFSLRLTIAHVEVADRSSPMHNLFEAGPVEVWLDPEAL
FT                   LWGSLTVKTLRLEGLAFGTARTEPGDLPAQEGAEQEEAASPSPPSEGGPDPASVLAAVL
FT                   DPSALDVEALLSREADRLQVVAARREVEALIREAPRSFEADLDRLSRRLRDLTSRVKEL
FT                   TRTNPSRISDPAALTALVSDAEPLTKEASLLYDEAGALSRAIEDRISRARALERQLRGA
FT                   VEHDSAYLSSFLRPDGEAIARLLSEVTASILKDEARTYLAYARKGVEACLTLARRREGS
FT                   PGHRREAPTGRVVHFPVKRRPGFWLRHLSGSGILPGGTLSLELTDLTSHPSLIHTPLTL
FT                   RLSYTGSPRVGAQGTLDLSKDEPTYTLSLEAEGLELRDRSFPLFGALSATGSASFRASG
FT                   TYPRTLTAGGSLSLAGPHLAPTGGPGHLVAPLLEGEESLSLTVSYRKQDQEESLEVTSP
FT                   LFSSLAERLARALDTQKSELASRIEEELEARIRDSLAALSGETTRLDDLSRRSEALRAG
FT                   AQGLREDLESHRRALEDRISRLRQELLEEKTDEVKEKASELLKDAAGSLLGR"
FT   gene            complement(434243..434779)
FT                   /locus_tag="STHERM_c03570"
FT   CDS_pept        complement(434243..434779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01330"
FT                   /db_xref="GOA:E0RPD6"
FT                   /db_xref="InterPro:IPR019935"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD6"
FT                   /protein_id="ADN01330.1"
FT                   /translation="MVKALARIIVALNTNVRKEHIAAGIAWGLLLGCIPAGNLLWILLF
FT                   LFSLILVHNHAAKLLVLALVKLALPLLTPLTDAVGWAVLTHPALVSVWTSLYNLPLVPL
FT                   FRFNHTLVMGGLTLGTLLWPPVFFLFRFLVDRYRTHMAQRLVQSRWYKALLRIPFVARL
FT                   KEAIEKTSRILHLVH"
FT   gene            434884..435624
FT                   /locus_tag="STHERM_c03580"
FT   CDS_pept        434884..435624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03580"
FT                   /product="HTH DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01331"
FT                   /db_xref="GOA:E0RPD7"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD7"
FT                   /protein_id="ADN01331.1"
FT                   /translation="MADRIDYTIHGDEMQLVEVVLDPGEGVRAEAGAMLYMEEGIAMDT
FT                   RMEGGLLGGFKRILAGESFFITNFVNTGSRRAAVAFAAPYPGKIVPLDLGALGGRFVCQ
FT                   KDAFLCAAAGIEIDVVFTRRLGAGFFGGEGFILQELSGDGWAFIHAGGTIVEKRLAPGQ
FT                   TLRVDTGCFVGCSPTVDYDVRFVGGFRNALFGGEGLFLTELTGPGVVYLQSLPLARLAD
FT                   RILAGQVQRKGEGGPGMMGSFFGE"
FT   gene            435679..437400
FT                   /locus_tag="STHERM_c03590"
FT   CDS_pept        435679..437400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03590"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01332"
FT                   /db_xref="GOA:E0RPD8"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD8"
FT                   /protein_id="ADN01332.1"
FT                   /translation="MQRAEALKEILRRIDGAGYKAYKDIEGAYDFDDFVLVIDHVQGDP
FT                   FAAPSRVRVRIPQRVAGFPEAAYRPKSREIALRDYITRVFAREAGRFQRPRATGKSGVI
FT                   SIDRPGQEILERTSCFVNDREVELRFTVGLPAFGRRIAGRIAQEMFFEDIPALVRRAGL
FT                   YRSIQGRSLVEHLKTNEDADALRAELSKAGIVAFVADGAILPRESGVSQKPLSAGTVVP
FT                   FESPPSLRLEFTLPNRGKITGMGIPHGVTLIVGGGYHGKSTLLNALEMGVYNHIPGDGR
FT                   EFCVTIPEAVKIRAEDGRRIEKVDISPFISHLPFGKDTTSFSTEDASGSTSQAANIIEA
FT                   LEAGARLLFIDEDTSATNFMIRDHRMQELVSKDHEPITPFIDKVRLLLRDYGVSTVMVI
FT                   GGSGDYFDVADRVVCLIEYRPYEVTAKAKEIAQRYRTDRRPEGGDRFGRITPRAPLSES
FT                   FDPSKGKREVKISPKGLTSIHFGTHEIDLGAVEQLASVSQTRAIGDAIYYATRYMDGRR
FT                   ALAEILDRVMEDVAREGLDVLSPFPVGDYAAFRRFELAAAIDRLRTLKVRQLRESS"
FT   gene            complement(437379..440153)
FT                   /locus_tag="STHERM_c03600"
FT   CDS_pept        complement(437379..440153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03600"
FT                   /product="probable ammonia permease with sensory box/GGDEF
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01333"
FT                   /db_xref="GOA:E0RPD9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPD9"
FT                   /protein_id="ADN01333.1"
FT                   /translation="MEPNVGDLLWITVAAGLVFLMQAGFAMLEAGFTRSKNSINVAIKN
FT                   LADVGISSVGFWAVGFGLMFGTTWQGLTGRDHFLFLPNEGLAGVWEAAFFLFQLMFAAT
FT                   CTTIVSGAVAERMRFAAYLVVSTVITVVVYPVFGHWAWGGALFGSPEGWLVRRGFVDFA
FT                   GSTVVHSMGGWVALAAVLIIGPRKGRFEEGARMQGSNIPIAVLGALLLWLGWFGFNGGS
FT                   TLALDDQVPGIILRTSLAGAAGLMAAMAAGWVLTGRADVSHVINGSIAGLVAITANCHA
FT                   VTEAEALIIGAVGGLVMLGSLRLLERLRIDDVVGAIPVHLAAGIWGTLAVGLFGDPALL
FT                   GTGLSFWEQVGVQTLGVAVAGVWGFGVSYLLLRLIDRFFPLRVPPEAEEMGLNVAEHGA
FT                   TTELYDLFTTLTEQARTGDLSLRVPEDPFTEVGQIARAYNRVMDRLQETTVDRDEYVRL
FT                   LSVMRTGLCVIDRDGRIAPHYSRAFLEIFELSEEEAARLTFLDILKSRVPERTYTSVSE
FT                   FLEVMWAPHVDEEVARSLSPFRELDLFCPHGHRFTHKVIRAEVQRIWGGEAITHLLFVI
FT                   EDITEQALLERELQEKERRTASEMEMFYHILHTHPVILDQFLQSVEEDLTTIAEICERE
FT                   SDDPERALSLIYRYVHSIKGDAYAVGLDPIGETAHQIEEHILQMRESGTCSEEALVDLG
FT                   VKMGEIRTLLERALSLKERLLAFHRESAEAPTSDPIVFAVERFLERIRAEEGKRVRVDF
FT                   SAYHREEIPLEIYKPVKDMVLQCVRNAVAHGIEDEAEREARGKPAEGCIRISTSREEEV
FT                   LRIIVEDDGRGMDLARLRARLLERGLIAPDAPPREVLRALFTHGASSRDEADALAGRGA
FT                   GLPLVGTLVRRLGGRIALTSTPGRGTRIVISLPRSPASHIPTSGIQDQELSRS"
FT   gene            complement(440195..440650)
FT                   /locus_tag="STHERM_c03610"
FT   CDS_pept        complement(440195..440650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01334"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPE0"
FT                   /protein_id="ADN01334.1"
FT                   /translation="MTKEELKAVVDCTTRYFSTVTPHPATIGVPFIKRKEQAFFLDYTG
FT                   MIGISGSRKGGIYLTASGGMLWNLGHLILSEEVMEEELLMDIAGEVANTVAGNLREAFG
FT                   PEFMISVPLVVRGVPDDLLIHVQSPVYIIPILWEGFQSFLGVGLDPA"
FT   gene            complement(440647..441015)
FT                   /gene="cheY1"
FT                   /locus_tag="STHERM_c03620"
FT   CDS_pept        complement(440647..441015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY1"
FT                   /locus_tag="STHERM_c03620"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01335"
FT                   /db_xref="GOA:E0RPM1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM1"
FT                   /protein_id="ADN01335.1"
FT                   /translation="MKKALVVDDSRTIRNLLAGILEEMGIEVAGFAADGEEAIVAFQRI
FT                   RPDLVTLDITMPRADGLLCLERMKQLDPRTAIVIISALSDERTALTALKKGAAGFIKKP
FT                   FTPEEVKRTLSHVLEVTA"
FT   gene            complement(441250..441726)
FT                   /locus_tag="STHERM_c03630"
FT   CDS_pept        complement(441250..441726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03630"
FT                   /product="automatic annotation"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01336"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM2"
FT                   /protein_id="ADN01336.1"
FT                   /translation="MGPGGRLRPPMEHITRGGTMKSYRKELWFNTPSRVAFINITPQIE
FT                   EAVRESGVKEGLCLVNAMHITASVFINDDEPGLHQDYRDWLEELAPHEPTSRYRHNRTG
FT                   EDNGDAHLKRQIMGREVVVAITDGRLDFGPWEQIFYGEFDGRRPKRVLVKIIGE"
FT   gene            complement(441763..443109)
FT                   /locus_tag="STHERM_c03640"
FT   CDS_pept        complement(441763..443109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01337"
FT                   /db_xref="GOA:E0RPM3"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM3"
FT                   /protein_id="ADN01337.1"
FT                   /translation="MTLPWLAVTAGILLLVASTLLVVRKARRRRGKVLLERILSPRGSD
FT                   DTGPPILRDMLFALEEAYTRQEPAPAVFFLSDDMQDQLQVDVFLDRLLGRRTSFSNTRI
FT                   LGSTLLERKREGDTERSFWIMDLSRKVQRTDASTSSLLLESSRTIWSLHKHVAAPDQIP
FT                   GAGGRCPSCKTPLPERPHSPRCPYCEAALNSGRYGWTLTRLHAPLTFAQHTLLSPRSTH
FT                   SPLLEAALRRTILHTILPEAFPTTNTLPCLPGARTRLLQMIRPAHTSPICLTVNDVQVL
FT                   ASLSPRTRHALLTLTFQRAILDGPAVEDLLDPFPLTRHLLLHIDEPSSTVTGVELPEAG
FT                   HPFLATRLTTLYTPSLDAVLLLAGVLLAEGRNPSRIMEHLEPLPIPPHLRTLLLYHLPL
FT                   AAQGHTGIPLPLTPAARRATLTALQRLANRLSPPPSPVLLSYLRDLLED"
FT   gene            complement(443106..443807)
FT                   /locus_tag="STHERM_c03650"
FT   CDS_pept        complement(443106..443807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01338"
FT                   /db_xref="GOA:E0RPM4"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM4"
FT                   /protein_id="ADN01338.1"
FT                   /translation="MLYTFIVGLGVIPLPPLSLPFESLDTARVLFFSFPSLIAGFVAGR
FT                   TRRRRARTLRRATIGHSSPVAEGSGLQRWVLHVRYKNLLQLSPEEADRTLVHLQDLWND
FT                   LFIEYPHLVVSFRGDEGWIVGTTPVLEACRIAVRLSEGYEGAIPPSMGLHRGDARLLAP
FT                   SPTLPPLVVGEASRTAHLLSDAAVGGKLLISPSIYHEVKEQVVVEGPRHIRPQPGVHKT
FT                   AYVFTSFKEDT"
FT   gene            443932..444276
FT                   /locus_tag="STHERM_c03660"
FT   CDS_pept        443932..444276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03660"
FT                   /product="HIT-like protein tag-202"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01339"
FT                   /db_xref="GOA:E0RPM5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM5"
FT                   /protein_id="ADN01339.1"
FT                   /translation="MGDTIFDKIVRKEIPSDVVFEDEVALAFRDINPQAPVHVLVLPKR
FT                   RAATLTEFTEQDPSYLGEFLKRVSMVAKQLGLEENGFRVVINQGRHGQQSVAYLHVHIL
FT                   GGRQMEWPPG"
FT   gene            complement(444333..444420)
FT                   /gene="trnL1"
FT                   /locus_tag="STHERM_c03670"
FT                   /note="tRNA-Leu-GAG"
FT   tRNA            complement(444333..444420)
FT                   /gene="trnL1"
FT                   /locus_tag="STHERM_c03670"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   gene            complement(444493..445761)
FT                   /locus_tag="STHERM_c03680"
FT   CDS_pept        complement(444493..445761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03680"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01340"
FT                   /db_xref="GOA:E0RPM6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM6"
FT                   /protein_id="ADN01340.1"
FT                   /translation="MEVSVQPGRLSGHIPVPPSKSHTIRALLVAAAAGGTSRIRSPLFS
FT                   RDTRACMRAVSLLGAVVREEGADLLVEGTGGRFSVPEDVIDVENSGTTLYLAGAMAALI
FT                   EGGRAVFTGDAQLRRRTAGPLLASLQDLGARAESTRGNGCAPLVIGGPLRGGSTSIACP
FT                   TSQYLSALLLACPLGKGESLVEVVELNEHPYIDMTLWWLKAQGVALEREGYDRFRIPGG
FT                   QSYRAFDLTIPGDYSSATFFLCAAAVTGSTLTLTNLYPDDPQGDREVLEILERMGCRVE
FT                   VSPEERAVRITGGSLSATEVDMTRIPDALPALAVTACYAEGTTRLYNAAHTRLKETDRI
FT                   AVMAQELSRLGARVEELPDGLLIHGPCPLTGGIASSHDDHRVAMALAVGALAARAPVTI
FT                   EGAEAAEVTFPEFFSLLEAHRTG"
FT   gene            complement(445771..446781)
FT                   /locus_tag="STHERM_c03690"
FT   CDS_pept        complement(445771..446781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03690"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01341"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM7"
FT                   /protein_id="ADN01341.1"
FT                   /translation="MSREETRDTTILHLPAELFNAVSVGLLILTEEWKVRAWNHRMQEF
FT                   TGIEEERVVGRDLREFLPEFKKEKYQVLLSIVFTDGAPVILSPQLHRKLYVPAPIYPEA
FT                   PLQERFFFTTIAPASLEGLPCAVFTVQDVTDLVKRIQLYKEMKDRALVEIERRKRVEEQ
FT                   LLAINKKLERSARTDPLTGLGNRREMEERLDAEIGRALRTGSPFSIIMADIDNFKTFND
FT                   TYGHDCGDYILVKLAQLFKQSLRRQDSISRWGGEEFLILLPDTRKEGALVVAEKLRNRV
FT                   GETPFLFAGKEHNVTLTFGVSTFDETSHTVYEYIKRADQALLVGKASGKNCVRFL"
FT   gene            complement(446778..447398)
FT                   /gene="cheC1"
FT                   /locus_tag="STHERM_c03700"
FT   CDS_pept        complement(446778..447398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheC1"
FT                   /locus_tag="STHERM_c03700"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01342"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM8"
FT                   /protein_id="ADN01342.1"
FT                   /translation="MKISEVHLDYLKELMNMGVGRAARVLGSLLNAPIELKVPEIYIYT
FT                   KAEILKEFSAFPGDRISSVLLPFDGVFTGLAFLLFPPQSAQHLISLLVQEMDEDEDLDE
FT                   IRAGTLSEIGNIVLNSIMGTFSNFFSSHIHYTVPSYTESRPEELFQHYTKAHKEYSFLL
FT                   ARTRFTVSSLNIEGDIVILMEVTPFQHLLKEIDAHYESIVRKK"
FT   gene            complement(447395..447754)
FT                   /locus_tag="STHERM_c03710"
FT   CDS_pept        complement(447395..447754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03710"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01343"
FT                   /db_xref="GOA:E0RPM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPM9"
FT                   /protein_id="ADN01343.1"
FT                   /translation="MAKTVLVVDDALLARKIARKILEKEGYQVEEAEGGQEAISMLEAQ
FT                   RPDVLLLDLLMPGMDGIQVLEELAKRRVSVPTIVVSADTQESTKQRCIQLGAKVFLNKP
FT                   LTEEELKKALQEVSQ"
FT   gene            447889..449016
FT                   /locus_tag="STHERM_c03720"
FT   CDS_pept        447889..449016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01344"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN0"
FT                   /protein_id="ADN01344.1"
FT                   /translation="MKLSKGMRVGVSILAAAMVLSGAPHVDDRWGFIVDPPEGWQLSPS
FT                   EKGVSVTDPYRVASFQVAAFPGRRFSSAVDMGEAFFSSLEAEGDVSAFAPYGGMQAILA
FT                   DAAFPVESGTVRGYFVFINGEEADYILMAYAPEDVYETYHDFLLSAIDSFAPSGDWYLY
FT                   PGPIGQFYYPVEGPSRTRVDVPFEGGTLAFLLDPGEEDAAQVLIEREARVLLAYGDPPS
FT                   VEAWRRYYRMVVRDEYPRFREVSAKLSERMGGGAGDVPSRLLSWFQGFAFERTGTLSDL
FT                   RAPISAVRRHAGDCDALALAYLIILHHLGYDGILMVSSVYRHAMAAVDVPGDGARFPFN
FT                   DHTYLVAELTDDVPMGMIAQDMSTVEHWIGVDLFP"
FT   gene            449153..449854
FT                   /locus_tag="STHERM_c03730"
FT   CDS_pept        449153..449854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01345"
FT                   /db_xref="GOA:E0RPN1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN1"
FT                   /protein_id="ADN01345.1"
FT                   /translation="MLDEYPPILTTEEVARILRLSERTVLKFAREGTIPAMKVGGQFRF
FT                   SRDKLAEWIERQMAGGEFALWERLPQWHGGVAELLSPECVLTGFSATREEEAFQKMVDA
FT                   AFRAGRVKDPEELVRLVLIRERQCSTVMRPGVAFPHPRAVGPEVVPEYALVLAISPEGV
FT                   PFSDAPGDGDVHFIVLFAIPSLQLHLKILAALGELFSHEEVQERLLSARSPQEVISYIT
FT                   SYEKEREKDDV"
FT   gene            449844..450299
FT                   /locus_tag="STHERM_c03740"
FT   CDS_pept        449844..450299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01346"
FT                   /db_xref="GOA:E0RPN2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN2"
FT                   /protein_id="ADN01346.1"
FT                   /translation="MTFSTYLSHDRVVFLSARSKDEALKALVSRLAGAVSPFEPDDLLE
FT                   RLHEREGLMSTGIGLGIGVPHLRYKGVKEPCIVIGLQPQGIEDYESMDGEPVKILVLIL
FT                   VGEGQHREYLRILSGVVKALKREEVRKALLSARSPEEVVDILKREDV"
FT   gene            450299..451972
FT                   /locus_tag="STHERM_c03750"
FT   CDS_pept        450299..451972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03750"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01347"
FT                   /db_xref="GOA:E0RPN3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN3"
FT                   /protein_id="ADN01347.1"
FT                   /translation="MEVFHDLFSRISVEQLNVLLLLGVVLFGGTIGSVYFKKARIPQVI
FT                   AYILLGILVGKSGLRLFSEDFLSSFEPFNYLALGLISFALGGELDLSLLKKHGKVLTWV
FT                   LFLEAFGAFIMVGIGFFLLGRLFFDPATSLVIALLAGSISSATAAAGTTDVVWEYRAKG
FT                   VLTTTLLGVIALDDVLALLLFAVTSSISFALMGVSTNVLATIGRPLYEIGGASLVGWGA
FT                   AWLLSRQLSRYTEEERIFVFTTGMVVLVLGLSLALDLDMLMAATVMGFALRQYAPRKTE
FT                   VILRLLEKFAGPIYLLFFVFVGASLEVASISLSALVFIAAFLLFRIGGKTVGTRMGAWI
FT                   SGAPEKVGRYLPLCLLSQSGVAIGLSLIAYQRFPGTIGQTILVVVTTTVFVVQLVGPAL
FT                   VKVALEKAGEAGLNVTEEDILTRHSVADVLPADRAVVPNTIRLSELLRLYAEHDWNVWA
FT                   VVDAEGRYRGVVGFENLREALAEPELQEFVIAEDILTPFPETVHPHTPLHEALRIMRRR
FT                   NVDFLPVLDDRGHVLGILEERMVRHFVRRELLSAQARTGL"
FT   gene            452094..453080
FT                   /locus_tag="STHERM_c03760"
FT   CDS_pept        452094..453080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01348"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN4"
FT                   /protein_id="ADN01348.1"
FT                   /translation="MAHRRGEGTKTTRFFDLMNLLSSAPRSRRELAERLGVSFSTITRY
FT                   LQDLERMGYPLEYGRGSRGEALVSLKKVELPFSREEIVWLYNAALLMAAHLDRECALAA
FT                   GMLAKIAERLTVAPSWFRALLREEADRMRSRRPSSPPVDEIFNTVSRAWLEGTMIELTY
FT                   QAPHKQEKTYLCGILGIRPNLVGRSYYLITWCPELNDLRTFRVDRIRRVRQQGLTRFEP
FT                   PPGIDLTVRLSSAWNVWWGDKEEEVVLRFSRDVAYRVMETQWHEHEEKAPQPDGSIIWR
FT                   ARISEPREMLPWIRGWGKDVEVLSPPWLRTHLAEEAKAMYELYWGKK"
FT   gene            453219..455528
FT                   /locus_tag="STHERM_c03770"
FT   CDS_pept        453219..455528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01349"
FT                   /db_xref="GOA:E0RPN5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN5"
FT                   /protein_id="ADN01349.1"
FT                   /translation="MFYAHSRPDLPKDKWQTLEEHLAEVGSLAGMFARKWDAEVLGVIA
FT                   GRYHDLGKAQDDFLKRLEGSSTPVDHSTPGALFVKEQFSQRGKDFEPLGMFLAYPIAGH
FT                   HTGLPNGRDASDHNLFTRLQKTSPLPPHNLQQVAHLLDISEDALAHQIERLKRDLGRYL
FT                   SKTPPDLTRAGMYLYLFVKMIYSALVDADFLDTERFMDPERSRLRGAYPPIERLHARFF
FT                   DSMERFLEERTSHPSPVDAIRGEIYRACLDAAREPQGFFSLTVPTGGGKTLSSFAFALT
FT                   HALTHHLERVIYVLPYTSIIEQNADVLRRFVGDDAIIEHHSNYESKEEVHGGVASSDTY
FT                   SEAELKRQLATENWDAPVIVTTSVQFFESLFSHRTSKNKKLHNIARSVVIFDEAQTIPR
FT                   EHLLPILRALEVLVHHFGVTVVFCTATQPALNKRNDFDGIEGVREIIPDPHDLARRMER
FT                   VHPQYVGLLSYETLVDSLAEESQVLCIVDTRKKARNLFSCLASRISEGRFHLSAAMCPT
FT                   HRSEVLRRIRETLSQGKSCRVVTTQLIEAGVDVDFPVVYRSIAGIDSLAQAAGRCNREG
FT                   KLEKGRLLVFELEGEDVPNIGDFRPRAEVAREVIRKVLRNGREDDHFLSLRSVREFFEH
FT                   FLWRMSHALDKRGITEKLKGVLRDIDIPYEDIGKGFHIIDEPVISLYIPYDERATSLLR
FT                   TLRTEGPSSRVMRSLQRYVVQVHDKAFQKYGEMGVVEEVYEGFFALTEWGREHFYDAEM
FT                   GLLPPTDTLRAEDLIV"
FT   gene            455565..456203
FT                   /locus_tag="STHERM_c03780"
FT   CDS_pept        455565..456203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03780"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01350"
FT                   /db_xref="GOA:E0RPN6"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN6"
FT                   /protein_id="ADN01350.1"
FT                   /translation="MYGVALKVWGPLACFTRPEMKVERVSYDVMTPSAARGILEAIYWK
FT                   PVIVWRIDRIHVLKPIRFVSIMRNEVGCKMSHTSPRLFVEDKREQRHSLMLRDVAYIIE
FT                   AHFELTALAGKDDPHDKEPEKHREIFMRRAQKGQCYHRPYLGTRECVADFEWIEPPFPP
FT                   TELPEEDRHKDLGWMLYDIDFEHNKESLFFRARLENGVLHVPPKEEVVR"
FT   gene            complement(456584..456802)
FT                   /locus_tag="STHERM_c03790"
FT   CDS_pept        complement(456584..456802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01351"
FT                   /db_xref="GOA:E0RPN7"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN7"
FT                   /protein_id="ADN01351.1"
FT                   /translation="MTIRDKLTLSCDKAPSFLRFRSFFMSIYEGYKIAYSFFFMKILFF
FT                   SLKAKDHIRSTNKILFVGKGFSITEYS"
FT   gene            458002..458877
FT                   /locus_tag="STHERM_c03800"
FT   CDS_pept        458002..458877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03800"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01352"
FT                   /db_xref="GOA:E0RPN8"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN8"
FT                   /protein_id="ADN01352.1"
FT                   /translation="MAITNRYDFLYIFDVENGNPNGDPDAGNMPRIDPETNLGWVTDVC
FT                   LKRKVRNYVLIKHKDTPPYKIYVKEKAILNLLHKEALEEVGADLSSDKGRKGSREEVEK
FT                   ARKWMCEHYYDVRTFGAVMSTTYDCGQVRGPVQFSFARSVDPITPVEVSITRMAVTREE
FT                   DAEKQQGDNRTMGRKHVVPYGLYVARGFVSAPLSQDTGFSDADLELLWEALCNMFEHDR
FT                   SAARGVMSARKLIVFKHQSELGNAPAQKLFGAVSISRKDETAPPRSFEDYTISLNREVV
FT                   PKEVEIIEML"
FT   gene            458952..459590
FT                   /locus_tag="STHERM_c03810"
FT   CDS_pept        458952..459590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01353"
FT                   /db_xref="GOA:E0RPN9"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPN9"
FT                   /protein_id="ADN01353.1"
FT                   /translation="MFREEDLIPISSLQHYIFCPRQCALILVEQLWEENYFTAEGRVLH
FT                   TRVHAGHVRLREEGVQVCSMPVRSLTYGIYGVCDVVVINDYEYLPVEYKRGRPKTHHAD
FT                   EVQLCAQVLCVEEMKDIHISKAYLYYYKIRHRVLVEISDELRAMTKETIENVHALIAAQ
FT                   KVPPPVNDKTRCTRCSLKSVCLPSVSGKKRVEAYLASILEEERDKEGGS"
FT   gene            459587..460621
FT                   /locus_tag="STHERM_c03820"
FT   CDS_pept        459587..460621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01354"
FT                   /db_xref="GOA:E0RPP0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP0"
FT                   /protein_id="ADN01354.1"
FT                   /translation="MKRLLNTLFITTEKLYLKKDHECVAVFQKKRLLTRIPLIQLSQIV
FT                   CFGNVLVSPFLLGHCGKNGISVSFFSRNGRFLARATGPTRGNVLLRREQYRIADSEERS
FT                   LPIVRAVILAKIHNSRRVLQRAFQDHGEKIADPKGFQRAIGLLQRLKERVAQIPTIEEV
FT                   RGIEGDASRLYFTLFDQCITSQKADFFFHERSRRPPLDRMNAILSFLYTLLYCDMISAL
FT                   EGVGLDPAVGFLHKDRSGRASLALDLIEELRAYLGDRIALSLVNLGQIKAEDFELLDNG
FT                   AVFLTEKGRKKVLTAYQQRKQEEITHLFLGEKIPIGLLFYVQGLLLARYIRGDLDGYPA
FT                   FFWK"
FT   gene            460643..460930
FT                   /locus_tag="STHERM_c03830"
FT   CDS_pept        460643..460930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03830"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01355"
FT                   /db_xref="GOA:E0RPP1"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP1"
FT                   /protein_id="ADN01355.1"
FT                   /translation="MMVVVSYDVGQDEGGQKRLRKMAKLCEGFGQRVQYSVFECLVDPA
FT                   QWVNLKAHISSIINPEYDSVRFYFLGANWKRRVESLGKQRSFEPDEPMII"
FT   gene            462617..462877
FT                   /locus_tag="STHERM_c03840"
FT   CDS_pept        462617..462877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01356"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP2"
FT                   /protein_id="ADN01356.1"
FT                   /translation="MLDAENPQRGCHGSIGHRAVFPLLVKNESGDIISGENLCDLLVEA
FT                   SREQGGTRSIVTLGPFRHGVRRYPLWVNISEYIIDQEGVWA"
FT   gene            462868..463425
FT                   /locus_tag="STHERM_c03850"
FT   CDS_pept        462868..463425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03850"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01357"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP3"
FT                   /protein_id="ADN01357.1"
FT                   /translation="MGLSRSFEPWNLFVGVLLSSEVYALDVQRVLEMEWGPVDFVSDLM
FT                   PFRYTSYYDKEMGGGILRWFLSFERLVDPSRLWEFKVRSNELEDRWREGGRRNVNLDPG
FT                   LLNLSRVVLASTKDHAHRIPLQEGIYAEVTLVYREKRFSTLPWTYPDYRSREYQEVFKR
FT                   MRRLYVEKRRMWLKQGGGEAGG"
FT   gene            463443..464171
FT                   /locus_tag="STHERM_c03860"
FT   CDS_pept        463443..464171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01358"
FT                   /db_xref="GOA:E0RPP4"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP4"
FT                   /protein_id="ADN01358.1"
FT                   /translation="MEAGVKRWWVVICWVGVVGGCGAPLVVMRVVLPEVPAGWGEWGME
FT                   WRLVWSGGEGGVVEGVRPGEVVEVVVERGMVWVWVLEGVVRGWEGVVRPAGGVVLWGEG
FT                   REGVVSWEDGAACSLLYELQAGGFPLEEFNVRRFVEEVRVRLEDPWELDRERAREAIIG
FT                   RDISVYDIACKEVFDVTLAFPPGIWRSGNPMRATEVLSGTCTVKLCSGIHHFLDEEAAS
FT                   LFCVYVDERGRAQGFLSPLD"
FT   gene            complement(464189..466618)
FT                   /locus_tag="STHERM_c03870"
FT   CDS_pept        complement(464189..466618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03870"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01359"
FT                   /db_xref="GOA:E0RPP5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP5"
FT                   /protein_id="ADN01359.1"
FT                   /translation="MKSYSFRDIEKKWQRYWLEHKTFSVKEDPSIPKEKRRYVLDMFPY
FT                   PSAEGLHVGHPEGYTATDIYCRYLRMRGYQVLHPMGFDSFGLPAEIYAITTGTHPRITT
FT                   ERNIERFRTQIQSLGFSYDWDREIATHRPEYYKWTQWMFLKMYEMGLAYMAEVPVWFCE
FT                   ALGTVLANEEVIQTPEGPRSERGNHPVIRKPLRQWMLKITAYADRLLEGLDKLDWPESI
FT                   KTMQRNWIGRSEGADIRFPLKDHDGHIEVFTTRPDTVFGATYMVLAPEHPLVKEITTPE
FT                   QREAVEAYVRQAQLKSDLERTDLAKEKTGVFTGAYAVNPFTEKEIPVWISDYILITYGT
FT                   GAIMAVPAHDERDWEFAKKFDLPIVQVVSRDGKEEELTEAFVEEGISINSGPFSGLPTK
FT                   EMKEKIIAYMEEKGIGKRAVNYRLRDWIFSRQRYWGEPIPVVHVEGDGVQPVPYDQLPV
FT                   TLPEVESYKPTGTGESPLATIRDWVETSAPDGSGRKAYRETNTMPQWAGSCWYYLRYLD
FT                   PHNDREFASREKIDYWMPVDLYVGGAEHAVLHLLYARFWHKVLYDLGLVNTDEPFMRLV
FT                   NQGMILGEDGEKMSKSRGNVVNPDDIIEEYGADSLRMYEMFMGPLEATKPWSTKGLVGV
FT                   HRFLNRVWDISEREITDEEPDPDLLKLLHKTIKKVTEDTEHLRFNTAIAQMMTYINEIY
FT                   KLERVPRSLWEPFVLIIAPYAPHIAEEMWEKLGHEGSLAYHPWPTYDEALTIDEVVTVV
FT                   IQVNGKVRARIEVPRDLPKEELEKRALSHERIRQWIDGKEMKKVITVPNKIVNIVV"
FT   gene            467239..468222
FT                   /locus_tag="STHERM_c03880"
FT   CDS_pept        467239..468222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03880"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01360"
FT                   /db_xref="GOA:E0RPP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP6"
FT                   /protein_id="ADN01360.1"
FT                   /translation="MIEIRSVGEEAGSITPSGSPSRGSASFLTTLKKNRQFLVMLIPVT
FT                   VYLLVFNYAPMAGLILAFKRYIPALGFWKSPWAGLSNFKFLFVSGAFGRILFNTVFYNV
FT                   IFLVTCQALGMMVAILISELRLRKLNNLLHSLTFFPYFVSYVVVGAIVYNIFSYEFGVF
FT                   NNLLEAWGAEPVNVYQMPNVWVFILTFLNSWKWVGYTSIIYYTTIVGIDPELYEAAEID
FT                   GASTLARIWHITVPYLKVTLLTIVLFQLGSIFKGQFDLFYNVIGNNGQLFEATDVVDTY
FT                   VFRMLITNFDVGLGTAAGLFQSFFGFLLMMIVNGVVKKVRPQYALF"
FT   gene            468232..469125
FT                   /locus_tag="STHERM_c03890"
FT   CDS_pept        468232..469125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03890"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01361"
FT                   /db_xref="GOA:E0RPP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP7"
FT                   /protein_id="ADN01361.1"
FT                   /translation="MRFGRPISREGLVFQFVGYGLLIVVVILCVAPLLLVVSGSLSSEE
FT                   SIYQHGFWFIPREFSLDAYRILFKAPKDVLQALWISVVVAALGTITSVFVACMVAYVLI
FT                   QPEFAYKRFFSIFIYFTAIFSGGLIPTYILMVRYLHLKNTLLALILPQWITAWNLFLLR
FT                   NFFTEIPYSVVESARIDGAKEFTIMTRLVIPMAMPGITTIALFQILYYWNDWVQAMLYI
FT                   TDKALYPFQYYLYTMLHNFLSVQNAIANAGIVLPSVPTESFKMAMTVIAILPIAIIFPF
FT                   IKRFFVTGLSKGAIKG"
FT   gene            469176..470729
FT                   /locus_tag="STHERM_c03900"
FT   CDS_pept        469176..470729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03900"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01362"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP8"
FT                   /protein_id="ADN01362.1"
FT                   /translation="MRNVVKGVWLGLLMVVLSFGLWATGAQEEGTAGGAQELKPVELVM
FT                   WLVGDSVPDYELMLQELNKLTKEELNATIKVNFTTWTDWKTKLRLLLTSGEAFDLVHMA
FT                   PWGIYQEASKLRLLLPLEDLAPKYAPVTWESYSPDVLKQATVNGHVYMLPFNYTDPYGN
FT                   GFLYRLDLAEKYGLGKIRNIEDLETYLVTLAKNEKGIIPYNAGEFDLTTYPETICAAMP
FT                   SFPKAGGEDIIQGLMPYFYVFYDDPNPEPVFILEHPSFREAIEFSRRLYRAGAIPKGVL
FT                   SNQVGSREAFINGTSAVTLLNPLNANEVYQQVAAKHPDWKLDYWNPYLDLDHPTKAPAI
FT                   NNGMSVPASSRNPQRALMFLEKLHQDQRYHDLTSYGIRGKHWDLDENGQIVLPEGVTVD
FT                   STGFAWDRPCPWGWREEKFYRLNPLKFASTWQVIKDWYSAYLAKAVDRKYVSFYLDKEP
FT                   ILAEFAAVDNLKTQYVDPLLWGIADPATYPEVMDKFYAAGLGKVKDEILKQWKAYMAQY
FT                   "
FT   gene            470817..473033
FT                   /locus_tag="STHERM_c03910"
FT   CDS_pept        470817..473033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03910"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01363"
FT                   /db_xref="GOA:E0RPP9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPP9"
FT                   /protein_id="ADN01363.1"
FT                   /translation="MRNEGSPWKHVLRRTLLFFSITAGLTIIVLTVTIYLSIQPIVARR
FT                   LYRVERQNIHNAVTGIRLMQNLATNLLIQIYNDPLIVPLLTVPPEDPQEEYLAIQSLKK
FT                   YSTFVPYLDSVYIYNDATGRCYLSTSASTNLSLPVEEMYDREFLELMEDGRWINSPAPI
FT                   FRSYEGDFPFGGQRRRVFTYLYNVMGVRTRRPSVVAINISYEWITSIMESLDASEGYPA
FT                   FILDREGSLIGASMEDEDLVGLVRTTIQGQGSEEGQPLVTTVATRRETYLLVYETLRDM
FT                   GWVVGKVVPLSQAVNEIFVIRRELLKIGTAFLVAGLLVSFLLSNRLTRLLRSLSRGQNG
FT                   EVPYRSFFKTRVLSDLLLKGPEGASVRVEDAGDLLAIRVSPHSWYALLACEREGGDEIP
FT                   ADWYAHLLEEVEGWEDVRWEWLQREDEFLLVVETERDPGHCQGEIFGEWHRRLERALGT
FT                   SVRLYVAGFSRGAASLPRLYNQMSSLLANRRFLDGKDVFTQEDLGVLSRGHYEYPQNKE
FT                   HEFLEALHHMDAETAVSVAQEVFQGTRSFGYHVFQSVKYRLCTAFLRAVEQENQFLVST
FT                   FGLDPVRFLEEVERAQGPEEVSAVFESEVRRFVRHMEEDRTSDHKKLVQEVCRIIEEEY
FT                   DDFNLGVATLADRIGLSPGYLGQLFKKYVGVSMTDYINEVRVSRAIHFLVNTEAPVYEI
FT                   PQMVGYTNKQHFHAVFKKYTRLTPNEFRKQARLKRAQRRDEMAS"
FT   gene            473084..475213
FT                   /locus_tag="STHERM_c03920"
FT   CDS_pept        473084..475213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03920"
FT                   /product="putative beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01364"
FT                   /db_xref="GOA:E0RPQ0"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ0"
FT                   /protein_id="ADN01364.1"
FT                   /translation="MGDPGGRLHYHVCVEERYMQHRILHGAEYNPDQWLEEPEVLEQDI
FT                   ALMREARIDTVTLGTFSWSLLEPEEGVYSFEWMDEVMERLERAGIRVILATPSGARPRW
FT                   LARKYPEVLRVGPDRRRRLFGERHNHCFTSPVFRERVYELDRRLAERYGRREHVILWHI
FT                   SNEFSGECHCELCQEAFRRWLYDRYDGDLEALNRAWWTAFWSHRYTSWEEIASPSPLGE
FT                   PNLHGLNLDWRRFVTHQTVDFMLVEVRALRDGGPSLPVTTNLMGFQRDLDYFRLARHLD
FT                   VVSWDSYPLWHGRGRTTPRVACGELDHNWDPEGRDWVLASGVAWAHALHRGLGGGRPFL
FT                   LMESTPSHTNWQPWSKPKRPGMHVLSSLHAVAHGADSVQYFQWRAGRGGSEKFHGAVVY
FT                   HDRRTDGRVFQEVRELGGILERLGGMEGSRVEAEVAVVFDWENRWALEDAQGPRNDGRL
FT                   DYVEECWRWFDAWHRRGVGCDVVHPEGDWSAYRVVVAPLWYLVKEEWADRVARFVEQGG
FT                   VFVTTVWSGVVEEHDLCHVGGFPGPLRGLVGVRSREVDVLVEDEVRRVAGVWGVCEGRL
FT                   LCDVLAVEDEGVEVRAVYADGFYAGSPAATRVRRGRGWAYYVGTLLAQEGIDWLVGELM
FT                   GEAGVVPALRVVPEGVDVSVRVTEEGRRYLWLLNFREHEVVVELPEGVWRDVLGGGERR
FT                   GVLVLPGYGYAVLES"
FT   gene            complement(475272..476246)
FT                   /locus_tag="STHERM_c03930"
FT   CDS_pept        complement(475272..476246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03930"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="UDP-galactose4-epimerase; galactowaldenase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01365"
FT                   /db_xref="GOA:E0RPQ1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ1"
FT                   /protein_id="ADN01365.1"
FT                   /translation="MRFVLTGGAGYIGSHVYRLLKERGHEVVVYDNLSHGHREAVEPAD
FT                   LRVGDLHDTETLREVLLSFKPDVVMHFAAFIEVGISTERPLEFFENNTVGTIRLVQTMM
FT                   HTGVHHFIFSSTAAVYGHPEKIPIPEDARLTPVNPYGSSKVMVEEFLRSLSEWSPFRYV
FT                   AIRYFNAAGAAEDGSIGEAHDPETHLIPLILKAAKGERPHITIFGTDFPTPDGTAIRDY
FT                   IHVDDLAEAHLLAAEYLMDGGESQALNCGYSRGYSVREVIETAKKVTGRDFPVIEGDRR
FT                   AGDPPALVADSSRMRTILGWKPTRDDLAYIIKTAWNWELNRRY"
FT   gene            complement(476387..477460)
FT                   /locus_tag="STHERM_c03940"
FT   CDS_pept        complement(476387..477460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03940"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="beta-IPM dehydrogenase; 3-IPM-DH; IMDH"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01366"
FT                   /db_xref="GOA:E0RPQ2"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ2"
FT                   /protein_id="ADN01366.1"
FT                   /translation="MKTYKIAVIPGDGTGPEVVAEGVKVLKAAAATYGFKLDLTYFDYG
FT                   GERYLKTGKIISDEEVQELRHFDAIYLGAIGHPDVKPGILETGLLLKIRFDLDQYINLR
FT                   PVKLYPGVDCPLKDKGPEDIDFVVVRENTGGIYTGHGGVTRKGTPDEIATQVMVYDRRT
FT                   VDRCLKFAFELKKRRNAESEKSRSKPIHLVHKRNVLTHCGDLWYRAFEEMGADDYPDIP
FT                   RDYMHVDATTMWFVKNPEWFDVLVTENLFGDIITDLGAMIQGGMGIAAGGNINPEGVSM
FT                   FEPIGGSAPKYTGKKMINPLAAIEAGRMMLDFLGEHEAAKAIEKAVALTCTKLESLSAG
FT                   KMGYNTEEVGDMVAEAV"
FT   gene            complement(477598..478752)
FT                   /locus_tag="STHERM_c03950"
FT   CDS_pept        complement(477598..478752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03950"
FT                   /product="arabinogalactan endo-1,4-beta-galactosidase"
FT                   /EC_number="3.2.1.89"
FT                   /note="galactanase; endo-1,4-beta-galactanase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01367"
FT                   /db_xref="GOA:E0RPQ3"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ3"
FT                   /protein_id="ADN01367.1"
FT                   /translation="MRHKRFSHLWLLLGATLLTLLLGGCKGEIFGSPTDAADELEARAG
FT                   NSLQIGVDLSEALYAQEHGVQYRDTNGQVKDVFQIFKDHGYTWVRVRVNVDPPDNPNYA
FT                   MFTDLAYAKQLGAIAKSKGFKLLVDFHYSHWWADPGNQWTPSAWQTNNINTLCTYVYNW
FT                   TKDAITQLRNAGAAPDMVQIGNEITNGLLWDLGGPYRSGGSWRNMAWLINSGINGVKDA
FT                   GSSAKIMIHLDSGGSRSTTQNWITNFRNNDGQWWDVDAFGLSYYTMWQGSLGDLSNNLS
FT                   YLNTLGKEIYIVETAYYWDTNEKGYSGSQVPYPQTPQGQYQFLQALKNTVSAYSNVKGV
FT                   FYWGAAWAQSWKWLSAPGWPDDDASRRSLFDDNAVATMGIDGLF"
FT   gene            478972..480714
FT                   /locus_tag="STHERM_c03960"
FT   CDS_pept        478972..480714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03960"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01368"
FT                   /db_xref="GOA:E0RPQ4"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ4"
FT                   /protein_id="ADN01368.1"
FT                   /translation="MRGNLTDEAVGAIKEGIRTKEEQVRLCGLHVQEGRFVHSFEGGSL
FT                   SFQVERMPLGWVVRGTVEGRPGRLEVVRLPLRFPLLLQSWESWGACPRVDEGWRFPWGE
FT                   RQYEDWRYTVSLVPELMREGVVSDYLAAWEGGLAGFLTSRYAHGFFTVEGEELVGYLEF
FT                   FDRVFDGPVPLEPLVVLEGGEIWDLLEVYATMAGRENRARVPAHSPLGWCSWYHYFLDL
FT                   TWDDVRKNLALAKEWPFEVFQVDDAYEADIGDWLEPKEGFPPVEEMARTIREAGFTPGI
FT                   WTAPFCASATSRLFREHPEWFVKEGGVPLVAFRNWGKDIHALDLSNPEVQAHLSRVFSS
FT                   LRAAGYGYFKIDFLFAGAVPGERVMAVSPVEAYRMGLETIRAAVGDAFILGCGAPLLPS
FT                   VGLVDGMRIGPDTTPFWDPAVPDNGAPAIQYALRNALYRSFMHRRFWLNDPDCLLLRKD
FT                   RISLTEEERRTFALTAGALDGMLVVSDDLSLVDAAGRGLLDEALSLTGGRPRVGDLGGG
FT                   CYEVVSEGTRSGRVRLVVNLGEEEAGGVAPHGVVLEKEEQGLGLSRRVELREGRRFTYY
FT                   HREE"
FT   gene            480716..481690
FT                   /locus_tag="STHERM_c03970"
FT   CDS_pept        480716..481690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03970"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01369"
FT                   /db_xref="GOA:E0RPQ5"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ5"
FT                   /protein_id="ADN01369.1"
FT                   /translation="MELRYNVLTGEWVIVSGATQRRPVQPGQSECPICPGGLELPGDYD
FT                   LVSFENRFPSLSREAEEVEDLSPVLRRAAARGVCEVVVYTSRHEGALPDMEIAQVEKLV
FT                   HMWCDRMRELSSLSFVEYVFIFENRGKEVGASLPHPHGQIYAFPFLPPRVKAKVEAAAA
FT                   FGEEHGRCPVCAVLEEERARGERVILEGRHFVALVPFYARFPYEVHIYPVRHVDNLMYF
FT                   SFEERAEFAWMLKTVTAAYDRLFGEPFPYMMMFFPAPLRVASPFFHFHVEFDPPKRDKD
FT                   KLKWMASVETGTGAFINPVPPEEAAARLAACVKEVEDEVQGAR"
FT   gene            481668..482720
FT                   /locus_tag="STHERM_c03980"
FT   CDS_pept        481668..482720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03980"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01370"
FT                   /db_xref="GOA:E0RPQ6"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ6"
FT                   /protein_id="ADN01370.1"
FT                   /translation="MRFRAPGRVNIIGEHTDYNDGFVLPFAIDRWIEVEVEPSDRWVVW
FT                   SERTGEEVVFSPSERRGDWSDYVAGVVWALERRGLSLRPARVLVRATLPDGAGLSSSAA
FT                   LEVATGAAVCASSGYDPDRDLLVEAAWEAENEFVGMRCGIMDQFVVAHGREGHALLLDT
FT                   RTREFRLVPISLEGAEFFLVNSGVKHELASSGYNTRRAECAAVLERLGKGSFREVRPEE
FT                   VEGLPEPLRRRARHVLSENERVLRTVEALERGDAAEVGRLLSASHASLRDDYEVSCEEI
FT                   DWLVERLGRVEGVYGARMVGGGFGGSVLVVAREGVAEGLEGVLGEYGAWWGAEAGVLRV
FT                   RSADGVGRVG"
FT   gene            482847..485117
FT                   /locus_tag="STHERM_c03990"
FT   CDS_pept        482847..485117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c03990"
FT                   /product="glycoside hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01371"
FT                   /db_xref="GOA:E0RPQ7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ7"
FT                   /protein_id="ADN01371.1"
FT                   /translation="MKFTDGYWRMRKGVVPFFPHTVWEVIRSEREVKAHVLCTRVRHRG
FT                   DTLNVPLLTVRIWSPREDVLGVEVVHHLGGVPKAPDLLLLERRSPLPLRVEEGEEALLV
FT                   SSGRLAARISTSRWGLEFLGDGRLLTDSKEKNLGYVRTAEGEAFLHEQLRLGVEELIYG
FT                   LGERFTPFVKNGQVVEIWNGDGGTSSELAYKNVPFYLSSRGYGVFVNDAGPVSFEVGSE
FT                   KVSRVQFSVPGERLEYFIIYGPHPMEVLEKYTDLTGKPALPPAWSFGLWLTTSFITDYD
FT                   ETTVRSFVTEMKERGIPLSVFHFDCFWMKGLHWTNFLWDRERFPDPEGLLAWLKEQGVR
FT                   SCVWINPYIAQQSEIFMEGMERGFFLRRPDGTVWQTDDWQAGMAIVDFTNPEARRWFAS
FT                   KLERLLEMGVDSFKTDFGERIPVDVIYYDGSDPMRMHNYYSFLYNRTVFEVLERKRGRG
FT                   EAVCFARAATAGGQQFPVHWGGDCVSTYESMAESLRGGLSLMLSGFGFWSHDIGGFEKT
FT                   ATPDLYKRWVAFGLLSSHSRLHGNESYRVPWLFDEEAVEVLRFFTALKHRLMPYLYTVA
FT                   VEAHRRGVPVMRPLILEFPEDPGCRYVDREYLLGPALLVAPVFGEEGEVAFYLPPGLWR
FT                   HLLDGEVLEGPGWFARRYDYFSLPLFQREGSVLVLGKEDAAVYDYTRGVVCEAFLPREG
FT                   RILWSQVDARGEPAASLSLERRGDRVIFACEGFSESRLVVHGGEGEGRMECGLSEEGEV
FT                   RMG"
FT   gene            485340..488198
FT                   /locus_tag="STHERM_c04000"
FT   CDS_pept        485340..488198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04000"
FT                   /product="glucan 1,4-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01372"
FT                   /db_xref="GOA:E0RPQ8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ8"
FT                   /protein_id="ADN01372.1"
FT                   /translation="MSQDAIGEVSVSREVSPTRERFRDPDLPLEERVSDLISRLTLEEK
FT                   LSLIPVRQAGVPRLGIDPYPIGGEAAHGVAWVGEATVFPQPVGLSCTWDKDLLRRVGEV
FT                   IGVEARAYRDILGTEFGLTLWAPTVDLVRDPRWGRTEEAYGEDPCLASELAGSLVRGMQ
FT                   GDHPFYLRMGATLKHFFANNNETDRGISSSEIHPWLMHNYYLEVFRRIIERARVTCIMT
FT                   AYNAVNGTPCLLHPAVRELVKERWGLPGFVVTDAADFGMTVGMHAYFEDHAESIAATLR
FT                   AGVDALTEDDRTLVIESLRRALERGLLEEKDLDAALRNIFRIRFRLGEFDPPERNPYAG
FT                   ITREALCAPSHTRLAREAARKSVVLLKNEGILPLSASSLRRVAVVGPLADEVHTDWYSG
FT                   TLPYVVTPLQALKERLPGVEVWYEEGSSRVRLRSAAYGGYLAADEEGNLFLTCPGQAPG
FT                   TESLWDWLDWGWGSHIFRSVRSGRYLTCAPEGTGLSATARQVRGWFVQEVFTLEERWGG
FT                   LCALRTWHGKYLSCDAQGGVHLSDRAESMRELFELEPIRSGEEQVRACAEAADVVLAFM
FT                   GNNPFINGKETVDRPDLALPPLQHRLVRTAFEANPRTVLVLIGSYPFAVPWEDAHLPAL
FT                   LYSSHGGQEMGQALVDVLLGEVSPAGRLSLTWYRSSSVLSSIFDYQIHKGRKSYWYARE
FT                   EDVLYPFGYGLSYTTFEYTGMRCAPLRATPETGVEVSFRVRNVGPVASDEVVQCYLVPP
FT                   EGPFSPKKVLVRFDRCHFAPREEKEISWRLTAEDFSFWHPVAEARLPLPGRWRIQVGSS
FT                   SRHIHLEEVITLEAPPLPHWTPGRRIPVAGGEDVEGCAYVEGEGLHPALRPRGGGRALV
FT                   RCGVLECSGDVHELHVLVRNGAETTDLVVRWGSHEVRFPKALPFTGGEWKEVSLECSLA
FT                   PGRHDLSISWRGEAEILWILFT"
FT   gene            488180..489142
FT                   /locus_tag="STHERM_c04010"
FT   CDS_pept        488180..489142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04010"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01373"
FT                   /db_xref="GOA:E0RPQ9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPQ9"
FT                   /protein_id="ADN01373.1"
FT                   /translation="MDPLHLRTRDERGIRMEPILHPEDKEDRKHGTDDFPFALYDNYLR
FT                   YPYFSRYTIDPHWHEEMEFLLVVRGNARVLRDGEFVEVGEGEALFIPPRTFHAAESLDH
FT                   QPFHFIALVFHLDLLEGEVQDVCHKRYFTGIKKRLLSFPGVISRKTLWGKAILHELMEV
FT                   VDLADHKGPGYELGIKGALFKVFSLIFSHGVVQKSEVAGDVYAVEKILPALEYIKEHYQ
FT                   ENLSVDDLARLVYLSKYHFIREFKRLTGRTPVEFINRYRVHKAMAMLIETDEKVLNVAY
FT                   ECGFNDMSYFIRLFHRFTGLTPAQYRRAYAPRGVKTGGR"
FT   gene            489179..490135
FT                   /locus_tag="STHERM_c04020"
FT   CDS_pept        489179..490135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04020"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01374"
FT                   /db_xref="GOA:E0RPR0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR0"
FT                   /protein_id="ADN01374.1"
FT                   /translation="MPANGAHLVKTSSLKKHTSWWATVVNQRYLILMSFPFVLWVIVFR
FT                   YLPLWGWTMAFQDYKPGLPFFQQKWVGLKYFIILFEDPKFWEVMRNTLAMSLLGLAFGF
FT                   TLPIVLALFLNEIRHMLFKRVIQTITYLPHFLSWVIVASLVFQMLGPSGPLNEFLLSLG
FT                   VVKEPVPFLTKPHYFWWVVTFADVWKEIGWNSIIFLAAIAGIDPELYEAATMDGAGRFR
FT                   KMWHITLPGIMPTVIVILIMSIGNLINIGFEKQFLLRTPLTKEYADVLDLYVLDYGIGS
FT                   GRYALGTAAGIFKSVVSLILLFTVNRLSKKTTGMRVL"
FT   gene            490146..491072
FT                   /locus_tag="STHERM_c04030"
FT   CDS_pept        490146..491072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04030"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01375"
FT                   /db_xref="GOA:E0RPR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR1"
FT                   /protein_id="ADN01375.1"
FT                   /translation="MRSVGVKDYYRRAKLGDTLFNAFNYTAMILLGIATLYPFLNVLAI
FT                   SLNDSVDTVRGGITIFPRKFTLENYAYLFSYPSVVRGAVMSVLRTAVGTVTGLVSTAMV
FT                   AYAISRKDFFARRFVTGIFVMTMYISAGLIPDYMLIRSLGLINNFLVYILPGLISAFNV
FT                   IVLRSYIEGLPYELQESAKIDGANDFVIFSRVVMPLCLPVLATIALFIAVGHWNSWFDT
FT                   YLYASSNKYLTTLQFELQKILTNVQSQAAASAQDIYSYALTEQARRVSPESIRMAMTIV
FT                   ATVPILCVYPFLQKYFTRGLVLGALKQ"
FT   gene            491121..492791
FT                   /locus_tag="STHERM_c04040"
FT   CDS_pept        491121..492791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04040"
FT                   /product="polysaccharide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01376"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR2"
FT                   /protein_id="ADN01376.1"
FT                   /translation="MKRLLPLLLLIPMVLSATGQGEKAAETTVGTKTPITFTMFNAEVN
FT                   PNWDEFQSPVAQEIKKRTGVTLEIEFAVGDPKQKLAVMAASGDYPDLVYAKGDLNLLKD
FT                   AGGILQLDELIDQYGPNLKKMYGQFYDRLRWSKEDPHIYYVGSYPVHDPIIVPNGLFWL
FT                   QHAVVLELGFPRLETLKDFENAIKTYYAKHPTINGQPTIPMTLLADGWRFLISVTNPAW
FT                   AATGGSDDGEWYVDQETFKAVRHHTRQIEREYFRWLNHMWNEGLLDRESFIQKYDQYKA
FT                   KIASGRVLALADAAWEISEPVTALRQAGMEERMYGQYPVVISEDVVCRVNQSPGYSGGW
FT                   GVALTVDCKDPARAIEFLDWMATEEAQILTHWGIEGVHWKYDENGKRVFLPEIDRMRRT
FT                   DPAFSKKTGIGNYSYPFPQWGRIKDSTGNYIMPDSEPEDQIKNYTEVEKKVLAGYGARM
FT                   WMDLFPGPDEFPPKPYGAAWMIRIDDPDLVAIDNRVRDDIGMRRIPEAIMAPPEKFDEI
FT                   WDAYLKEMEEAGLPRLTEEFNRLLRERIELWNPGFTFPE"
FT   gene            493004..493105
FT                   /locus_tag="STHERM_c04050"
FT   CDS_pept        493004..493105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01377"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR3"
FT                   /protein_id="ADN01377.1"
FT                   /translation="MCIAGDRRVYGRVYTGTDGRGIVYWELERLPGL"
FT   gene            493159..494265
FT                   /locus_tag="STHERM_c04060"
FT   CDS_pept        493159..494265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04060"
FT                   /product="glycosyl hydrolase family 12 protein, TPS linker,
FT                   domain X"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01378"
FT                   /db_xref="GOA:E0RPR4"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR041438"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR4"
FT                   /protein_id="ADN01378.1"
FT                   /translation="MKHTKPLWGAALAALVLLGGCTEVVSPGATGEISSRAVWESWDQW
FT                   ATWTDGEYTLYNNVWGSGAGSQRIWANAYYDWGVWADHPDTGGVKSYPNVSRMINIKIS
FT                   EIDSLTSSFTIATRPSDGAYNSTYDVWLGDYAYEVMLWMNHVGEVKPISYEWDSSGNPV
FT                   PVYSDVTVGGHTWNVYRGTNGSQEVFSFVRTSALDTGTVDIKAILEWLRDAGWIGDVEV
FT                   DQLQFGWEITSSPGGRDFAISAYEVNLSTSGTTPTPTPTSTPTPTATPTPTSTPTPTPT
FT                   PTSGEYREIELPFTYDGPGEYFWKTDDFSTEVDWGRYVNSWNLELLEINGNDYTNRWVA
FT                   QHQVPPAADGYWYIHYKGSFDWSHVEMK"
FT   gene            494442..495167
FT                   /locus_tag="STHERM_c04070"
FT   CDS_pept        494442..495167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04070"
FT                   /product="putative transmembrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01379"
FT                   /db_xref="GOA:E0RPR5"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR5"
FT                   /protein_id="ADN01379.1"
FT                   /translation="MKRSFSVIVSALTVISLVFLAGGCMSVPHVSLEGKSVLYLTKVSS
FT                   GELTETDKTIIAHLESLGMVVTPMNAKESKADDAQGYDLVYVSEVVSSSHVGNKFKDVA
FT                   VPMVSTEHYIADDMGFAEPEEGKGYGKAEYAYKELVIKDPSHLLAAGLSGTVQIYTDYG
FT                   SVGFSRPQGEVQVVAVAPDDESMVLIYGYEKGSKDMHGDVVPARRVFSFLFEGMESLLT
FT                   DEGWKLFDAAFMWALEGSE"
FT   gene            495233..496633
FT                   /locus_tag="STHERM_c04080"
FT   CDS_pept        495233..496633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04080"
FT                   /product="putative pectate lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01380"
FT                   /db_xref="GOA:E0RPR6"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR6"
FT                   /protein_id="ADN01380.1"
FT                   /translation="MKKKWSVPMCILSVLMLLFSGCVSSPQGGARVSEEAEMPQSIEEE
FT                   LAALGYEYPVEDFSDIPAAGEKVFPNAVGFGIYTRAGRGGKIIRVTTLESDGPGSLRAA
FT                   LEAEGPRIVVFEVGGVIDFEMTTIEITSPFLTVAGQTAPSPGITIIRGGLVVKTHDVLI
FT                   QHIRVRPGDGADLSFRGWEVDGISTYGEDAYNVVIDHCSVSWATDEGISVSGPRLPRPR
FT                   ATSHFVTVSNCIIAENLNNATHSKGAHSKGALIHDNVQYVAYIGNLFAHNVDRNPYAKA
FT                   FTLSVVANNLIYNPGTNAIRVGYVPSEWTGTGVNPLPARMTAVGNVLIHGENTLPHLAL
FT                   IGTEGLVFMEDNLAFKKDGSPARLSMGKVTLLHHKPLWPEGFIPVPAEELEEHIVANVG
FT                   ARPADRDSVDERIIRDLVERKGRIIDSQEEVGGYPAYEPVYRPLEIPDDVEAWLNELAA
FT                   EVEGRASR"
FT   gene            complement(496713..497468)
FT                   /locus_tag="STHERM_c04090"
FT   CDS_pept        complement(496713..497468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01381"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR7"
FT                   /protein_id="ADN01381.1"
FT                   /translation="MRGMRLLCLASLMLLLGACATSSGKIVEETPEPQPTEEPPVGVQE
FT                   TPSWTVYDASVLPDQAVPPFYADNIKGLKAETAVVDDPEIPGNKVLSIVSPPGEDNKLC
FT                   WAMDWDLPNKAATVVFRAKLQGEAVDAIAFDIEFRCGMYRDRLVAYGDGTIKLDKAGVS
FT                   ATIDATAWHVVRITLLQKDEGLAIDVYIDEDPTPLLSGVSTTGHSDKKFRFGDGSGNDY
FT                   CSSLYDWVIWTTTGAFPPGTGLPGGLTGI"
FT   gene            497567..497674
FT                   /locus_tag="STHERM_c04100"
FT   CDS_pept        497567..497674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01382"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR8"
FT                   /protein_id="ADN01382.1"
FT                   /translation="MIVYTKFCVKTGVLDGKNALHLLYLILISHERDEG"
FT   gene            497671..499767
FT                   /locus_tag="STHERM_c04110"
FT   CDS_pept        497671..499767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04110"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01383"
FT                   /db_xref="GOA:E0RPR9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPR9"
FT                   /protein_id="ADN01383.1"
FT                   /translation="MNTNLTHGAPRGYLSRRLVLLLSLIMGAFFIGLFVFWGHQASEYV
FT                   LSLQLQDMLNTTDQASETIELFMGGLRIRLAEEAEDDEVQEAFSEGDVEELRKIASEVM
FT                   AEEGRFFADVVIYGADATPVVGEARGVRFDPLEIRNQALIKKEPILIPGAVLLQEGRPG
FT                   MMLVTPVLRDGELLGFLGAFVDLSNFYTLFFSENVFGRTGYLYIVDGEGRIIAHPNSAL
FT                   LLSDISQTELFQQLYKRNIKSGTLRRGGEAIAYSWVLYHDIPWLVVGVARSAELLEGMF
FT                   RILALGGVGALIALAVQGLLVVMVLRLLVVKRVRLLQQSIEKVSRGHLEVPPRIRGRDE
FT                   MAFMLNLFSGFVERIRRTVGRVQEEMSLVARSGGALAQAVDHTSHAVEDILSQLDRTSS
FT                   DIEAQNTSIVETSSAVEQMARNIEMLSEAISRQSSSIEESATAVEQMVKNVEAIGRMGE
FT                   ALSDNFTTLQSASEEGKSGLQNLVQLAEVIRDTSKQLEEANRIISGVASETNILALNAA
FT                   IEAAHAGEKGKGFAVVADEIRKLAEQTTNHSKRIRESIRDIRRAIEEMVGLSQASFSTF
FT                   ELILERLEGVASYIQQVGNALHEQRAGGTQILQALEEMRSITAQVKDGSHQMAEGNAHI
FT                   LDAAGRLNELTQRIEQAMKAIGGQSEEIEKVLDVLRKENAETQQSIARVQESLSFFVLE
FT                   DDEG"
FT   gene            complement(499764..500867)
FT                   /locus_tag="STHERM_c04120"
FT   CDS_pept        complement(499764..500867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04120"
FT                   /product="unsaturated glucuronyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01384"
FT                   /db_xref="GOA:E0RPS0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS0"
FT                   /protein_id="ADN01384.1"
FT                   /translation="MSHTPIDPLSVAREAAESLMHRYPDPAELPPAHRWHYHQGVFLFG
FT                   MLKLWEETGEDRYLEYVKAYVDALVDEQGNLELATTELDAMQAGNLLFPLHERYGEARY
FT                   KKAMDYILGLLEGFHTTPEGGFWHKEKYPNQQWLDGLYMAGPFSVHYASLFGRPELYDL
FT                   FVKQALLIERHTRDPQTGLLRHAFDYSKQAPWADPVTGIAPEAWGRALGWFPAALLDIL
FT                   DHLPPSHTGYRVLEEMFRDLMGPIVRVQDRATGLWFQVLDKGHDPSNWLETSCSALFLY
FT                   SLSKGIRTHRLPVDPYITHARKAFQGIVGKTSRDPEGYLHIHDICIGTGVGDYRHYLER
FT                   PRSIDDLHGVGAFILGCVEFHRTRESI"
FT   gene            501029..501862
FT                   /locus_tag="STHERM_c04130"
FT   CDS_pept        501029..501862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04130"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="DKI isomerase; 5-keto-4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01385"
FT                   /db_xref="GOA:E0RPS1"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS1"
FT                   /protein_id="ADN01385.1"
FT                   /translation="MMEVRYSIHPEHAKGFDTERLRNEFLVTDLFRADVIRLVYSHNDR
FT                   IIVGGLHPVKGRLTLGASKELGTEYFFERREGGVVNIGGPGVVTIDGTAYEIAKNEAVY
FT                   IGKGAREVSFMSKEGTSPAKFYFLSAPAHKEYPSRRITLTDARKLELGSDENSNARTIY
FT                   QLIHPDVLETCQLCMGVTILKPHNVWNTMPTHTHERRMEVYFYYELPADQVVFHLMGQP
FT                   HETRHIVMRNEEAVLSPSWSIHSGVGTSNYAFIWGMIGENQTYTDMDTVPMEVLR"
FT   gene            501859..502620
FT                   /locus_tag="STHERM_c04140"
FT   CDS_pept        501859..502620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04140"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="2-keto-3-deoxygluconate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01386"
FT                   /db_xref="GOA:E0RPS2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS2"
FT                   /protein_id="ADN01386.1"
FT                   /translation="MILDMFKLDGKVAIVTGCRRGIGRALALGLAEAGADIVAVMRSEE
FT                   PGLEREITSLGRRYLWVEADLSSIEPVERIVEEAVKAFGKVDILVNNAGIIRRDDILDF
FT                   SEEDWDEVMNVNLKSVFFLSQAVARRMKEQGTGGKIINIASMLSFQGGIRVPSYTASKS
FT                   GVLGLTRILGNELAKYDIQVNAIAPGYIETDNTRALREDPVRNKEILGRIPAGRWGSPD
FT                   DLKGAVVFLASPASDYMTGSVVAVDGGWLAR"
FT   gene            complement(502710..504173)
FT                   /locus_tag="STHERM_c04150"
FT   CDS_pept        complement(502710..504173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04150"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01387"
FT                   /db_xref="GOA:E0RPS3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS3"
FT                   /protein_id="ADN01387.1"
FT                   /translation="MTKADIGLIGLAVMGQNLALNINDKGYRIAVFNRTVEKVDDFLAG
FT                   PAGGRETVYGAHTLEEFVSLLSRPRKIILMVKAGAVVDEFIRKLLPLLEPGDLIIDGGN
FT                   SHFSDSTRRTRELAEKGILFIGTGISGGEEGARHGPSMMPGGNPEAWPLVKEIFQAISA
FT                   KTPDGQPCCDWVGPEGAGHFVKMVHNGIEYGDMQLIAEVYHIMKSLLGLSHERMSGIFD
FT                   RWNRGKLGSYLIEITRDILAFKDEDGGPLVEKILDAAGQKGTGKWTGIEALDHGVPVTL
FT                   IVEAVFARSLSSFKDERVHAAEVLGEPLVPWKGTEEERARLVDDLEKALLAAKMVSYAQ
FT                   GFMLMREASHTYGWDLDFGKIATLWRAGCIIRSVFLDTIREAYRNEPGLSNLLLAPYFK
FT                   ETILEAEASWRRVVSTAVTHGIPTPALSSALSFLDGYRTSRLPANLIQAQRDYFGAHTY
FT                   ERVDRPRGQFFHTNWTGRGGATTSGTYTV"
FT   gene            complement(504207..505478)
FT                   /locus_tag="STHERM_c04160"
FT   CDS_pept        complement(504207..505478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01388"
FT                   /db_xref="GOA:E0RPS4"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS4"
FT                   /protein_id="ADN01388.1"
FT                   /translation="MILFEAGGPTARLSLDDLREGLYTALERWGRVKRALIVPPDITRL
FT                   HSRAGELSCMAYRYLGSACKGVLPALGTHAPMTPEEKALMYPDIPAELFIDHNWRTDIR
FT                   TLGEVPADYVEEVSEGKVRFPWPAQVNYHLLEGHDLILSIGQVVPHEVIGLANYTKNIF
FT                   VGTGGAEGINKSHYLGAVYGMERIMGRIHTPVRKVLGYAASRFCRDLPILYVLTVLSPD
FT                   EEGSLVVRGLFIGDDDACFEKAARLSQQVNLTYLDEPLEKVVVYLDPQEYRSTWLGNKA
FT                   IYRTRMAIADGGELVIIAPGVKEFGEDPTIDRLVRRHGYRGTDYVLEAVQRDPELQGNL
FT                   GAAAHLIHGSSEGRFGITYAAGGLSREEVEGAGFSYMEVEEALRRYLPEDMRTGWKDRH
FT                   GERYYFIPNPAVGLWTWRRRFEEG"
FT   gene            complement(505475..506362)
FT                   /locus_tag="STHERM_c04170"
FT   CDS_pept        complement(505475..506362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01389"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS5"
FT                   /protein_id="ADN01389.1"
FT                   /translation="MAARTMDHFTREKEFFIGIDSDGCVFDTMELKHKECFCPEFVYHF
FT                   SLQSVSRYARQVWEFVNLYSTTRGINRFLAVIRAVDLLAAHPEASKRSPHLPSLTALRR
FT                   WVQRETKLGMHTLTEELERNPDPELALVHRWSQGVNEAIARMVQGGIPPFPYVKESLAL
FT                   MQEKADTLVVSQTPFEALEREWTEQGIHTYVKAIAGQEVGNKARQIAAAVADHYPPSHR
FT                   LMIGDAPGDLEAARANEALFFPIIPGQEEASWEELHREGLPRFFEGRFEGEYQHRLLER
FT                   FERSLPSTPPWEAT"
FT   gene            506596..508872
FT                   /locus_tag="STHERM_c04180"
FT   CDS_pept        506596..508872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04180"
FT                   /product="alpha-L-fucosidase 2 precursor"
FT                   /EC_number="3.2.1.51"
FT                   /note="alpha-1,2-fucosidase 2;
FT                   alpha-L-fucosidefucohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01390"
FT                   /db_xref="GOA:E0RPS6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS6"
FT                   /protein_id="ADN01390.1"
FT                   /translation="MSDRAGGRRLWSDRPAGVWRDGYPVGNGRLAALVVGGLGEERIHL
FT                   NHEWLWRGRYRDRVAEGRAHLLGWVREAFFRGDWEEGTRRANEAFGGGGGVSGRPCRVG
FT                   AYQPAGTLVLWWEGMDGEGYERELDLEEGVVRVRRGRSVEEVMAVMGGGPVGVRVSGWG
FT                   RGWVGLEREVQEGVAVRVGAKGGMVRLEGRFEEGIGWEVRAVVRGGVCRGEGGRVWVEG
FT                   EEVVVWVVVDVWEEVGGSRRRLPSYGPPEVPGEGWEAVRRRHVEAYGGLFGRVRLVVEG
FT                   EEPLLPTGRRREDPDPLLPALLFDYGRYLLIASSAPGCDLPANLQGKWNPLLEPPWDAD
FT                   YHMDINLQMNYWLAEGAGLGECVRPLVRYVLRMVPSAREAARRLFGCRGIWFPLTSDAW
FT                   ARATPEAYGWDVWVGAAAWMAQHLVWRYLYGGDEGFLRETAYPFLKEVALFFEDFLVED
FT                   GEGVLQVVPSQSPEHRWEGLEGFPVGLCVSSAVDVQLVRWVLRMAVELGGRLGDELGRW
FT                   REMEGRLARLRVGGDGVLLEWGRELPEAEPGHRHLSPLWGFFPGDVLWDEDPEVREGAV
FT                   RLLERRVRHGCGQTGWSRAHLACLCAALGRAEEAWEHLRVLLGEFTTESLLGLHPVDLF
FT                   QVDAGLGGAAAVLLMLLQVRPDGVLRLLPALPRAWGRGRVEGLRAPGGWCVGVWWEGGK
FT                   VREAWFEGGRGVCRVEAWAEEGVVRHGGEEWVVRAREGVWEVGGRGEGRYAVRGCAGKD
FT                   VSSFV"
FT   gene            508934..509950
FT                   /locus_tag="STHERM_c04190"
FT   CDS_pept        508934..509950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04190"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01391"
FT                   /db_xref="GOA:E0RPS7"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS7"
FT                   /protein_id="ADN01391.1"
FT                   /translation="MRMHRMIMLVLSVLLLSALPLLASGTGEGEQAQEQYVLKFNHVLS
FT                   QNDPFHKAFLNWAENAYSRSNGRLKIEVFHSAQLGVEEDIIEQIRMGANVGQNTDSARM
FT                   GNYVPDIAVVNGPYFFDSLDEVWKLNESPTMQAWLKELETKYGIKVLSFNWVQGWRNLL
FT                   TNKPIKSPDDLRGLRIRAPGAPIWMESIRSLGATPVAMAFSEIYSGIQTKVVDGAGNVN
FT                   VNTLNTRLYEVVKYLNETKHILLVNFEVVSAKWFNSLPADLQTILQEECDKAGRQVSLE
FT                   VDKIGEEAKAKLAEQGMTIIPYEEIDIAAFKQNSIKAYETLGILEARNKIFKELGKM"
FT   gene            509950..510531
FT                   /locus_tag="STHERM_c04200"
FT   CDS_pept        509950..510531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04200"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01392"
FT                   /db_xref="GOA:E0RPS8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS8"
FT                   /protein_id="ADN01392.1"
FT                   /translation="MFQRGKGDPPLPPLRVRIYHLCLIERNHMNNFLQKLYKIEEYAAA
FT                   SLLSAATLLIFVSAVTRTFDLPLNWALDLTLFLFAWSVFLGADVAMRRNNLVNVDLLVA
FT                   RLPVPVQRACAVVSYILILVFLGALTGYGFWLSYASRARAFQGIPWFSYTWVALSVPVG
FT                   SILMIITTIRQFRAYLKEARPPAAEDGEVL"
FT   gene            510567..511847
FT                   /locus_tag="STHERM_c04210"
FT   CDS_pept        510567..511847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04210"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01393"
FT                   /db_xref="GOA:E0RPS9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPS9"
FT                   /protein_id="ADN01393.1"
FT                   /translation="MLLVAILFLLFLLMGMPVAFAIGISGVAFFLQHPELPFSMIVQLP
FT                   ISQTQNFPLLAVPLFIFAGNIMNSAGVTQRLIKLSTLLTGHMRGGLAQVSVVLSTLMGG
FT                   VSGSATADAAMEARLLGPGMLERGYSKGYIAAVIGYTSLITATVPPGVGIIIYGTTGEV
FT                   SIGQLFAAGLMVGLIMMVALMITVAITARVRGYRPERERRASLKEIFSSLGETIWALIF
FT                   PILLLVGLRMGIYTPSEVGAFACVYGIFVGVFVYKELTWKKFLETLRTTANDVGAVMYI
FT                   IALSGIFRYGIPFEHIPQALTSLITGFTSNVHLLLILVVVFLVFVGMFMEGSVAILLFT
FT                   PILLPMVQAFGVDPVHFGLVMCTTITMGLLTPPVGISMYALSSILEMPISEYLKEMWPF
FT                   LGAVVAVILFMIFFPDVVLFLPRLLFG"
FT   gene            511891..512631
FT                   /locus_tag="STHERM_c04220"
FT   CDS_pept        511891..512631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04220"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01394"
FT                   /db_xref="GOA:E0RPT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT0"
FT                   /protein_id="ADN01394.1"
FT                   /translation="MKLKDRVALVTGSARGIGRAVALRLAQEGASVGIMDLKGTEETAQ
FT                   EFSSMGHKAVPLHADVTRYEEVASAVEKLVEAFGKVDILVNNAGIIVRGHVLDLSLEEW
FT                   RKVIDVNLHGTFHCCKAVLPYMVKQNYGRIVNITSIAGKVGDITAAPAYGTSKGAVNTL
FT                   TKSLARQLADYGITVNAVAPHAIETDMSAQWTPEQRKAVIDAIPLKRLGKPEEVAEAVV
FT                   FLVSEGASFITGEILDVNGGYLMD"
FT   gene            complement(512668..513387)
FT                   /locus_tag="STHERM_c04230"
FT   CDS_pept        complement(512668..513387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01395"
FT                   /db_xref="GOA:E0RPT1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT1"
FT                   /protein_id="ADN01395.1"
FT                   /translation="MPTREKQPIEVRSLSEQVYQYLCDQIIEGRIKYGDVLNIKQLAQQ
FT                   LKVSTMPVREAIKRLEMEGLVTIKPRSTCIITIPTKKDILETVEMRELLEVFCVEKVYA
FT                   SVDQDDLHPLHEIVERMEHVAPLLLQDDAHDSPRFPLLLSEYIQLEHLYHTQLCRLANN
FT                   SLVDKFYREINLKLNMHFIYDIAAPPDVARTYRDHRTLLDALSSHSKEAVRIIREHLRQ
FT                   SRKNIIKGRGFAQLPDE"
FT   gene            complement(513390..514367)
FT                   /locus_tag="STHERM_c04240"
FT   CDS_pept        complement(513390..514367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01396"
FT                   /db_xref="GOA:E0RPT2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT2"
FT                   /protein_id="ADN01396.1"
FT                   /translation="MNPYRIVVADDRFNGNYEQEREALSGLEYEFVVCREDMPPQEFLS
FT                   IAQEADALLVNLRPIPEETISHLRRCRIISRYGIGVDNVDVEAATAAGIWVSNVPDYGI
FT                   EEVSDHAAALLLACARLIMVKDRGIRVGKWNHTAGLKAFRLHGKVLGIVGYGRIARAFH
FT                   RKMKGFGFARTLVYDPYIPSEEISRAGGEAADLFTLLREADYISIHAPLTKETRHLIGE
FT                   REIGMMKPTAVIVNTSRGAIIDQQALQRALEEHRILGAGLDVFEEEPLPKDSPLRDLEN
FT                   VVLSDHSAYYSEESLVDLKRKAALNVKETLLKGRPLYPVNNPGS"
FT   gene            514545..515537
FT                   /locus_tag="STHERM_c04250"
FT   CDS_pept        514545..515537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01397"
FT                   /db_xref="GOA:E0RPT3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT3"
FT                   /protein_id="ADN01397.1"
FT                   /translation="MEYAELMGTDIRISRIGMGCWGIAGGRTWGERDDRRSIDTLRAAY
FT                   DRGISFFDTAYSYGNGYSEELVGKALGPLGDRVVIATKVGTELSSPSEVERHCEESLRR
FT                   LRRDWIDLYQLHWHLPGMPPLPEIIEAMWRLVESGKVRAIGVCNLGKGQLALLPPEIPV
FT                   VTNQLPYSLLWRAIEYEVMPASLERGMGILAYSPLMQGLLTGKFSSPEEVPEGRARSRH
FT                   FSSSRPQAIHGEEGAEELTFETIHRLSDLARDLDIPLAHLAIAWVLQREGVASVLVGAR
FT                   TPDQVDANVGALAVRLSEEVLAELDTITTPLKERLGPNPDMWQTSGRIW"
FT   gene            515531..516604
FT                   /locus_tag="STHERM_c04260"
FT   CDS_pept        515531..516604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01398"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT4"
FT                   /protein_id="ADN01398.1"
FT                   /translation="MVRGGSSSDGSVHLYHHERALMVGAYRLRRADVSSPTAFHSWREA
FT                   LIPSLREALGVSAAFPPPAPRWTVLDGREDDGVVRRLLHVEIAPSLVMPVYVLHRAGLS
FT                   SPRRAVVALHGHGGGGKDAVAGVMDLPEVEGAVGRYRYDYGKALARRGYVVFCPDLRGF
FT                   GRRRLFPGDDLLGSDCLALQGGAISQGRSLLGEWIHDLVLLARVIGEVPPAGPGGIGVC
FT                   GFSGGGLAALFFGIFEEKVEAVVVSGYFHSFRDAAYRTNLCACNMLPRVWRWVEMGDLG
FT                   ALLAPRLFIVESGTEDPLNGPRGIADVYEQVEYTKAAYRLIGMEEKFHHVIFEGGHRWD
FT                   GDGVYPLLMEWFPPEVS"
FT   gene            516580..518799
FT                   /locus_tag="STHERM_c04270"
FT   CDS_pept        516580..518799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01399"
FT                   /db_xref="GOA:E0RPT5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT5"
FT                   /protein_id="ADN01399.1"
FT                   /translation="MVSARGVMRTSYLSPEERHEGLRAFLAFNAFNGVGFGLLAETIVY
FT                   LLALQYGATNLQLGYISSLIHLTGFLLILFPHVLKGAPLVLVYFGAWLGRGLVALLYWL
FT                   TLLVSPSAAIWVILATYTLFCMLRTVGVALYRPVQKMLSTPSTLGSVMVQANLAYSLTM
FT                   IIGQLLSFLFLSSPLTSGPRGLLSLILGGVLFNSVASLFLLKIPSRERIASSGDEHIVG
FT                   VLLEAMRNPRIRYPVLLHWIHLGTTILLGFSTALLKRGLGLPENLVVLYTMTTYVGLVA
FT                   AGFVNRPFVDRLPARPLLLLSFGLEIPLFLVFAFLRPGAAFGMLLILGFALGFVKGTIA
FT                   AHVGRTLVDAYPDDRKFSYNAMVNFVTSFLALGFGMAGGALADLGVGVAASLPFLNEYS
FT                   LVFAAGTVLVFVSMVISLGVRDDRRMEVRELLGVFLSPEHLTAMLGSYRLESTRDERKR
FT                   RLILNSLMECSSPLAEREIERILRHPFSVESKFVLNRLFVNPKPALLPRVLTLAGEEGY
FT                   VHRERAIFALGAYRGPEVERVLRTALDDPDPAVRGAAAKSLVRAGYPVDPADLFRRFLH
FT                   APVVREEVDYLIALGLAEEEEFLFRRIFTFAEKREGPYYRMTVYSAISSALGTAPLLGD
FT                   LFMEEESGRGKGVSRFLEEAVRFVPFWRERDRIGRSMREEKWEDILLWVEECIRGISAN
FT                   EGVRGVIHAFGSALREKLSGAPVREDAMAALYFFYALLDRNPEQR"
FT   gene            518932..519870
FT                   /locus_tag="STHERM_c04280"
FT   CDS_pept        518932..519870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04280"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01400"
FT                   /db_xref="GOA:E0RPT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT6"
FT                   /protein_id="ADN01400.1"
FT                   /translation="MAEHVAGGSAKGFSLFPPEVKRNIRKYKVFYLFLLPGFLYFVVFH
FT                   YLPMLGLRWSFYEFDLRGVGEFIGLEHFKTALASEGFRRAFWNTLILSSANIVIQMTAS
FT                   IIISLLLNEVTNQLFKRGVQTIIYLPHFLSWPVVASVFVLIFSQGGMVNAFVQKLGGEP
FT                   IYFFGDPVWWRRVYLFALAWREVGWASVVYLAALSGVDPQLYEAAWIDGAGRIRQAIHI
FT                   TLPSLVPVIVIVLVMNLSKIFNLFESVLVMYNPLVYSVADVLQTYVYRTGIVEFRYGYA
FT                   TAVGLFRSLIAFALVMASNWIVKRIRGEAVV"
FT   gene            519892..520764
FT                   /locus_tag="STHERM_c04290"
FT   CDS_pept        519892..520764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04290"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01401"
FT                   /db_xref="GOA:E0RPT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT7"
FT                   /protein_id="ADN01401.1"
FT                   /translation="MTLVQRFNRANLPRTVFVIVNTLFLLFIVMLIVIPLLKVFVDSVD
FT                   ARAAETIFRFLPEKFTLDAYRNLLSRPALYRPFLVSLYTTTLGTIIALMTTALFAYALA
FT                   QDNLPGKGFFLMVALITMVFRAGMIPLFLVVRDIGLLNNVWAVILSRCVDAYYLLLLRN
FT                   FFKTIPTSIMEAAEIDGCKPFTVFWRIVLPLSKPGLAAIGLFYLVMYWSQFFEYILFLP
FT                   TKPQWHNFQVFLRNVVIESETQGFEGFAFATQSLKNAVVVASMIPVLIAYPFVQKYFVK
FT                   GINIGAVKG"
FT   gene            520819..522252
FT                   /locus_tag="STHERM_c04300"
FT   CDS_pept        520819..522252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04300"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01402"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT8"
FT                   /protein_id="ADN01402.1"
FT                   /translation="MRKLVCAALCLLVAATVWAGPQAEQQAGAAQIKEIDIVLDRILMP
FT                   EDGLDQWVAEYEKLFGIKLNVTKPPHNQYSQILGTMFAANDLPDICEIQTADYVPYAKS
FT                   GKLVPLEDFIKASPVVKSIDSQYYEAYRLKDGHIYGFPTYKGGGCVGYIRKDWLDKLGL
FT                   KVPTTWDEFVTVLKAFTFNDPDGDGQDDTVGMTLPFQVPVNEFDYYNRFIMQGAYFDFQ
FT                   KKNGKWVDGFTQPEMKAALQRFQQLYSEGLLDREFFTNKTSTARTKIYEGQAGFMEYWA
FT                   GTWGTRMDASAKSSNPNAEVIAVPPIKGAHYVSRVGPVFGITTAAKNPKAVFDAIIGTM
FT                   WDKGKGQMLWTFGVEGLHYKTVGENKIEMLPQPSNPSTPMQKSFIDPHLTLNDWALPIE
FT                   FEEKMKLSVDIHNTYAVQLGIPEGGDLFSRYVGEIRTLKQEIFSKIVTGEYSVDEGLKM
FT                   YQQKAKELHIDEVLAELNG"
FT   gene            522332..523720
FT                   /locus_tag="STHERM_c04310"
FT   CDS_pept        522332..523720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01403"
FT                   /db_xref="GOA:E0RPT9"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPT9"
FT                   /protein_id="ADN01403.1"
FT                   /translation="MHVDVTTLGADPTGLRESTDAFREALSRIEAAGGGRLHVPPGDYL
FT                   VGPLRLCSHLEFEVARGARIRFVQDPDRYPVVFTRWEGVECHAYAPMLFVEGAEDVRIS
FT                   GGGVIDGQGASWWRMYRDYREGRLTRFPFSSVEEIARRNAHLSTKASGGGGRESHFLRP
FT                   PLLQVKDSRRVVIEGIVLRNSAFWNTHILYSDEVWIRGVSFENPPDAPNTDGLNVDSSR
FT                   NVRIEDCTFDVGDDCLGLKSGIDEDGRRVGRPTEHVVIRGCIMRRGHGGIVCGSEIAGG
FT                   VRNVVVTGCIFQDTDRGIRIKSRRGRGGFVENVMIHQIVMERVLVPLVVNLYYRCGIDP
FT                   GEEEIVSRLASLLPLPVDETTPAVRNISISQVLATGVKSSAGFLLGLPERPIEGLVLSD
FT                   YRVFMDEEGQEGEPAMAFFPTATRRGGFRGKYLKDAEFRGVRIEGAEEPAFLVEDSCSV
FT                   RRLD"
FT   gene            complement(523827..524927)
FT                   /locus_tag="STHERM_c04320"
FT   CDS_pept        complement(523827..524927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04320"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01404"
FT                   /db_xref="GOA:E0RPU0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU0"
FT                   /protein_id="ADN01404.1"
FT                   /translation="MEPIVVKPKGSCMWDAAALGEIMLRLDPGEGRIRTARTFTVWEGG
FT                   GEYNVVRGLRRCFGLKTTVVTAIPDNDLGYLLESLIGAGGVDSSHCIWLPYDGIGRQHR
FT                   QALNFTERGFGIRGAKGVSDRAHSAASALKPGDVDWKKLFQEEGVRWFHTGGIFAALSE
FT                   TTAELTVEAVKAAKEAGTVVSYDLNYRPSLWKSRGGEKEAQRINKMIVPHLDVLIGNEE
FT                   DFIAALGFEVKGVGKEVVGLNVESYKEMVQEVAKTYPNLKAIATTLREVKTATINGWSA
FT                   LLYYQGQFYHSIGWENLEILDRVGGGDSFASGLIYGFLEGFDPQTCVNYGAAHGALAMT
FT                   TPGDTSMASKAEVEKIVKGGSARVER"
FT   gene            complement(524927..525607)
FT                   /locus_tag="STHERM_c04330"
FT   CDS_pept        complement(524927..525607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04330"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01405"
FT                   /db_xref="GOA:E0RPU1"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU1"
FT                   /protein_id="ADN01405.1"
FT                   /translation="MIPRREIYRIMVEEGLIPVFFNPDPEVAKKIVDACAKGGARCIEM
FT                   TNRGENAVAVFRELVAFCREHHPDLILGVGSVVDPYTAGIYIAEGAKFVVGPVFDREIA
FT                   LLCNSRKVPYIPGCGSATEIHEAEKYGAEICKVFPGKEVGGPGFVKSVLGPCPWTEIMP
FT                   TGGVDTTEESLRAWFEAGVVAVGIGSKLITKERVKHGDFDAIAEDVKRVKALIAKIRSE
FT                   RGGT"
FT   gene            complement(525604..526479)
FT                   /locus_tag="STHERM_c04340"
FT   CDS_pept        complement(525604..526479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04340"
FT                   /product="xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01406"
FT                   /db_xref="GOA:E0RPU2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU2"
FT                   /protein_id="ADN01406.1"
FT                   /translation="MRQERLNLGIRLHDVGRGSPRELAARASRAGYCTVHLALHKAFEG
FT                   FPPEPGLLSPGFARFIRRTFEEYGLEIAVLGCYINPIHPDPRVREIHIQRFLEHIRYAR
FT                   DFGCSIVATETGSRAPDCSFHPETRSEESFSLLLSTVGRLVEAAERYGVLVAIEPVADV
FT                   HTIDSASKMKRLLDMVSSDHLKVLFDPVNIVPAAEWERHETIVSSAFELLGDDVVAVHV
FT                   KDFVVEEGKKRAVPPGHGVMDFRRLFRMILAKKPYIHMLAENISSDIIDLTYGFLTEAF
FT                   ETIRTEDVPL"
FT   gene            complement(526476..527756)
FT                   /locus_tag="STHERM_c04350"
FT   CDS_pept        complement(526476..527756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01407"
FT                   /db_xref="InterPro:IPR032586"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU3"
FT                   /protein_id="ADN01407.1"
FT                   /translation="MATPGSLSFPRYSIGTGDRFGHEAEAQLRAVIEAGRLGRALGIVW
FT                   NKSYREHTIIGSRPEDVRRMADRAVSSLGWEGPYFVDADHITTKTVDLFLDSADFFTID
FT                   VAEAIGKGEVSPQEEEDLLASLGDLLNRELAIPGLSSPLAISEETARGTIRAYWPAVRE
FT                   AARIYRRIEQGASRPFVVEVSMDETDEPQRPPELLLILAMIRKAGIPARTIAPKFSGAF
FT                   YKGVDYVGDPHTFAREFEDDLCVVRYAREQFALPEGLKLSVHSGSDKFSLYPLVREILS
FT                   RHPQEGVHLKTAGTTWLEEVAGLAEAGGEALALAKEIALTCYSMIEELCAPYAAVIDID
FT                   PERLPSPGEIEEWSSGRFVEALEHDPSNPSYNRDFRQLIHVGYKVAAQMGERFHQALEA
FT                   HREVIAARVTRNLLERHIIPLFPGDIP"
FT   gene            complement(527883..529109)
FT                   /locus_tag="STHERM_c04360"
FT   CDS_pept        complement(527883..529109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01408"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU4"
FT                   /protein_id="ADN01408.1"
FT                   /translation="MKGEVTMKRYAVLFMLVTGAMTLIDAQETAPTEALTEYSSEHYLV
FT                   RTDTPEERAQSLASRMEAAFHLFNRYYRFDPEALPAPLTVRIFSSKADYDAYLRKKTGT
FT                   TRESFIYLHYQNPAKRELVGYLLDDETELNRQLLHQGSIQFLRAFVNNPPLWLQEGMAV
FT                   FFEACEYDPETSSMIYRENLTWLDPLRTLASQTGGLIPLSEFLHMDLEAASRNLELYYP
FT                   QAWGFVSFLVYEWDKEYNRILWDTIRLLSPSATYEENLETLDARVFSWYDIDQMKDRLL
FT                   SYLEGKKSFRVLLEEGIEAYRSGDLQKAEEAFTRASKLDPDHYAPYYYLGLIAYTRGTH
FT                   SLAEYYYTTALERGAEEAATTYALGLNAFAADRMEEARTYLVKAQTLAPDKYGEKVQAL
FT                   LERMGSEGM"
FT   gene            complement(529147..530019)
FT                   /locus_tag="STHERM_c04370"
FT   CDS_pept        complement(529147..530019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01409"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU5"
FT                   /protein_id="ADN01409.1"
FT                   /translation="MRSLFRNLGWIFKGVKVYALIGKSGTGKSFRARLVADKYGIPLIV
FT                   DDGLLIKGEKILAGESAKKETTYLGAVKVALFQKESHRRAVIQALRKEEFNKILILATS
FT                   KKMADKIARTLDLPPVHKYITIEEVATPEEIEIARHYRRTQGKHVIPVPSLEVKRTYPQ
FT                   ILADSLRLIIKRGFGFFKKEQVVEKAVVRPTFAQKGTVTISESALTELILHCLAEYDPD
FT                   LRLLRAQITTEGGAYHITIYLSVPFGKELASPLHELHRYIITNLERYTGIIVEELHMVV
FT                   DKITKPVEG"
FT   gene            complement(530072..530974)
FT                   /locus_tag="STHERM_c04380"
FT   CDS_pept        complement(530072..530974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04380"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="rRNA-uridine isomerase C; rRNA pseudouridylate
FT                   synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01410"
FT                   /db_xref="GOA:E0RPU6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU6"
FT                   /protein_id="ADN01410.1"
FT                   /translation="MEDYQVFESGPDDHGKRLDRIVRTLLSHIPLSRVFRALRTGEILL
FT                   EGKRVPPSTRVSRGARIHIHRSLLPEREPRQKWEPRALPILLETDHLLILNKPPGAVVH
FT                   GPGSLTDQVRSYLKDRIPPSLAFTPSPLHRLDRLTSGILVFSRSIHGARWFTRALREGG
FT                   IEKTYLALLEGTLAEPARWEDLLTREGRRSRPSPHGRPALTDVRPLLAAPTATLALCII
FT                   HTGRMHQIRVQAALRGHPLLGDTAYGSTRRIRPVLHAWRLRPLSPSPLFPADGLQAPLP
FT                   DESETILSRILPGWEDALP"
FT   gene            531093..531566
FT                   /locus_tag="STHERM_c04390"
FT   CDS_pept        531093..531566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01411"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU7"
FT                   /protein_id="ADN01411.1"
FT                   /translation="MGNGLVRVLSHPVFLSGFLSWFCAQVIKLLVEALKRRRRLASPLL
FT                   PVVLWKTGGMPSSHSALVTALATSIGFHDGADSSLFFLSVFYAAIIIRDAVGVRKAAGQ
FT                   QAQVLNRLGEGVQERLGVEFTPVKEVTHGHTFPEVGVGMVLGFSIALVVSLLS"
FT   gene            531577..533037
FT                   /locus_tag="STHERM_c04400"
FT   CDS_pept        531577..533037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01412"
FT                   /db_xref="GOA:E0RPU8"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU8"
FT                   /protein_id="ADN01412.1"
FT                   /translation="MPRREVQEVRAYWSGVGGGVLFVGALVLMIFLSGGSGGWEGVQVL
FT                   GIRESVAPEVVVEALERRGLGPVVWEGSQEVELWEGRELGRYRLRDLPSRLDPADPRYD
FT                   PYLSWLPSMFEGRVGEEVVSLLYVPQRHGALWFLFEVLPVLRAFPGKVVLMGQGWPVRL
FT                   FLAGVFLGLLVWWAWGRWGVWAVAGGVGWVVSVGTGGVGMVPAAASGMVSFLLLLPPVA
FT                   EMLERGVLWGWRWEEWGGVVWWGVIHLTVVVGWAVFLGSWEVAAALLVECGVVGMMVAY
FT                   FTWWRSRLSHRVFRPVPLRRRTRTDAGRSLSRWGWGLFLLVCATVAAGAGLAGGEVRIP
FT                   LPGEGPWWQGAGGYLAHRAFQEGFLFNVPFEMPMRGDAVILPRLRIEGDEVVREDEVVL
FT                   RFDEAWFRRVEDLPPHRIERLFLQAGVETSFVGSPTRVQWRWPVQAAGLLVLLLLLLPE
FT                   VLKRGAGLTFETRYGMRAAIRKEGRQVA"
FT   gene            533034..534356
FT                   /locus_tag="STHERM_c04410"
FT   CDS_pept        533034..534356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04410"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01413"
FT                   /db_xref="GOA:E0RPU9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E0RPU9"
FT                   /protein_id="ADN01413.1"
FT                   /translation="MRSLLAGRMRGGLEFRSYVQTVDRRVVNASLPKVVVIPLAWGMME
FT                   ASHPVVKPGDEVKEGQLLAKPASVMGAPLYSSVPGRVRDIVPVSLPEGEREAVILDLAG
FT                   TFERRAKVRTSDWADMTPEKLWKRLFSSGVIRHGNVPLPIGRFLPPPGRKAEALVCACF
FT                   SAEPWRYTEELLLDLRREAVAEGLRILVRTVMPKEVHLVVPEEERTISRLLVRDLGDPG
FT                   IPVRVHHVARRYPFTSDEMLLELVGGARLTWGRLPVDEGFVIAEPSTLLAVRDAVVGGR
FT                   PVLEQVVLVGGDAVQRPVLVKVRLGMPVFDLLSQEGTMLGPDADPRVFLGGPLSGREVS
FT                   WLGAPLLPGVDVVTLLGRGATGGEEPCIHCSRCAQVCPRGLEPWLLHEALGRGDGRLLT
FT                   GGAIEGCIGCNLCSFVCPSAIPLADRFRDYLEKEREGHGEG"
FT   gene            534343..535374
FT                   /locus_tag="STHERM_c04420"
FT   CDS_pept        534343..535374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01414"
FT                   /db_xref="GOA:E0RQ30"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ30"
FT                   /protein_id="ADN01414.1"
FT                   /translation="MERVDGGRLVLGSRQVYERKKVLALLPVVGGMAVLFGPEGLLTTA
FT                   STVVGSLGADLLMAQLLSRKARPSWDAVGLGLLVGLFLPPGLHPVAGFLAAVFGQVVAR
FT                   WTFGGPARAWFHPAVAAVLFAVVSFPFDAGSYLPPLFGDRVQGLPLFVEAKRLLSGLRG
FT                   GSILQVVGLTPSAIDVRVTGVLNDVIFVPLRSYLPDGYVDLALGNVPGAVGAQMGLFVF
FT                   LGALFLVYEEVVRVDLPFLFLGAYTLLVFVAGRGPEGGADVLFYLGATDVVLAAFFLIP
FT                   DEVSRPSRAGLLPWYAVAGGLLAGFFALGGVFPYPGLLCAAVLNLTVPLVDHLSVARVG
FT                   GRA"
FT   gene            535371..535877
FT                   /locus_tag="STHERM_c04430"
FT   CDS_pept        535371..535877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01415"
FT                   /db_xref="GOA:E0RQ31"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ31"
FT                   /protein_id="ADN01415.1"
FT                   /translation="MRHVLDQRFDVGLVVLFFLSTLALIGSGYVFLGGRLEDRDAGGVR
FT                   LVLGGEGLQVEEMGLPLSAGSVYRVSGDGEAVWAVSLPVLWREAGLVVVLYDGTGAVVD
FT                   VRFPYGLEAGGDDPYDTDRLRRLLLDRSARRLWHEVKGVDPLLLRKVEEAVRLGRSLLE
FT                   EGGLL"
FT   gene            535878..536486
FT                   /locus_tag="STHERM_c04440"
FT   CDS_pept        535878..536486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01416"
FT                   /db_xref="GOA:E0RQ32"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ32"
FT                   /protein_id="ADN01416.1"
FT                   /translation="MERAGFFHGNILLVAGCGLAPALALTTRFGYGLLLGLVAWGLLLF
FT                   LSLLFSSFREYLRNREMQLAVFFIVGGTTVSLMELGFRAWAPEVLRVLGLYLPVLVVGS
FT                   LVWGYGVAYGLSYRPKRTFRMAMRVGGGYAAAVVVMAFVRELLGYGALSLVPFADAALV
FT                   VPGLGDLPLRAAVAPAGAFFVFGYLAALVRLAGRDGDAR"
FT   gene            536476..537057
FT                   /locus_tag="STHERM_c04450"
FT   CDS_pept        536476..537057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01417"
FT                   /db_xref="GOA:E0RQ33"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ33"
FT                   /protein_id="ADN01417.1"
FT                   /translation="MPADALLYLGPSHLAFAFFLGLSLLFSGVSRVRDALFLGGVVTGL
FT                   LLLAGLYQYVLERWVLSVLDVRAFRFMGFLLGFGGVLVLLFLLLRRVAPGEDGRWLELV
FT                   RRGDLVALVLGGVLVVLEGEGSLGWSLWGLLWAGVGFTAGLLFFVGILHRVEGPEVPGP
FT                   LRGLPVRTVCAGLVALVVEVTGYALYPLFV"
FT   gene            537067..538155
FT                   /locus_tag="STHERM_c04460"
FT   CDS_pept        537067..538155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01418"
FT                   /db_xref="GOA:E0RQ34"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ34"
FT                   /protein_id="ADN01418.1"
FT                   /translation="MAERDVVFMRRALALARRAEGRTSPNPMVGAVVVKDGRVVGEGFH
FT                   ERAGLPHAEVAALSEAGEEARGAEMYVTLEPCCHWGRTPPCTDAILKAGVRRVVVACRD
FT                   PNPQVAGKGLSILAEAGVEVEVGVLSREARWLNRGFISRMERGRPWVVAKVAASLDGRI
FT                   ALPDGRSKWITGEEARWEVHRLRAGSDVLVTGIGTVLADDPAFTVRVPGGEGRDPGVVV
FT                   LDTRGRLPVGARVVREGTVVMVGPGVDAGWRGEVERRGVRVVEVGIRDGKVDVQAVSRW
FT                   LGEEGVNVAMVEAGAGVTGAFLEAGMVDELVVFVAPRVLGEGRGWVEGRVVEGLGEREW
FT                   EVREVRRVGEDVMVRCVRRGWV"
FT   gene            538180..538821
FT                   /locus_tag="STHERM_c04470"
FT   CDS_pept        538180..538821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04470"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01419"
FT                   /db_xref="GOA:E0RQ35"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ35"
FT                   /protein_id="ADN01419.1"
FT                   /translation="MFTGIVREIGVVREVRKEGGGLVVRVEGPGVVGVLEVGASVAVDG
FT                   VCLTVTALDERTFLADVSYETAARSTLGGVRVGRRVNLEPALAVGERLGGHLVSGHVDG
FT                   VGRVMVRERRSGGEYFAFWVPPELRKYIASKASVAVDGVSLTVAEKLPEGFSVVVIPHT
FT                   LAVTTLADRRRADMVNLECDILAKYVESLLLEGGPGTGDLTIERLRDLGF"
FT   gene            538894..540192
FT                   /gene="ribA"
FT                   /locus_tag="STHERM_c04480"
FT   CDS_pept        538894..540192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="STHERM_c04480"
FT                   /product="riboflavin biosynthesis protein RibA"
FT                   /EC_number="3.5.4.25"
FT                   /note="includes: GTP cyclohydrolase-2 (GTP cyclohydrolase
FT                   II); 3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01420"
FT                   /db_xref="GOA:E0RQ36"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ36"
FT                   /protein_id="ADN01420.1"
FT                   /translation="MANEETHDIFASIEEAIEEFRAGRPLVVVDDEERENEGDVIVAAE
FT                   KITPELVNFMAKEARGLICVAITEERARELDLEPMTPENQDTLETAFTVSVDAVGTGTG
FT                   ISAHDRALTTRKLVDPEARPEDFRRPGHVFPLRAKPGGVLRRAGHTEAAVDLARLAGLY
FT                   PAGVICEIMKDDGSMARLPDLVDYCRRHGLKLISIAQLIDYRRRQEKLVRREAEALLPT
FT                   KWGEFRAIAYTEVLTGETHLALVKGDVAGKQDVLVRVHSECLTGDTLGSLRCDCGQQLA
FT                   AALERIEKEGLGVLLYMRQEGRGIGLANKIKAYALQDQGHDTVQANIALGFPPDLRDYG
FT                   IGAQILVDLGLSSIRLMTNNPKKIAGLSGYGLKVTKRESIEVPPNPRNQYYLETKKIKM
FT                   GHLLAVVQGKDASSEPLHQGNVRTGGDPHEEER"
FT   gene            540189..540659
FT                   /locus_tag="STHERM_c04490"
FT   CDS_pept        540189..540659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04490"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="riboflavin synthase beta chain; lumazine synthase;
FT                   DMRL synthase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01421"
FT                   /db_xref="GOA:E0RQ37"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ37"
FT                   /protein_id="ADN01421.1"
FT                   /translation="MNPGKIVEGKLIGKGLSFAIVASRFNEFITTKLIEGAMDALVRHD
FT                   VDPAQVDLVWVPGSFEIPLTAKRLAASGKYHAVICLGAVIRGATPHFDYVAAEVAKGVA
FT                   LAGLETGLPVIFGVLTTDTIEQAVERAGTKAGNKGWDAAVSAIEMANLFSQL"
FT   gene            complement(540722..541714)
FT                   /locus_tag="STHERM_c04500"
FT   CDS_pept        complement(540722..541714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01422"
FT                   /db_xref="GOA:E0RQ38"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ38"
FT                   /protein_id="ADN01422.1"
FT                   /translation="MRETRVLPATDEAIEEAARLLREGEAVAFPTETVYGLGANALDAV
FT                   AVARIFEIKERPLFDPLIVHIAEEGMLKEVVREVPSIARRLMARFWPGPLTLVLPKGER
FT                   VPGIVTAGLPTVGVRMPAHPVARRLIERAGVPIAAPSANRFGSLSPTRAGHVAGQLGGR
FT                   VALVLDGGACEVGVESTVVRVEGGRVRVLRPGGVAVEALEEAVGRGAVVVGGPEREGAQ
FT                   EAPGMLPWHYAPSVPVVVLEGGAMPGAEEAREAGLLAWREVPARPAFRAVEVLSPRGDL
FT                   QEAAARLFEGLHRLEEAGVARIYAEAVPEVGLGRAVMDRLRKAARRRPS"
FT   gene            complement(541711..542733)
FT                   /locus_tag="STHERM_c04510"
FT   CDS_pept        complement(541711..542733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04510"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamidesynthase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01423"
FT                   /db_xref="GOA:E0RQ39"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ39"
FT                   /protein_id="ADN01423.1"
FT                   /translation="MGSVKDLEVVKAPSDREPGEGRFRFSDRYSVFDWGKMPDDIAHKG
FT                   AAICIATAYFFERLAEEGIPSHYLGVVEDGRVVRLSEARGPVRELACRLFRVVRPSRRN
FT                   GEYDYGIFAGLSGNFLIPLEVIYRNSLPPGSSVFRRLASGALTHEDLGLAGPPEPGMRL
FT                   DPPMLDVSTKLEETDRYLSWEEAQRIAGLSEEEVSALKERTRFLDRLITEETRRLGLDH
FT                   EDGKVEYAFDEGRRLVLVDALGTLDECRFTYRGIPVSKEVARIFYRRTEWYRRVEEAKQ
FT                   EDRVHWKERVGMEPPPLPREFAQAISEMYMAYANELTGREWFRVRPLSEVLRVIGEFVG
FT                   "
FT   gene            542983..543567
FT                   /locus_tag="STHERM_c04520"
FT   CDS_pept        542983..543567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01424"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ40"
FT                   /protein_id="ADN01424.1"
FT                   /translation="MRVPLFLSIVVLAAGCVTTSGEDAVRTAEPAARPVSALPAGRPSS
FT                   PGHIEPPVLTPTEREEIRQAHLAALAQEIARLETLLSGDRQEDDAIATFISRLSEEKAR
FT                   LEREDPASYTPSSWVDLEGSFTGPFEFGQLFYYEGMTRSGPFYHLAGLKDGALSALREE
FT                   RPYRILAAVLCRRYYPFPSSYIFVYRWEALR"
FT   gene            543610..544758
FT                   /locus_tag="STHERM_c04530"
FT   CDS_pept        543610..544758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04530"
FT                   /product="probable monogalactosyldiacylglycerol synthase"
FT                   /EC_number="2.4.1.46"
FT                   /note="NtMGD1; MGDG synthase type A; MGDG chloroplastic"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01425"
FT                   /db_xref="GOA:E0RQ41"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ41"
FT                   /protein_id="ADN01425.1"
FT                   /translation="MHRILFLTVGVGGGHIAPARAMASALEARFPDRLAVEVVDLPRAA
FT                   GASRIDERLNRAWIQAARHPAPMRILYWLLTRLPRTGLEFARWHYRELFEAGIPYLVSR
FT                   SPDLVVSTHPLCSMVALEARADHGLRFPLLTYVVDPFDAYPWWAARGVDLFLVASEEAR
FT                   EGLVRYDIDPSRIRIAPFPVRPEILTPSATREEVCLSLGLGPDLPVLLCTGGGMGLGKI
FT                   GRYVEALVRARLPLNIVLLTGRNRALYERMRPLSGPGSRLAVVEFTDRMADLYHTADLV
FT                   VGKAGASTAMEALVVGRPMLFTEWIAQNDYAIIRYFLDHGYGWYIPGVRDSLRFLSRAD
FT                   LPARVAHARARIQEAGFTTGVYQIADLIASILEGGGEPLPSA"
FT   gene            complement(544748..546088)
FT                   /locus_tag="STHERM_c04540"
FT   CDS_pept        complement(544748..546088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01426"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ42"
FT                   /protein_id="ADN01426.1"
FT                   /translation="MAGYDRPANDDNLSAWVVTVDMGLGHQRAAAPFAPIAEEGIITVG
FT                   SISATDQSERALWLRMQRTYEFLSRVRSVPVIGPPLFGILDALQNIPPLYPFRDMSAPS
FT                   YQVKLLSSLIRKGLCKGMIEKVKEKPLPILATHPAPALAADMAGFPRVYCIVCDAEVSR
FT                   AWVAENPRESRIHYMVPCGRALRRLKLYGVPDERIFLTGFPLPLEVLGDENLSTLTQDM
FT                   GQRLHYLDPNNRFWPLHEMNVRHFLGRSNLKWRKERVFTVTFAVGGAGAQVEIGCAILK
FT                   SLRKRIAAGEVMLNLVAGVREEVRRIFEEEKARWAPDSPLVQVVYAPTKEAYFARFAQV
FT                   IRRTDVLWTKPSELSFYAGLGIPIIMAPEIGAQERYNKAWLMEIQAGIPQEDPAYTDQW
FT                   LWILLEEGRLAESAWDGFLKARKYGTYKIMEVLKTGTMVRETSPLKR"
FT   gene            546187..546867
FT                   /locus_tag="STHERM_c04550"
FT   CDS_pept        546187..546867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01427"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ43"
FT                   /protein_id="ADN01427.1"
FT                   /translation="MIGTFKDVREHERLLRKAVRHLARHRTREALSLLKRCVTLCPSEE
FT                   KSFLGRAFHLLGISLRRMGACGPALRAWLAAYRIRKGPRLRRRILSSLNEYGMLKQDTP
FT                   EQDDWKAFYAIQVRRYLSSKRSAHFSSRAEKDMIDQLIWEYWRDVRRMYDLSSLSTAQK
FT                   LQVFHDVEIVFPWMVFIPPEATPLDVPTPGCTPGRKCTCGSGLPFTLCCGRTKNPDELW
FT                   IGSF"
FT   gene            547001..547912
FT                   /locus_tag="STHERM_c04560"
FT   CDS_pept        547001..547912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04560"
FT                   /product="RNA polymerase sigma-70 factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01428"
FT                   /db_xref="GOA:E0RQ44"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ44"
FT                   /protein_id="ADN01428.1"
FT                   /translation="MDFASIAAEEAMETVKRKKKRRVQDSGDANVLSLYLKEINRIPLL
FT                   TREEEDHYARLAAQGDQHAKEKLVTANLRFVVNVAKKYQNQGLPLADLISEGNIGLLNA
FT                   IERFDPDKGYHFISYAVWWIRQAILKAISEKSRMIRLPLNRANELVQIEKARKLVQTES
FT                   GEHNEIKKVAETLDYDEDHVANLLNLSKEYVSLDTPVYEDRDSAMLGDYLKDEASRPPE
FT                   DVVLEKTLQEEIQEVLATLTEKEAEIIQYRFGLNGRHPMSLKEIGDLYNLTKERIRQIE
FT                   KKALKKIQQSEKAKILETYLAS"
FT   gene            548148..550811
FT                   /locus_tag="STHERM_c04570"
FT   CDS_pept        548148..550811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04570"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="pyruvate, orthophosphate dikinase chloroplast
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01429"
FT                   /db_xref="GOA:E0RQ45"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ45"
FT                   /protein_id="ADN01429.1"
FT                   /translation="MSPKYVYFFGQGKAEGSAKMRDLLGGKGANLAEMTSIGIPVPPGF
FT                   TISTEVCELYYKNDKQYPPEVREQVEEALAKLEKAMGRKLGDPENPLFVSVRSGAAISM
FT                   PGMMETILNLGMNDQTVEGFARQTGNPRVAWDSYRRFIQMFGSVVKGIPHEEFEKVLEG
FT                   LKQERGVELDTELTADDLKELVSRYMKLYKEKVGEEFPQDVKAQLWAAIDAVFDSWDNE
FT                   RARKYREINNIRGLKGTAVNVQAMVFGNFGDDSGTGVCFSRDPSTGENVFYGEFLMNAQ
FT                   GEDVVAGIRTPEKLSGLAEKMPEVYAQLEEVKNRLERHYRDMQDMEFTIEKGRLFLLQT
FT                   RNGKRTGRAAVKIAVDMVKEGLISREEAVMRVSPEHIDQLLHPMLDPEAKKKARALAKG
FT                   LNASPGAATGKIVFTARRAEELAGVEKVILVRKETSPEDIGGMYAAQGILTSTGGMTSH
FT                   AAVVARGMGKPSVVGCKDVVILDEGRCEIGGREFKEGDWITIDGTTGEVFEGQIPLVVP
FT                   EIRGELQEFLGWVDEIRLSAVRENCPEKGFRVRTNADTPQDARRAREFGAEGIGLCRTE
FT                   HMFFDKGKIEAFREMIIAEDLEARKKALEKLLPLQKEDFVGIFHEMAGLPVTIRLLDPP
FT                   LHEFVLMSETEIEELSRSSGVPAEKIRQRIEALHEMNPMLGHRGCRLGITYPEIYEMQA
FT                   RAVMLAACEVAKEGKPVYPEVMIPLVGMEKELVFLKERIVKVMEEVKSSSGVQVSYRVG
FT                   TMIEVPRAALVAEKIASHAEFFSFGTNDLTQMTFGFSRDDVGSFLPAYLQMEILETDPF
FT                   ASLDEEGVGQLVKLAAEKGRKARPGIKLGICGEHGGDPASIDFAYRVGLDYVSCSPFRV
FT                   PIARLAAAQAVIRNRK"
FT   gene            550890..551651
FT                   /locus_tag="STHERM_c04580"
FT   CDS_pept        550890..551651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01430"
FT                   /db_xref="GOA:E0RQ46"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ46"
FT                   /protein_id="ADN01430.1"
FT                   /translation="MITRGCDGEGVEVEKASAAARTIPRLYDILFSWYGPQGWWPLLSK
FT                   AGTPGYDDEGYHPGIYEVPDGMGAFEIAVGAVLVQNTAWTNARRALAVLLERSLCSPER
FT                   ILGLEEEALARLIRPCGYYTLKARRLAHLARFFLSCDGLPERNALLGVWGVGRETADSI
FT                   LLYGYGVPVFVVDAYTRRIFSRLGLLASDDTPYEEVRSAVEEAVPPDHVCYNEFHALLV
FT                   EHAKRFCRKRPLCGECPLRLECAHLSSAGGS"
FT   gene            551771..552589
FT                   /locus_tag="STHERM_c04590"
FT   CDS_pept        551771..552589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04590"
FT                   /product="D-mannonate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01431"
FT                   /db_xref="GOA:E0RQ47"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ47"
FT                   /protein_id="ADN01431.1"
FT                   /translation="MKMQPLWDLSDEVVVITGGTGMIGKAFAVALAGSGAKVAIWGRGK
FT                   TVPVEASVEEVKERLEGEGEVIGCAVDTGDMEAVERGFQEVEERLGTPTVLINGVGGNR
FT                   GKAGFLEMDVSWFEDVFRLNLMSGMVIPTQVFGRRWVEKKVQGSVVNIASMASYKPLSG
FT                   VYAYAAAKAAVMNLTMGLAKELAPHGIRVNAIAPGFFVGHQNRELLYDDYQAGKLSDRG
FT                   RQIIARTPFGRFGEEEDLYGAVIFLASRKASGFVTGVTIPVDGGFLVDNI"
FT   gene            552608..554017
FT                   /locus_tag="STHERM_c04600"
FT   CDS_pept        552608..554017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04600"
FT                   /product="uronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01432"
FT                   /db_xref="GOA:E0RQ48"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ48"
FT                   /protein_id="ADN01432.1"
FT                   /translation="MRAFMDENFMLQGEVARELYHETAASLPIYDYHTHLPPEAILEDR
FT                   IFEDLGEVWLGGDHYKWRAMRSFGIPEDLVTGSASFKEKYLAWARTVPFLVGNPLYHWT
FT                   HLELKRYFGIEDVLSPQTAERIYQEATSLLRTPEFSVRNLLRKMGVKVVCTTDDPVSDL
FT                   APHRALAEEGFEVKVLPTFRPDKALDYGDPGRWNAYIEELAHAAGMRIANLQDYLEALE
FT                   RRVAFFHSVGCRISDHAMVAPVYREAPESTIRAAFVRLREGRALEREDQEALYTHTMRF
FT                   LGRLYAEREWAMQIHMGALRNNSTRMFQTLGPDTGFDSIADRAIAEPLSRFLDSLDREG
FT                   RLPRTILYVLNPRDNYVIGTMIGNFQDGSMPGKMQFGSAWWFNDQRDGMEAHLRALANL
FT                   GVLSTFVGMLTDSRSFLSFPRHEYFRRIFCNLLGGWVEAGEYPYDRETLRTIVEGVCYR
FT                   NACSYFTIPVE"
FT   gene            complement(554022..554720)
FT                   /locus_tag="STHERM_c04610"
FT   CDS_pept        complement(554022..554720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04610"
FT                   /product="lipoyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="lipoate-protein ligase B;
FT                   lipoyl-[acyl-carrier-protein]-protein-N-lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01433"
FT                   /db_xref="GOA:E0RQ49"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ49"
FT                   /protein_id="ADN01433.1"
FT                   /translation="MQNTLCVTWLGRQPYRPVWELQHALRRKRAAGTIPDVLLLLEHDP
FT                   VITMGTRETSHEILLPPEELASRGVAVLQVERGGEVTYHGPGQLVAYPILSLRHHPRSV
FT                   KKLVHHLEEVGIRVVARYGIRAERDPRYPGLWVEDRKIMAIGIAIREGITFHGIALNVH
FT                   TDLEAFSWIVPCGIRDRGVTSIARETGKQLSVEEIARAWEETFLEVFGYRGERVSLQEL
FT                   LEGEVQPAEE"
FT   gene            554757..556349
FT                   /locus_tag="STHERM_c04620"
FT   CDS_pept        554757..556349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01434"
FT                   /db_xref="GOA:E0RQ50"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ50"
FT                   /protein_id="ADN01434.1"
FT                   /translation="MSIPQKPKSSHWADVTAFRIIKEKGDKPRYVCASGITPSGTVHIG
FT                   NFREIISVELVVRALRDLGKDVRFIYSWDEYDVFRKVPKNMPNREDLETYLRMPITMVP
FT                   DPWGKEESYARANEKEVEAILPEVGIFPEYIYQAKEYTSCRYAEGIRRALERRDVIRRI
FT                   LDKYRAEPLPDSWWPVVIFCASCHKDTTTVEHWDGTYGLSYTCSSCGFKEALDFRRQGN
FT                   VKLRWRVDWPMRWREEQVDFEPAGKEHHSDGGSFDTAKQIVREVYDHEPPVTFKYDFIG
FT                   IKGQGGKISSSTGNVISLKDVLEVYQPEVVRYLFAGTRPDTEFAISFDLDVIKIYEDYD
FT                   KCERIYFGKEQVDPKKLERERRTYEFSQVERAPASMPLQVPFRHMTTLVQIYEGDLDAL
FT                   MAQEFPSVSGEEARRLRRRAQCAWNWVTTYAPEEFRFSLRVGDESIEDLPVAHRRVVQR
FT                   LYHLLADGWDSLDEVKLGEAIYAFCEEEGIAAREFFPSLYRVLLGKDRGPRAASFILTV
FT                   GKEKILTILGRYL"
FT   gene            complement(556359..558059)
FT                   /locus_tag="STHERM_c04630"
FT   CDS_pept        complement(556359..558059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01435"
FT                   /db_xref="GOA:E0RQ51"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ51"
FT                   /protein_id="ADN01435.1"
FT                   /translation="MKRIDLHVHSIHSEHPSEWFMQRLGAKESYTDPETVFRMALERGM
FT                   DFVTITDHNRIEGALLLKARYPDRVIVGVETTTYFPEDGCKIHLLLYGLDEHRFRMVEK
FT                   LRPNIYRLRDYIREEGIAHSVAHATYPVNNRLTVAHLEKLILLFDVFEVINGGRNSYFN
FT                   NAWKEVLLSLTPAHIERLQRKHHIAPFSSTPWVKGFTAGSDDHGGLFIGNTYTLVEAHT
FT                   PEEVLDHIREKRTQAAGAHGSYRSLVFSVYKVAYDFLTSGGGGGGRSLFLSLSRQIFEG
FT                   ARPSLRERALYSHLRRKLRGQKMGEILDELVRDISGKETALSEARLERVFLHVRRVSDA
FT                   FLRMLAGRVAGALLDGDLVDLLVGLSSSLPGLYLIAPFFSSLRHMYAHRDLVEGIRSSL
FT                   GIQNSPSAASRVLWFSEDGRPDPSVIRILAPRAHVLPVTPSASLPGTSLPIVAEIPLDP
FT                   GFSLPLPSPLGAAELLSREQPDHLVFTAADPVALVCLFLGRLIGASTTFVFDPRGEGHP
FT                   VAHTLTTHLLRHTERIVVHTEEAAARAEGEGADPAKIHLAPPAAEPVGV"
FT   gene            558392..558718
FT                   /locus_tag="STHERM_c04640"
FT   CDS_pept        558392..558718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01436"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ52"
FT                   /protein_id="ADN01436.1"
FT                   /translation="MRHSGPLRIVPDFSFPFSKVVISPHEGVDLGYISACYSVRFYVNV
FT                   SLDAFARGEGDGIQAQLFLDHNCKQGTVEISRALWEKLGKPRQAVLVADDTGQKVLFLT
FT                   KKPE"
FT   gene            558904..560463
FT                   /locus_tag="STHERM_c04650"
FT   CDS_pept        558904..560463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01437"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ53"
FT                   /protein_id="ADN01437.1"
FT                   /translation="MEPELFSEVLSSLPMEVAITDEGGRILWANEAFSLLTGYGRTSSS
FT                   MLIRQFLLMFAEDRPEVFVKGADGQLSLRILTRWSFHDGKKVVWSFERLVADPKGVLSS
FT                   RDSLTGLLGREWFFREAGSLLAGARFEGTSFVLMVIDLDGFKRINDLYGPEVGDEVLRI
FT                   VARRITGHLRAEDMVSRTGSDEFAVLLRDVADPAGIARRVLASIRERMVVGGHALSLSA
FT                   SIGAGVFPRDGLSLEELVAAADAALLTAKAHRDTVWFCTPEVRRRIMHRWDMERQVLDQ
FT                   VREGRIHLFYQPIVRVTSGMLAGVEALSRLRGEDGALVLPEEFVPILEEGKVIHLLGRK
FT                   VLALAVLQGELWKARGLFVSVNISPQEFLHPEFVDVVREVLDASGFPPELLMLEVTESS
FT                   LVGDVDRTVQVLSALRDEGIRVAVDDFGTGYSSFASLKRMPVDVIKLDRRFLHGVEESE
FT                   RDRAILEGMTHMAHGLGLEVVVEGVEREAQLEILRESGCDYVQGFLLGHPMRDVAISHL
FT                   VG"
FT   gene            560467..561219
FT                   /locus_tag="STHERM_c04660"
FT   CDS_pept        560467..561219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01438"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ54"
FT                   /protein_id="ADN01438.1"
FT                   /translation="MFVVSSVERDVSRLCVFAAARVVFAYVHCLRGEEGREWEYGVRFL
FT                   REALVEEGEVGGEGVEGALEGVRERAARRAWERQCGYRRRFTTPEVIGRVIEAARDVRE
FT                   AEVWTTGAVGFRVGVQRLASALHHAGEWAEVGGDRPGMGVLGEVRREVEAAGRRWGVVW
FT                   GVRFEGERLASALASMVGLGFGVERGDVGEVWEWVRGVDGRLGEWWGEGVGAEGEDVWV
FT                   RVLGVVVGWERRLQGVRGCGSPTKNPCT"
FT   gene            complement(561171..563291)
FT                   /locus_tag="STHERM_c04670"
FT   CDS_pept        complement(561171..563291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01439"
FT                   /db_xref="GOA:E0RQ55"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ55"
FT                   /protein_id="ADN01439.1"
FT                   /translation="MKQVAVVIVEDEAVIALDIKRRLEDLGYRVEGVFQNADECLEKIG
FT                   NLHPDVVLMDILLEEGQDGLVLAQRIYDEYGVPSIFLTAYSDSTTVERIKQVRGAIGYL
FT                   LKPFNEREMAVTIELSLFRHHLHRELEIQRTWLSSLFSSIGEAIILLDEDGGILFLNPG
FT                   AEELIDATSNEAVGKPLVEFIRFYDVDTGEEIPFLSLAQESRGREGGIIFDHIYLLTST
FT                   GERIFVQGTISNLTGGLQTGNRGGSGRTEDEEHPYPLPFPSVSSGGFVLVLRNITEVRR
FT                   LSTIVRYQSVHDPLTGLLNRSQLLTSLQESLRQADPDTPLDTFAFLDIDQFKVVNDVFG
FT                   HIGGDVLLKETADLLRKKLPDESTIARIGDDEFGIILRGVKSGDAERILRRLVTSLRRS
FT                   FIWEDKTLPVTVSIGAVAITPRHGDIYRVLAAADAACAVAKEEGGNRLRIVSPEDTDVQ
FT                   HRLGELHWIARLQQAIREERLTLYAQDIIPLGAHNGFPKKEILVRLKEEETLILPGEFI
FT                   PVAERYNLMPLIDRWIIEAVLQYGTSTPDHRDTVFAVNLSSATLLDEGFPDFFLRRLKE
FT                   TQFPPSRLCLEITETTAIRNFRKASLFIRRFREMGCSFALDDFGMGFSSFAYLKHLPVD
FT                   FLKIDGSFVQTIVENEVDYQLVKSIHTMGKIMGKKTIAEFVSSREIYEKLATIPVDYVQ
FT                   GFFVGEPHPLTP"
FT   gene            563336..564166
FT                   /locus_tag="STHERM_c04680"
FT   CDS_pept        563336..564166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01440"
FT                   /db_xref="GOA:E0RQ56"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ56"
FT                   /protein_id="ADN01440.1"
FT                   /translation="MDAKVKFKETQDLRGRDLSEFLESLYAAYTKEDLLPTDPVWWVHR
FT                   YRDRGEQEVAGWVAASLAVGKVEAIHRSLGILFERIHPGEVTRLSYRDALRRLRGLSHR
FT                   FFSSEMLASFLAATGEILREWGDLETWAASCRNRAEGDMRKTFRLMSALFRECAPGDIG
FT                   ILLPLPRSGGPWKRVCLFLRWMVRRDAVDLGLWSSFPPESLLMPVDVHILRVSRRLGVA
FT                   GLSASPSFRAAERITSFFRSLSPRDPLRYDFALTRWSMGVEASFVPKTGRSILH"
FT   gene            564215..564790
FT                   /locus_tag="STHERM_c04690"
FT   CDS_pept        564215..564790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04690"
FT                   /product="rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01441"
FT                   /db_xref="GOA:E0RQ57"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ57"
FT                   /protein_id="ADN01441.1"
FT                   /translation="MKSVRGTRTEKNLLIAFAGESQARMRYTYFASQAKKEGYVQIALI
FT                   FEETANQEKEHAKRFFSFLEGGDLEITASYPAGRIGTTAENLRMAAEGEHHEWSSMYPE
FT                   FARVAREEGFEGIAKLFEHVSVAEKQHEKRYRDLLENIEKGRVFKREKPVMWRCINCGY
FT                   IVEAEEAPKQCPACAHPQAYFELLGENW"
FT   gene            564883..565047
FT                   /locus_tag="STHERM_c04700"
FT   CDS_pept        564883..565047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04700"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01442"
FT                   /db_xref="GOA:E0RQ58"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ58"
FT                   /protein_id="ADN01442.1"
FT                   /translation="MKKYVCDVCGYIYDPAEGDPDNGVDPGTAFEDLPDDWVCPMCGAP
FT                   KEDFSPYEE"
FT   gene            complement(565094..565552)
FT                   /locus_tag="STHERM_c04710"
FT   CDS_pept        complement(565094..565552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01443"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ59"
FT                   /protein_id="ADN01443.1"
FT                   /translation="MPEKEGKLSVLVLCTGNSCRSQMAEAWIRHFHGDRISVHSAGIEA
FT                   HGLNPYAVKVMEEAGVPLSGHTSKTMDELPVKEFDYVITVCDHAREACPYFPARVKVLH
FT                   RGFDDPPSLTRDETDEERRLAVYRRVRDEIREFARTLPAFLGLSDQGA"
FT   gene            complement(565576..566550)
FT                   /locus_tag="STHERM_c04720"
FT   CDS_pept        complement(565576..566550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04720"
FT                   /product="acetyl xylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01444"
FT                   /db_xref="GOA:E0RQ60"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ60"
FT                   /protein_id="ADN01444.1"
FT                   /translation="MAFYDLPLEQLLTYDPGEEAPEDFLAFWESTLEEKAPEGGKILSL
FT                   EERPDFHLQVFRVFDLAFSGYGGQPVRAWYILPRDAGKRLPCVVEYIGYGGGRGYPYHW
FT                   LTFPSAGYAYLVMDTRGQGSSWIHGDTPDLPDEGSNPSRPGFMTQGILSRETYYYRRLM
FT                   TDAVCAVEAAARLEEVDPDRIAVTGGSQGGGLALAAAGLSRRVALCLPDVPFLCHYRRA
FT                   VTITDREPYSEIRDFLKVHRHREEQVLTTLSYFDGIHFASHARARAYFSVALMDTICPP
FT                   STVFAAYNRYAGPKKIEVYTYNDHEGGQQHHLYRKLAFLRESL"
FT   gene            complement(566693..566766)
FT                   /gene="trnM1"
FT                   /locus_tag="STHERM_c04730"
FT                   /note="tRNA-Met-CAT"
FT   tRNA            complement(566693..566766)
FT                   /gene="trnM1"
FT                   /locus_tag="STHERM_c04730"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            566781..568118
FT                   /locus_tag="STHERM_c04740"
FT   CDS_pept        566781..568118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01445"
FT                   /db_xref="GOA:E0RQ61"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ61"
FT                   /protein_id="ADN01445.1"
FT                   /translation="MCVKSPLCQDREKTLTAMVNRTIFIKKIKNKEPVMNATELFPGIW
FT                   HLGANISKDNLFEGMWPIPHGVSLNSYLVEGKDIALIDLVRDWEDAPGEIEKQLGQLGV
FT                   DIQRIRYLVLNHLEPDHTGWVPGFKQRNPGVEIVTTKKGAELVDTFYHITDNVRVVKTG
FT                   DSIDLGGGKVLRFYEIPNVHWPETMATYEVSSKALFPCDAFGSFGKIGDRIFDDQLSEE
FT                   EHAFYEFESLRYYANIVASFSPFVERAIKALEGLEISAICPSHGIIWRRHPERIVERYA
FT                   RYASYYKGPAEPEVTLIWGSMYDNTAAATDAVREALLESGITFHEYRVPEQDFSHILAH
FT                   AWKSQGLILGMPTYEYHMFPPMAHTIDILGRKHVRGRTVFWYGSFGWSGGAEREFNELA
FT                   ERHKLGWEVVGKADFRGNPTAEDLSRLKREVAAFVEKVRERARTSA"
FT   gene            complement(568210..569583)
FT                   /gene="asnS"
FT                   /locus_tag="STHERM_c04750"
FT   CDS_pept        complement(568210..569583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="STHERM_c04750"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="asparagine--tRNA ligase; AsnRS"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01446"
FT                   /db_xref="GOA:E0RQ62"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ62"
FT                   /protein_id="ADN01446.1"
FT                   /translation="MDIVRQRIRDLFRLPPEGQRLEVYGWIRSVRESKQVAFLHLSDGS
FT                   TTAPLQVVVDTQRPDLASVLKELRTGAAVKVEGTLRPSPGTKQPVEVHAEALTVLGPAP
FT                   EDYPLQKKRHSFEFLREIAHLRPRTNTIGAVMRVRNTLAWEIHRFFQERGFLYVHTPII
FT                   TTGDAEGAGALFRVTTLPPDAPYDPTEDFFGAPAFLTVSGQLEAEAYALAFVNVYTFGP
FT                   TFRAENSHTPRHLAEFWMVEPEMAFCDLEGDMHLAQEFITHLLKAVLERHPEEMAFFEQ
FT                   WIAPGITDQLEAVVNTPFTHMTYTEAVEHLRKAPVSFTFPPEWGMDLQTEHERYLTEEL
FT                   VKGPVIVTDYPKEIKAFYMKQNPDGRTVRAMDVLVPRLGEIIGGSQREDDYERLLARMQ
FT                   ELGMRIEAYQWYLDLRRYGGAPHAGFGLGFDRLVQYVSGMQNIRDVIPFPRTPGNAAF"
FT   gene            569721..570674
FT                   /locus_tag="STHERM_c04760"
FT   CDS_pept        569721..570674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01447"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ63"
FT                   /protein_id="ADN01447.1"
FT                   /translation="MWRRGALVVLVGVLAAGLLPAGGASEHEAVPDEVRLTLFLGPTAL
FT                   GFIPLLEAGEVAGVPLSYELVPQPDVAVSRILAGETDVAALPVNLAARLYNGGADYRMA
FT                   AMYLWGLLYLVAPEPVTLEGLAGRRVYVPGKGATPDLVFRFLLEKRGVEGVELDYSLPP
FT                   AGLAQAVAAGKVDYALLPEPFVSRVLALREDLVVAFDLQAEWEREVGTPLTQTCIVVKG
FT                   EFLQEYPVFWKEVRRAIEESIHQVVADPDGATSSPVVEKLGLTSEIARAAIPRCRLSFV
FT                   PAREARQAVEAYLGVLLEYAPGSVGGALPPAEWYVE"
FT   gene            570753..572414
FT                   /gene="apgM"
FT                   /locus_tag="STHERM_c04770"
FT   CDS_pept        570753..572414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apgM"
FT                   /locus_tag="STHERM_c04770"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="phosphoglyceromutase; BPG-independent PGAM; iPGM"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01448"
FT                   /db_xref="GOA:E0RQ64"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ64"
FT                   /protein_id="ADN01448.1"
FT                   /translation="MEIKVDPLKKNPAFTPRRGPLVLLILDGVGFSRYEEGDAFRRALT
FT                   PHFDWLWEHCPHTTLKAHGTAVGLPSDGDMGNSEVGHNAIGCGRVYSQGAKLVDEAIAS
FT                   GRLFEGPVWRKLIDNVKKNESTLHFIGLFSDGNVHSNIAHLKAMLEQAKREGVKRARIH
FT                   ILLDGRDVGETSALEYVDPFEEFLAQLNKEGVDYRIASGGGRMVITMDRYGANWDMVRR
FT                   GWEIHVLGEGRQFSSAHEAIETLRKETGAIDQDLPPFVIAEDGKPVGPIQDGDSVIFFN
FT                   FRGDRAIEMSMAFEMDDFPYFDRKRRPKVEYAGMMEYDGDKHIPRQYLVAPPSIDRTVG
FT                   EYLAASGVTQMAVSETQKFGHVTYFFNGNRTGKFSEELEEYIEIPSDIVPFEWRPWMKG
FT                   AEIAEEVIKAVKENRFRFIRANFPNGDMVGHTGVFQAAVCAMEAVDIQLGRIRKAVEEA
FT                   GGILLVTADHGNCEEMYEHDKKGNLVRNPDGTPKAKTSHTLNPVPFIIYDPEYQGDYDT
FT                   TLREGLGISSIGTTCIELLGFISPEDYTPGIVPVRR"
FT   gene            572565..573683
FT                   /locus_tag="STHERM_c04780"
FT   CDS_pept        572565..573683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01449"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ65"
FT                   /protein_id="ADN01449.1"
FT                   /translation="MKGNIIWCVIVCSIVFPFSLGAFDITVHPPKVSGTPEDGAVNAEL
FT                   ETLVESIEAEFVSELEDADIQAVSLVKGFATANAFASHAGSIRSVLDYGFMQVSLGASF
FT                   GFQNPTSVPFNIGSLYEAAEETFDVLAGGGIQLGAQVGINLSFLLPGLHGAIRLGKFAV
FT                   SVPLAESVSLDHDLTMVGLVFSYPILKGVETAGTGWSGVSIGAGAIYESLSSVYSRDFR
FT                   YYYEPSSFSGDYVTIESLEARPSVHLEMESSQVVVPLEVITGVKAVFMHVYGGLGMDLA
FT                   FGSSELRLSADPNFEVKGYIDATGEDLSSFVASEGSVEVKGSVTTAPVTLNPKLIMGTG
FT                   WFLGPVVLETSLLLYFNEGSGFSGGITIATMF"
FT   gene            573807..574979
FT                   /locus_tag="STHERM_c04790"
FT   CDS_pept        573807..574979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01450"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ66"
FT                   /protein_id="ADN01450.1"
FT                   /translation="MRRILAICTALLFVAGAAVGAEVKITPPTVDFGSNSSYDLIDAYV
FT                   NGVLKALAQQAESQLNEEIGAFEQPSFVEGMANAGIFASHVGVMRSRFEYGFLQVGAGI
FT                   AIGFQSPTANPFDVEGIGQAMAEGGDVFAGVGVQAGGQVGLNASFLKEGLFLGLRFGRM
FT                   DLTSLAESMGDALPEGLSGSLSVVGVLASYQLVKPVDLMLIRWRGVNIGSGLVYQGLEV
FT                   RYKADVDPVSYEQEINKDIDNGGYLETGTVTLTAVPTVEVGVQTGTVAIPLEVSTGMRV
FT                   LILNVSGGLGADLAFGSSKLLFDADARIEASGSITHGETGTKLYINNGTITPGSAVLDA
FT                   GTEGGPTFLNPKVFASVGLLLGPISLEIPFTYYINEGSGFNAGITLGLTF"
FT   gene            complement(575029..575715)
FT                   /locus_tag="STHERM_c04800"
FT   CDS_pept        complement(575029..575715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04800"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01451"
FT                   /db_xref="GOA:E0RQ67"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ67"
FT                   /protein_id="ADN01451.1"
FT                   /translation="MERLDLRTGVAPAVEWIAGVLGLYRDEPHLVVGLPGGRSVVPVLE
FT                   ALRERDDLPWDRCVFFLVDERCVPPGSPERNDALLERVFFRPLVEKRWITRDQVHPYEY
FT                   RGEAEDWGLEAYERALRGYREAFHLVVLGAGEDGHVASLFPRHPSIWDDSPFYIRVEEA
FT                   PKPPPRRISASKTLLESSEACLLLFMGEGKREAYRRFLDPELPLADCPAKLAFEVDRLA
FT                   VATDLG"
FT   gene            575806..575878
FT                   /gene="trnT1"
FT                   /locus_tag="STHERM_c04810"
FT                   /note="tRNA-Thr-GGT"
FT   tRNA            575806..575878
FT                   /gene="trnT1"
FT                   /locus_tag="STHERM_c04810"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   gene            575910..576080
FT                   /gene="rpmG"
FT                   /locus_tag="STHERM_c04820"
FT   CDS_pept        575910..576080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="STHERM_c04820"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01452"
FT                   /db_xref="GOA:E0RQ68"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ68"
FT                   /protein_id="ADN01452.1"
FT                   /translation="MAKKGKAVEIIALACSECNRRNYTTKKNRRLQGKLQLRKYCPFDR
FT                   KHTLHVETRVK"
FT   gene            576094..576167
FT                   /gene="trnW"
FT                   /locus_tag="STHERM_c04830"
FT                   /note="tRNA-Trp-CCA"
FT   tRNA            576094..576167
FT                   /gene="trnW"
FT                   /locus_tag="STHERM_c04830"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            576191..576370
FT                   /locus_tag="STHERM_c04840"
FT   CDS_pept        576191..576370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01453"
FT                   /db_xref="GOA:E0RQ69"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ69"
FT                   /protein_id="ADN01453.1"
FT                   /translation="MRKIIQFFKDVWAEMKRVTWPSWEDVQGSTQVVIVSVAIFALVLG
FT                   AVDLLLLFLLDVIF"
FT   gene            576386..576940
FT                   /locus_tag="STHERM_c04850"
FT   CDS_pept        576386..576940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01454"
FT                   /db_xref="GOA:E0RQ70"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ70"
FT                   /protein_id="ADN01454.1"
FT                   /translation="MARGWYVLHTYTGYENRVEKTLRKLMEEEPYSRYILDVKVPEEEV
FT                   VEVKDGKRKVTTRKFLPGYVLVELDLPDIGWRDVCAQIRRINGVTGFVGTTGQSKPHPI
FT                   SQEELRQILQKTGELKGERHLRFGETFSVGETVRIVEGPFESFTGTIEEVNEERRKLRV
FT                   LVGIFGRATPIEVDFLQVEKI"
FT   gene            577009..577440
FT                   /gene="rplK"
FT                   /locus_tag="STHERM_c04860"
FT   CDS_pept        577009..577440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="STHERM_c04860"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01455"
FT                   /db_xref="GOA:E0RQ71"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ71"
FT                   /protein_id="ADN01455.1"
FT                   /translation="MAKKEVTAVLKLQLPAQQATPAPPVGPALGPHGVSAPQFVQQFND
FT                   ATKNVEPGLIVPVVITIYKDRTFTFELKTPPAAVLIKKALGIEKGSAEPHKVKVGKLTK
FT                   EQLRAIAEQKMPDLNANDIEAAMRIIKGTARSMGVEVEG"
FT   gene            577442..578122
FT                   /gene="rplA"
FT                   /locus_tag="STHERM_c04870"
FT   CDS_pept        577442..578122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="STHERM_c04870"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01456"
FT                   /db_xref="GOA:E0RQ72"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ72"
FT                   /protein_id="ADN01456.1"
FT                   /translation="MARHGKKYLEAVKKYARQERYPLERAVELVKELSYANFDETVELS
FT                   VKVNLKKGQTVRGTVTLPHRFGQEKRILVFARGDKAEEAREAGATYVGDTDLVEKIQQG
FT                   WLDFDVAVATPDMMKEVGKLGPILGRRGLMPNPKVGTVTMDIKGAVENLKQGQVEFRAD
FT                   KTGVVHLAVGKVSMEPEKIVENVNAALDEMRHRRPADTKGAFIKSVTLSSTMGPGVKVK
FT                   WDER"
FT   gene            578133..578663
FT                   /gene="rplJ"
FT                   /locus_tag="STHERM_c04880"
FT   CDS_pept        578133..578663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="STHERM_c04880"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01457"
FT                   /db_xref="GOA:E0RQ73"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ73"
FT                   /protein_id="ADN01457.1"
FT                   /translation="MYTTRVTEKKRARVEEIKKILEEGKGYIFADYRGLTVEQITRLRN
FT                   ELRQQQAILKVVKNRFAKLAFSELEITGLDEVLLGPTVVAVAKEDPAVVAKTIFKYVNE
FT                   TPIKVKAGYIDGQLYGAQQVEAISKLPSRAELLATLMGTMNAPLQNLVYALNGVTTKLV
FT                   RTLKALADKMEQG"
FT   gene            578745..579131
FT                   /gene="rplL"
FT                   /locus_tag="STHERM_c04890"
FT   CDS_pept        578745..579131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="STHERM_c04890"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01458"
FT                   /db_xref="GOA:E0RQ74"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ74"
FT                   /protein_id="ADN01458.1"
FT                   /translation="MAKLSTEEILDAISQMTVLEVAELVKAMEEKFGVTAAAPVAVAAA
FT                   PAAGAAAPQEEEKSEFDVILKGVADGKKIPVIKVVREVMGLGLKEAKDFVEAPGKAVKE
FT                   GVSKQEAEELKKKLEEAGAVVEIK"
FT   gene            579256..582750
FT                   /locus_tag="STHERM_c04900"
FT   CDS_pept        579256..582750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04900"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01459"
FT                   /db_xref="GOA:E0RQ75"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ75"
FT                   /protein_id="ADN01459.1"
FT                   /translation="MFSRDTEVTRQLLTTGRPEVMDLPNLLEVQFSSYEKFLQAEKIRK
FT                   GEPLAVQGLEEVFRSSFPIESPNGDMRLEYDFYTLDFEAIKYSEEECKRKGLTYAVPLK
FT                   AQINLIFLETGEIRQKMIYLGDIPLMTDRGTFIINGAERVVVSQIHRSPGVIFSHEKGV
FT                   YGARIIPYRGSWLEFEVDAKKDLIYAKIDRKKRILGTLFLRALGFDTREKIISAFYETK
FT                   EVAVSPETKDAVVGRVLARDVCTGEGPDQKKLLRAGAKIHPHEMDELLHAGVERVWVID
FT                   DEHPDSLHSEVILNCFDREEAKYTREEEGIDEPTKEDAIIAVYSAIMPGDPITIENAEK
FT                   DLQAMFFSERRYDLGDVGRYKLNKKFDYDPPLSTTVLTLDDIVNTMRHLIKVYIGEEPV
FT                   DDIDHLGNRRVRSVGELLTAELKTAFSRMERIAKERMSLKESDTIKPQDLISIKPIVAA
FT                   IKEFFGSSQLSQFMDQVNPLSELTHKRRLNALGPGGLSRERAGFEVRDVHYTHYGRMCP
FT                   IETPEGPNIGLILSLALYARVNEYGFLEAPYRKVKDGRVTNEIEYLTAMDEEKYFIAQA
FT                   NAPIDEKGRFLTDQVSVRKGGDYTTRPPEAIQYMDVSPRQIVSASASLIPFLEHDDANR
FT                   ALMGSNMQRQAVPLIFPEPPRVGTGMERRCAYDSGVVVKARRAGVVEYVSSTKVVIKPD
FT                   GVTDERERDIYFLQKYQRTNQDTCFNQRPIVNKGQRVEKGDVLADGPSTFKGELALGRN
FT                   VLVAFVPWYGYNFEDAILISERLLKQDVFTSIHIKEFSIEVRETKLGPEKITRDIPNVS
FT                   EKHLEHLDEEGIVRIGAKVKSGSILVGKITPKSDAELTPEFKLLNSIFGEKAKDVRDTS
FT                   LRVPHGAEGTVIDVQRLRRSEGDELPPGVEEVVKVLVASKRKLQEGDKMAGRHGNKGVI
FT                   SRVLPEEDMPFLADGTPVDICLNPLGVPSRMNLGQILETELGWAAVALDEWYATPVFES
FT                   ASPEMIEEKLREAGLPETSKTTLYDGRTGEAFHQPVMVGYMYMLKLNHLVDDKMHARST
FT                   GPYSLVTQQPLGGKAQFGGQRLGEMEVWALEAYGAANTLQELLTIKSDDMEGRTKIYES
FT                   IVKGEPSTSPGIPESFNVLVQELRGLALDITVQDTKGKPVPLTERDEELLTRQGEKF"
FT   gene            582762..586970
FT                   /locus_tag="STHERM_c04910"
FT   CDS_pept        582762..586970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04910"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01460"
FT                   /db_xref="GOA:E0RQ76"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ76"
FT                   /protein_id="ADN01460.1"
FT                   /translation="MKNMQEFAAIRIMLASPELIRARSYGEVKKPETINYRTLRPERDG
FT                   LFCERIFGTTKEWECYCGKFKSIRYKGVVCDRCGVEVTHFKVRRERMGHIELAAPVSHI
FT                   WFYRSVPSRMGLLLDLSVSALRSVLYYEQYIVIDPGDTDLKKMELLTEEEYLEARERYG
FT                   MSFTAGIGAEAIRTLLKNLDLDALAAELRAKMLEKGPKADKRLLKRLELVEQFRDSGNR
FT                   PEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMALNAPDIII
FT                   RNEKRMLQEAVDALFDNSKKRRAVKGASNRPLKSLSDILRGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKMHQCGLPVKMALELFKPFIMRKLVEREVVYNIKRAKTLVEQEADEVWA
FT                   VLDEVIQEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVH
FT                   VPLTQAAQTECWTLMLSSRNLLNPANGKPIVFPSQDMVLGIYYLTQVKKGAKGEGRYFA
FT                   SEDELVYAAECGAVDYHALVKVRVSKAPHNGAFVETSAGRVIFNQALPPELEFVNQVFT
FT                   DKELRQFVGRVYQEKGRGVAVRLLDAMKEIGFKYATLSGTTFSLADVVVPEDKKAMIEE
FT                   ANQKVAAIQEQYLSGHITNEERYNRVIEVWSKTNEDLTNVMMKVLREDRDGFNPLYMMA
FT                   HSGARGSRSQIRQLAAMRGLMAKPSGEIIELPIRANFKEGLSVIEYFISTNGARKGLAD
FT                   TALKTADAGYLTRRLVDIAQDVVVNEEDCGTINGIEMRALKDGEEIVENLADRIKGRFT
FT                   IERVKHPITGEIIVDVDQEITDEKAREIEEAGIEAVRVRSVLTCEARHGVCQKCYGRNL
FT                   ATNRLVEIGEAVGIVAAQSIGQPGTQLTMRTFHIGGTATRVVEENRVYLKYPVLVESLE
FT                   GNVVELETGIRLFTRRGKVKARRILETHALDEKDEVLVEDDQKVMTGQPLLRRASGEEI
FT                   FSGHNAIVRLKGDRLLLVAQEQSVEIRNGSEIFVHPGDVLDAGETIAVFDPFSEPIIAE
FT                   QSGVVKYHDMVLGTTLREEVNEDTGKIEKKITEHQLERLQPRIVIEDDEGNELGVYYLP
FT                   GGAYVNVEDGERITAGRTLARMLRESVRTMDITGGLPRVGELFEARKAKNAAVLAQVSG
FT                   TVHFHGIVKGKRVIVVEDEFGREYKHLIPMGRHLLVREGDHVEAGEKLCEGPVSPHEVL
FT                   RILGENALQAFLLNEIQEVYRLQGVEINDKHIAIIIRQMMKKVEIVEVGDTKFIYGQQV
FT                   DRREFFEENERVRRQGGQPAVARPLLLGITKASLSIDSFIAAASFQETTRVLTNAAIAG
FT                   SVDYLRGLKENVIIGHLIPAGTGVQRYREIKLYDEHKQDLDLKVRELLEARSQEETLEI
FT                   "
FT   gene            587044..587418
FT                   /gene="rpsL"
FT                   /locus_tag="STHERM_c04920"
FT   CDS_pept        587044..587418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="STHERM_c04920"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01461"
FT                   /db_xref="GOA:E0RQ77"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ77"
FT                   /protein_id="ADN01461.1"
FT                   /translation="MPTINQLIRFGRKKAKNKSKSPALQSCPQKRGVCTRVMTVTPKKP
FT                   NSALRKVARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGAKDA
FT                   LGVEDRRRGRSKYGAKRPKA"
FT   gene            587429..587899
FT                   /gene="rpsG"
FT                   /locus_tag="STHERM_c04930"
FT   CDS_pept        587429..587899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="STHERM_c04930"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01462"
FT                   /db_xref="GOA:E0RQ78"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ78"
FT                   /protein_id="ADN01462.1"
FT                   /translation="MSRRKKAIARHIMPDPKYNSREVMKFINRLMWDGKKSIAMSVVYK
FT                   AIGILEERTGKPGLEVFLRAVDNVKPVVEVRSRRVGGATYQVPVEVRETRREALAMRWI
FT                   IDAARGREGKPMEYRLADELLDAYNSTGVAFKKREDTHRMAEANKAFAHYRW"
FT   gene            588140..589330
FT                   /gene="tuf"
FT                   /locus_tag="STHERM_c04940"
FT   CDS_pept        588140..589330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="STHERM_c04940"
FT                   /product="elongation factor Tu-B"
FT                   /note="EF-Tu-B"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01463"
FT                   /db_xref="GOA:E0RQ79"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ79"
FT                   /protein_id="ADN01463.1"
FT                   /translation="MAKEKFERTKPHINVGTIGHVDHGKTTLTAAISGFCARNYGTKAF
FT                   SYDDIDNAPEEKARGITINARHIEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAIL
FT                   VVAADDGVMAQTREHVLLARQVGVPAIVVFLNKIDLVDDPELIELVEMDIRELLNKYEF
FT                   PGDDTPIIKGSAYKAMTNPDDAEATACIKELLETMDEYIPLPQRAVDKPFLMSIEDVFS
FT                   IQGRGTVVTGRIDQGVIRPGDEVEIVGFGETKKTVVTSVEMFNKILDEGQAGDNVGCLL
FT                   RGIDKDEVERGQVLAKPGSITPHKKFKAAIYCLTKEEGGRHTPFFSGYRPQFYFRTTDV
FT                   TGSVYLPDDKQMVMPGDNAEITVELITPVAMDKGLRFAIREGGRTVASGQVIEVIE"
FT   gene            589394..589702
FT                   /gene="rpsJ"
FT                   /locus_tag="STHERM_c04950"
FT   CDS_pept        589394..589702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="STHERM_c04950"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01464"
FT                   /db_xref="GOA:E0RQ80"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ80"
FT                   /protein_id="ADN01464.1"
FT                   /translation="MAGEKIRVRLKGFDTELVDQSAQAIVQAAQKAGAKVSGPVPLPTH
FT                   IRKYTVLRSPHVNKESREQFEMRIHKRLVDILNPTPAVMDALMKLELPAGVDVEIKQ"
FT   gene            589713..590339
FT                   /gene="rplC"
FT                   /locus_tag="STHERM_c04960"
FT   CDS_pept        589713..590339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="STHERM_c04960"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01465"
FT                   /db_xref="GOA:E0RQ81"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ81"
FT                   /protein_id="ADN01465.1"
FT                   /translation="MVGVIGRKLGMTQVFDANGYVVPVTVIKVEKNTVVDVRTPERHGY
FT                   RALVLGAFPLKASRAVKPYLGQFQKRGLEPKKVLREIRDFEGDYKPGDEIGVEIFEGVR
FT                   FVDVRGLSKGKGYQGVMKRHGFSGGPASHGSKFHRAHGSTGQSAYPSKVLKGTKMAGRM
FT                   GGVQVCVQNLRIVEVDKERGCLLVEGAVPGPRKGVVIVTRAKKKR"
FT   gene            590352..590978
FT                   /locus_tag="STHERM_c04970"
FT   CDS_pept        590352..590978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01466"
FT                   /db_xref="GOA:E0RQ82"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ82"
FT                   /protein_id="ADN01466.1"
FT                   /translation="METQVYSLKGEPIKTIELNDRVFACEVSHGSIYHAIRNELANMRV
FT                   GTASTKTRAEVSGSGRKPWRQKGTGRARAGERRSPLWVGGGVVFGPKPREYGYKLPRKV
FT                   KRLAYRSVLSLKLRENAFRVVEDFVVESGKTKDMVKALQALNPEGRRVLLVIGEESALT
FT                   KRAGRNIPWLLVHTYDKLRVHDVFYADQVLVQESAAVKLNTFLDR"
FT   gene            590989..591276
FT                   /gene="rplW"
FT                   /locus_tag="STHERM_c04980"
FT   CDS_pept        590989..591276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="STHERM_c04980"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01467"
FT                   /db_xref="GOA:E0RQ83"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ83"
FT                   /protein_id="ADN01467.1"
FT                   /translation="MDPHEVIIAPVLTEKANILREKENKYVFRVDARANKLEIKQAIRE
FT                   LFSVEPVACNVIRVKGKPKRMRRQPGRTSSWKKAVITLPPGQTIDIFESA"
FT   gene            591291..592115
FT                   /gene="rplB"
FT                   /locus_tag="STHERM_c04990"
FT   CDS_pept        591291..592115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="STHERM_c04990"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c04990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01468"
FT                   /db_xref="GOA:E0RQ84"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ84"
FT                   /protein_id="ADN01468.1"
FT                   /translation="MALKQYKPITPGLRFKTSLDFSALDKVEPEKSLVEGLPFKAGRGA
FT                   GGRVSVRRRGGRHKRLYRIIDFKRDKHGVPGVVKTIEYDPNRSAVICLVAYADGEKRYI
FT                   LAPKGIERGAVVQSGEDAPIAVGNALPLERIPLGTAVHNVELYPGKGGQMVRSAGTGAV
FT                   VMAKEGDYVTLKLPSGEMRMVFKKCYATVGEVGNEDHMNVVLGKAGRSRWLGRRPKVRG
FT                   TAMNPVDHPHGGGEGRSKGGRHPVSPTGIPTKGYKTRKRRKPSDKFIVKRRK"
FT   gene            592125..592403
FT                   /gene="rpsS"
FT                   /locus_tag="STHERM_c05000"
FT   CDS_pept        592125..592403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="STHERM_c05000"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01469"
FT                   /db_xref="GOA:E0RQ85"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ85"
FT                   /protein_id="ADN01469.1"
FT                   /translation="MARSVKKGPYVEKSLYKKVLAMAKGGEKRMIKTFSRASTIIPEMV
FT                   GLTISVYNGKTWVPVYITEDLVGHKLGEFAPTRIFRGHAGSDKKASK"
FT   gene            592416..592775
FT                   /gene="rplV"
FT                   /locus_tag="STHERM_c05010"
FT   CDS_pept        592416..592775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="STHERM_c05010"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01470"
FT                   /db_xref="GOA:E0RQ86"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ86"
FT                   /protein_id="ADN01470.1"
FT                   /translation="MKEKSGYRARARYLLVSPKKVRPVADLVRGKRYPEAVAILEHMPQ
FT                   KGARLIKKVIDSAAANALYLNKNLDEDMLYVKELRVDDGPRLKRLWPRSHGRADILLKR
FT                   MSHITVVVDELPQKG"
FT   gene            592788..593492
FT                   /gene="rpsC"
FT                   /locus_tag="STHERM_c05020"
FT   CDS_pept        592788..593492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="STHERM_c05020"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01471"
FT                   /db_xref="GOA:E0RQ87"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ87"
FT                   /protein_id="ADN01471.1"
FT                   /translation="MGQKVNPYGLRLGINKTWKSKWFVDLKDYAKVLHEDLLLRKRLLA
FT                   LPEAKAANVGDVEIIRHPQRVMLVVHTPRPGVLIGAKGATIERIGAELQKMVSKKLQIK
FT                   IKEIKRPEAHAQVVAQNIAAQLEHRASFRRVMKLAVANAMKAGVQGIKVRVSGRLGGAE
FT                   IARSEVQMAGRVPLHTLRADIDYGFAEARTTYGVIGVKVWIFHGETLGKAVKQDAGTIV
FT                   TPRRENRSRRRS"
FT   gene            593495..593917
FT                   /gene="rpsP1"
FT                   /locus_tag="STHERM_c05030"
FT   CDS_pept        593495..593917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP1"
FT                   /locus_tag="STHERM_c05030"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01472"
FT                   /db_xref="GOA:E0RQ88"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ88"
FT                   /protein_id="ADN01472.1"
FT                   /translation="MLSPKRVKYRKQQRQVGLLRRKASRGNTVAFGEFGLMALEPEWVT
FT                   SRQIEAARVALTRKIRRGGKVWIRIFPDKPYTKKPAETRMGKGKGSPEAWVAVVQRGRV
FT                   LFEVAGVDRDLAMEALRLAGTKLPIKTKIVERLHAE"
FT   gene            593923..594111
FT                   /gene="rpmC"
FT                   /locus_tag="STHERM_c05040"
FT   CDS_pept        593923..594111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="STHERM_c05040"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01473"
FT                   /db_xref="GOA:E0RQ89"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ89"
FT                   /protein_id="ADN01473.1"
FT                   /translation="MRNSFKDLSYRELLAKREELVKRYQELRFQKVVGHLDNPLEVRTL
FT                   RRNIARLNFLIHNHREA"
FT   gene            594118..594417
FT                   /gene="rpsQ"
FT                   /locus_tag="STHERM_c05050"
FT   CDS_pept        594118..594417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="STHERM_c05050"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01474"
FT                   /db_xref="GOA:E0RQ90"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ90"
FT                   /protein_id="ADN01474.1"
FT                   /translation="MTPKETAVEGNVKKPIRTERKRILVGEVVSDKMDKTIVVAVRRRK
FT                   LHPLYKKYVTRTKKVKAHDELNEARVGDVVRVVESRPISKEKRWRLLEIVERAQ"
FT   gene            594435..594806
FT                   /gene="rplN"
FT                   /locus_tag="STHERM_c05060"
FT   CDS_pept        594435..594806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="STHERM_c05060"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01475"
FT                   /db_xref="GOA:E0RQ91"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ91"
FT                   /protein_id="ADN01475.1"
FT                   /translation="MIQVQTYLNVADNSGAKKVQCIKVLGGTRKKYATLGDLIVVSVKE
FT                   ALPDAPVKKGTVQRAVVVRTKKEVRRPDGTYIRFDDNACVIVDNHNNPRGRRVFGPVAR
FT                   ELRENAEFMKILSLAPEVV"
FT   gene            594818..595153
FT                   /gene="rplX"
FT                   /locus_tag="STHERM_c05070"
FT   CDS_pept        594818..595153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="STHERM_c05070"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01476"
FT                   /db_xref="GOA:E0RQ92"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ92"
FT                   /protein_id="ADN01476.1"
FT                   /translation="MAIQRKKTAVKYKLKKNDPVMVIAGKDKGKTGRILSVDRERGRVV
FT                   VEGVNLVKKAVRRRSANEPGGFVEVEAPIHISNVMYLAKDGKPTRLGYKFVDGKKVRYA
FT                   KRTGEVV"
FT   gene            595153..595713
FT                   /gene="rplE"
FT                   /locus_tag="STHERM_c05080"
FT   CDS_pept        595153..595713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="STHERM_c05080"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01477"
FT                   /db_xref="GOA:E0RQ93"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ93"
FT                   /protein_id="ADN01477.1"
FT                   /translation="MAEVKVPILKTLYEERVKQELMEEMGYRNVMQVPRLEKIVLSMGV
FT                   GEAIQNKRLLDLAVEELTLIAGQRAIKRKARKSIAGFKVRKGMEVGAMVTLRGLRMYEF
FT                   LYRLIHVAIPRIKDFRGLNPNSFDGHGNYSLGITEQIIFPEIDYDSVERVTGFNVTIVT
FT                   TAKTDREAFSLLQKLGMPFRKAS"
FT   gene            595724..595909
FT                   /gene="rpsN"
FT                   /locus_tag="STHERM_c05090"
FT   CDS_pept        595724..595909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="STHERM_c05090"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01478"
FT                   /db_xref="GOA:E0RQ94"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ94"
FT                   /protein_id="ADN01478.1"
FT                   /translation="MARKALIIKSQREPKYRVRKHNRCKICGRPRGYMRDFEMCRVCFR
FT                   KLASEGLIPGVTKSSW"
FT   gene            595919..596317
FT                   /gene="rpsH"
FT                   /locus_tag="STHERM_c05100"
FT   CDS_pept        595919..596317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="STHERM_c05100"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01479"
FT                   /db_xref="GOA:E0RQ95"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ95"
FT                   /protein_id="ADN01479.1"
FT                   /translation="MSVSDPIADMLTKIRNASLARHEKVDIVPSKLKLEIIKILKNEGY
FT                   IKNFKKVVVSEKPFIRIFLKYDEQQRPVIHELSRISKPGRRIYSGYKEMPRIKNGYGTL
FT                   IVSTSEGVITDKKARERRVGGELICSIW"
FT   gene            596328..596873
FT                   /gene="rplF"
FT                   /locus_tag="STHERM_c05110"
FT   CDS_pept        596328..596873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="STHERM_c05110"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01480"
FT                   /db_xref="GOA:E0RQ96"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ96"
FT                   /protein_id="ADN01480.1"
FT                   /translation="MSRLGRLPVVIPQGVQVQVDSEERRVEVKGPKGVLSMEYRPEVEV
FT                   KVEEGVCRVERKNDTKKARSFHGLYRQLIHNMVKGVSEGFEKVLLINGIGYRAEVRGNV
FT                   VVLSLGFSMPIEYLIPEGITVTVEENTRIRVSGIDKALVGKVAAEIRSLRPVEPYKGKG
FT                   IRYENEMVRRKVGKAGVK"
FT   gene            596885..597253
FT                   /gene="rplR"
FT                   /locus_tag="STHERM_c05120"
FT   CDS_pept        596885..597253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="STHERM_c05120"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01481"
FT                   /db_xref="GOA:E0RQ97"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ97"
FT                   /protein_id="ADN01481.1"
FT                   /translation="MKTEKLIKEKRRKRLKRKLRVRKNVYGTPERPRMTVFKSNRHLYV
FT                   QVIDDSKGHTLVAASTLEKDLSSLRKCVADAEKLGEVIGKRALEKGIKRIAFDRNGYPY
FT                   HGIVKAIAEGARKAGLEF"
FT   gene            597262..597750
FT                   /gene="rpsE"
FT                   /locus_tag="STHERM_c05130"
FT   CDS_pept        597262..597750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="STHERM_c05130"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01482"
FT                   /db_xref="GOA:E0RQ98"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ98"
FT                   /protein_id="ADN01482.1"
FT                   /translation="MDQDREFIETLVSLNRVSKVVKGGRRFSFTALSVVGDGKGSVGYG
FT                   YGKANDVTEAIRKSIQKAKQSMVTVPMQHGTLPHEIQVKFKSTRVLLKPAAPGTGVIAG
FT                   GPVRAVLEAAGYSDVLTKVMGSRNSTNVVQAVFRGLQSLLVPGQVAKNRGKSLSEIWS"
FT   gene            597753..597950
FT                   /gene="rpmD"
FT                   /locus_tag="STHERM_c05140"
FT   CDS_pept        597753..597950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="STHERM_c05140"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01483"
FT                   /db_xref="GOA:E0RQ99"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQ99"
FT                   /protein_id="ADN01483.1"
FT                   /translation="MAKKAKKVRIKLVRSTIGRKPDQRKTVAALGLRKLNAVVEKELTP
FT                   SIEGMIRKVAHLVQIEEIEG"
FT   gene            597947..598423
FT                   /gene="rplO"
FT                   /locus_tag="STHERM_c05150"
FT   CDS_pept        597947..598423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="STHERM_c05150"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01484"
FT                   /db_xref="GOA:E0RQA0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA0"
FT                   /protein_id="ADN01484.1"
FT                   /translation="MSAKEIIVPSGAAKASRRVGRGPGSGKGKTSGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLYRRLPRRGFNNGAFRKEYAVLNLEILNEKFNDNEVVNLETLKQKRII
FT                   RRSVESVKILGNGRITKKLTVEVPAISASAKLQIESAGGKVVLVTPSQVENNGQ"
FT   gene            598413..599735
FT                   /locus_tag="STHERM_c05160"
FT   CDS_pept        598413..599735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01485"
FT                   /db_xref="GOA:E0RQA1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA1"
FT                   /protein_id="ADN01485.1"
FT                   /translation="MASNPISQVFRIPELRRRVLFTLAVLIVFRIGAALPIPGINITAL
FT                   KQYYLQQQTEGLTSITDYIDFFAGGAFKNFSIFMLGVMPYITASIIMQLLLVMFPSLKA
FT                   IAEEEGGRKKIQRYTRYGTVLVSLIQSFIVAQYADAIPDAVVLPKLSFVLLGMLTVTTG
FT                   SLFLMWLGEQVNQRGIGNGISLIIFAGIVARLPQAFIQLVEQIQLGELNPVVALLVLVL
FT                   FVAVIILVIYEQQGQRKIPVHYAKRVVGRRVYGVQNTYIPMRLNPSGVIPVIFASSVLL
FT                   FPLQIAQMLGTRVGWLADVAYWLRPGGVWYLVLYTLLIIFFAYFYTQVTLNPMELAKNI
FT                   REHGGSVPGVRAEKLEEYFTNILNRIILPGALFLAFIAIIPTLVQQVFHFPSRLAYLMG
FT                   GTSLLIMVGVDLDTMSQIEGHLKMHHQDGLVRRGKLRARNL"
FT   gene            599747..599860
FT                   /gene="rpmJ"
FT                   /locus_tag="STHERM_c05170"
FT   CDS_pept        599747..599860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="STHERM_c05170"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01486"
FT                   /db_xref="GOA:E0RQA2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA2"
FT                   /protein_id="ADN01486.1"
FT                   /translation="MKVRVSVKKMCEKCKIIKRRGVVRVVCENPKHKQRQR"
FT   gene            599870..600235
FT                   /gene="rpsM"
FT                   /locus_tag="STHERM_c05180"
FT   CDS_pept        599870..600235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="STHERM_c05180"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01487"
FT                   /db_xref="GOA:E0RQA3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA3"
FT                   /protein_id="ADN01487.1"
FT                   /translation="MARIAGVDLPNKQIQIALTYIYGIGRASARKICEKTGIPYETKVS
FT                   ELTSDQVQKLRQVIENEYTVEGRLRTQVALNIKRLMDIGCYRGLRHRKGLPVRGQRTRT
FT                   NARTRKGKRKTVANKKK"
FT   gene            600248..600619
FT                   /gene="rpsK"
FT                   /locus_tag="STHERM_c05190"
FT   CDS_pept        600248..600619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="STHERM_c05190"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01488"
FT                   /db_xref="GOA:E0RQA4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA4"
FT                   /protein_id="ADN01488.1"
FT                   /translation="MAKKKEKRTVYEGKVYIQATFNNTIVTVTDMNGNCVSWASAGALG
FT                   FRGAKKSTPYAAQVTAETAVKKAMDHGLQEAHVYVKGPGVGREAAIRAIDALGVRVRSL
FT                   HDITPIPHNGCRPRKARRV"
FT   gene            600632..601267
FT                   /gene="rpsD"
FT                   /locus_tag="STHERM_c05200"
FT   CDS_pept        600632..601267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="STHERM_c05200"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01489"
FT                   /db_xref="GOA:E0RQA5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA5"
FT                   /protein_id="ADN01489.1"
FT                   /translation="MGRYIGPQCRLCRAEGRKLFLKGERCYTPKCAMAKNRPKPGKAQY
FT                   ARMRKPSNYAIQLREKQKLKRLYNMSEAQFRRFFHMAEKMPGKTGDNLIILLERRLDNI
FT                   VYRMHFASSRKQARQIVGHGHVLVNGRKVNIPSYLVREGDRVEIREKSKKLLVFKESLK
FT                   EYTRSGVMSWLEVDPDNLVGTVKMIPMRSDITDLADIKENLIVELYSK"
FT   gene            601277..602368
FT                   /locus_tag="STHERM_c05210"
FT   CDS_pept        601277..602368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01490"
FT                   /db_xref="GOA:E0RQA6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQA6"
FT                   /protein_id="ADN01490.1"
FT                   /translation="MARKNLLKGFVLPTSITVEHLDTNAHYGKFAAYPFERGYGVTIGN
FT                   TLRRILLSSIQGYAISAVRITWYDDQGTAHVLSSEYEQIPGVVEDTLELFANLKLLRVQ
FT                   LPDEMEQKTVMVEFKGPKEVTGADFEVDQLEVMNKDFRVMTLMEDAHFEMEMQVDLGRG
FT                   YVPAEVQKNYIEVVGTIPLDALYSPIQRVRFDVENTRVGHRSDYDKLILEVWTDGSISP
FT                   EDALGEAAKLAKEHFTVFINFDEDAISHVRQLDHEEEQIRRLLETPIEELELSVRSSNC
FT                   LKNANIRTIGDLVSKSEEELSKTRNFGKKSLLEIKEKLKEWNLSLGMRDPSAYKAALER
FT                   VRLPESQESESTTEEEENDETQD"
FT   gene            602352..602795
FT                   /gene="rplQ"
FT                   /locus_tag="STHERM_c05220"
FT   CDS_pept        602352..602795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="STHERM_c05220"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01491"
FT                   /db_xref="GOA:E0RQI7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQI7"
FT                   /protein_id="ADN01491.1"
FT                   /translation="MKHRISFNRLGRKSSHRKALIRNMVTSLFRHERIRTTEVKAKEVR
FT                   RYAERLITRAKVDSVHNRRMVARFVQDKAVLAKLFTDIAPRFVSRPGGYTRVLKLGERR
FT                   GDAASMVILELVERKVEAKPEKKKREEKKAESGSKEEETAAQE"
FT   gene            602943..605462
FT                   /locus_tag="STHERM_c05230"
FT   CDS_pept        602943..605462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01492"
FT                   /db_xref="GOA:E0RQI8"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQI8"
FT                   /protein_id="ADN01492.1"
FT                   /translation="MRSVQKLGVSLFVSVVTVALVVLAGTLGGIREVEVRLLRPLVTEH
FT                   AVDRLVAVDGLIRSRMEGWREYLSGLAADPAFQRVFRTSQSEEDVQRRFDLVAELSARF
FT                   PELGFVRVVGLDGRRIHFSTRAEDVRERSASRIVYRNWDEVARREGLGFREGRFDDRDV
FT                   HLDPASQEVVVRIPVRDELGEVAGMLYAHMRVGDLGLLLAKEGLLAPSERLHVLDEGSL
FT                   VVSGSLSAEELRAVGGGALRVERGGEVWVGVEYEGTVGRLVAFLPEAAFSLSPLLMALL
FT                   LGVVGTSVFLLVFFLLNLRRDPVVEALRRLRRLEREVVGEVLEGREDLEWTRKRKELEA
FT                   RKGEIRSRVLEGLRVPPDRLPEVERFLDRVWDEVLRVAEAVVGEGPRLRRLEELLEDLV
FT                   RRLEEGVAVKGVLPAGGGVGDVGVREGAVGVADEEEEIGEVEEVGEVEEIGEVEEVGEV
FT                   EEVGEVEEVGEVEEIGEVEEVGEVEEVGEVEEVGEVEEIGEVEEIGEVEEVGEVEEIGE
FT                   VEEIGEVEEIGEVEEIGEVEEVSIPQGALPPEDEGELVAVLEEFEHLIEEKQEDVDREV
FT                   GGTVVEEDVVEPEPLPVKVGSLSSALFSFRPEYRRISSQVETVGIPPERKALYERLLRE
FT                   EKVRVFPLSVLRSGGFVQPPVEEENGIYRIREEVYRRVARARVEAPQEGHGGGRRPERL
FT                   PLGEDGLEYDPYLSRFSRSQVGMLKSLMELTRSVGAVCGGLFVRQEEGFVVRQALGLDA
FT                   AWAKRMRITGDDPLWSELAQRKVVWLGVPLEEIPWYAPFLSPTDAAMTRRSLWLPVWLE
FT                   GKEGYLFLGYKEEIDSVEEYLKYFLHE"
FT   gene            605459..606082
FT                   /locus_tag="STHERM_c05240"
FT   CDS_pept        605459..606082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05240"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01493"
FT                   /db_xref="GOA:E0RQI9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQI9"
FT                   /protein_id="ADN01493.1"
FT                   /translation="MREFFDRIQGYYVERLKEFSRSPRERHLAVGWESREAQERRFRVL
FT                   LDHVPLEGGSLLDVGCGLGDLYGFLKREGVACDYTGVDILPAMVEQARTSWPEGRFMVG
FT                   DVCSEDLFPPHSFDVVYASGMFNLRVEDNYAFLGRALGVFRSLARRAVVCSMLSVKSPF
FT                   PEPEYFYYEVDRVRRLAEAGPWRVEVMEHYMDNDLTLVCRKGGL"
FT   gene            606079..606510
FT                   /locus_tag="STHERM_c05250"
FT   CDS_pept        606079..606510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05250"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="RNase HI"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01494"
FT                   /db_xref="GOA:E0RQJ0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ0"
FT                   /protein_id="ADN01494.1"
FT                   /translation="MIEVYTDGACKGNPGPGGWAYVVVRDGEGEGAFGGERMTTNNRME
FT                   LLAVIKALERVDAGGRVRVYTDSEYVRRGITEWIDRWLANGWKTRDRRDVKNRDLWERL
FT                   WRLAAEVELEWVWVQGHAGVGWNEVCDRMAHLAALKAGG"
FT   gene            606554..608086
FT                   /locus_tag="STHERM_c05260"
FT   CDS_pept        606554..608086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01495"
FT                   /db_xref="GOA:E0RQJ1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ1"
FT                   /protein_id="ADN01495.1"
FT                   /translation="MQVVSFLPWGYEGIVVRVEVDIRKGIPGVEVVGFAGTAVKEARER
FT                   IRVALKNSGFSFPQKRVLINLAPAGLPKKGAWYDLAIALALLAASGQVEAAEGVVLVMG
FT                   ELRLSGEVLPVEGVLSSLIAARREGVRVAVVPAANVAEATVVKGVRVFGVGSLEEAVEV
FT                   VEAGFPEDREEKGTGVGVEEEWEHDFSSFKGQTYLRRALEVAAAGGHHVFLFGPPGSGK
FT                   TMGAYTFPSILPPLSEEERLEVLQVYSLAGELQNGSRRTYSNRRPFRAPHHSATVEGMV
FT                   GGGKEVRPGEISLAHQGVLFMDEAPEFRASILQSLREPIETGRITLSRAGHSFWYPARF
FT                   QLILAANPCPCGNLGREGAVCACSVQEIKRYWRKIGAPLLDRIDIRFPVSPESPEVLLS
FT                   DRPEPSAAVRERVERAWAIQRERFAGREYSRNASMTPEEVETHCRLGDEEQRLLLKAVE
FT                   QLSLSSRACASILKLARTIADLEGSERIQKDHLLEAVHYRRYGDMDFFWSEL"
FT   gene            608154..609371
FT                   /locus_tag="STHERM_c05270"
FT   CDS_pept        608154..609371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01496"
FT                   /db_xref="GOA:E0RQJ2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ2"
FT                   /protein_id="ADN01496.1"
FT                   /translation="MMRTFWTRTLVVIGAVGLFLFALGLGLGVGRSMGGRDASGQSEAV
FT                   LPEIPVDTGAEALIPVAEGAGRYSEDELENIRVYETRNRGVVNITTETLAYNWFLEPVP
FT                   QEGVTGSGSIIDARGYVLTNYHVVKGAYKVFISLADGSQYEGEVVGVDPENDLAVLKFD
FT                   PRDKDLVVIPMGSSSDLKVGQKVLAIGNPFGLERTLTVGVVSALGRPVRTEDGLIIQDM
FT                   IQTDTSINPGNSGGPLLDSRGYMIGINTMIYSPSGGSVGVGFAVPVDTAKRVVPELIAH
FT                   GYVERGWIDIVPVQLFPALVRYADLSVSRGILVSKVEPGSPAAEAGLKGGSPDKAVRYG
FT                   RSIIYLGGDIIVEVDGRAVGSLADLYAALEDNKPGETVEVKVVRDGKVVTLSIPLSKRP
FT                   ERFNWN"
FT   gene            609380..611365
FT                   /gene="uvrB"
FT                   /locus_tag="STHERM_c05280"
FT   CDS_pept        609380..611365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="STHERM_c05280"
FT                   /product="UvrABC system protein B"
FT                   /note="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01497"
FT                   /db_xref="GOA:E0RQJ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ3"
FT                   /protein_id="ADN01497.1"
FT                   /translation="MSGFRVEAPFGPAGDQGKAIALLSEGVKKGYRYQTLKGVTGSGKT
FT                   FTMAKIVEEVQLPTLVISHNKTLAAQLYREFKEFFPHNAVEYFVSYYDYYQPEAYVASK
FT                   DLYIEKDASINEEIDRLRLSATASLMERPDVIVVATVSCIYGLGNPEHFREMRVRIDVG
FT                   QHLDLGMLKQQLVSLQYERNDAVLTRGTFRVRGEVVDIYPAYLEHVYRVELDWDEVVSI
FT                   KVVHPLTLEVLDERKSLFVYPAKHFVLPEEQIRSAIQGIREELEERYRELLSQNKLVEA
FT                   QRLKARTEYDLEMLEEMGYCSGIENYSRHLSGRKPGQRPAVLLDYFPDRFLVFIDESHV
FT                   TLPQLKAMYEGDRSRKLSLVEYGFRLPSALDNRPLRYEEFEAIVPQVIYVSATPEEEEL
FT                   SKSSQVVEQIIRPTGLLDPEVEVRPTEGQIDDLYAEIRKRVEKGQRVLVTTLTKKMAED
FT                   LTDYLQSLGLRVRYLHAEVETIERVELLRDLRAGEFDVLVGINLLREGLDLPEVALVAI
FT                   LDADKIGFLRSATSLIQIMGRAARNAEGKVIMYADRVTDAMREAIEETRRRRTIQEAYN
FT                   REHGITPQTIQKSVRDILERKMKVKEEVERKEIEVLVHGYNILVPSERKKLIQRLEKEM
FT                   LERAKNLEFEMAAVIRDEIARLKEMA"
FT   gene            611362..611715
FT                   /locus_tag="STHERM_c05290"
FT   CDS_pept        611362..611715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01498"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ4"
FT                   /protein_id="ADN01498.1"
FT                   /translation="MRGRVFLLACAALILFSGCREDRALPLEVPASPPLSEELRWAVVQ
FT                   DAYARLWDAPPPGGSVVGILRRGDMLEIVEEEGAWCRVVRGTEEGWVGEGHLLRYRIRL
FT                   QAETASRRLIERF"
FT   gene            611798..612730
FT                   /locus_tag="STHERM_c05300"
FT   CDS_pept        611798..612730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05300"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01499"
FT                   /db_xref="GOA:E0RQJ5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ5"
FT                   /protein_id="ADN01499.1"
FT                   /translation="MRRVLSLLAGIVLASGFVWAGGQGESGDLSGTIRIAGSSTVYPIT
FT                   VAMAEEFNRIQPGVQIAVQSTGTGGGFTNFFIPGKTEINDASRPIKESELEQVRAQGDD
FT                   ALEFQVAIDAVTVVVNPHADWVDDVTIEQLRHIWRPDDPAQKWSDVDPSWPDEPFELYG
FT                   PTSASGTFDFFTEKVMGEEDLSRSDYQGTEEDNTIVQAVSGSKYALGYFGMAYYLENTN
FT                   RVKALKVNGVAPSLETARTYEYPLSRPIFIYVRKSALARPEVAAFVRFYIERTNSSLIS
FT                   EIGYVPVTDEVVKENLAKLEKAIAEVSKK"
FT   gene            612848..613765
FT                   /locus_tag="STHERM_c05310"
FT   CDS_pept        612848..613765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05310"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01500"
FT                   /db_xref="GOA:E0RQJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ6"
FT                   /protein_id="ADN01500.1"
FT                   /translation="MNSPSPPPHRTERWVQRVLLFMAGMSVLITAGIVLVLLVDSLSFF
FT                   REVSPLHFLTSTRWSPTIQPYSFGVLPLLSGTLAFTLCTALIALPIGLLTAIFLAEYAP
FT                   EGLRAVLKPALEVLAGIPTVVYGYFALVYVTPFLKTYLFPEISTFNTLSASIVVAIMII
FT                   PTVSSISEDAMRAVPRSLRYAAYALGTTKFQTVRTVVLPSALSGIVSSFILGISRVIGE
FT                   TMAVTIAAGNLSRMVNIFDPAEAFLRPIQTMTAAMVEVGISDVTGESMAYKSLYAVGLV
FT                   LFLFTLGLNLIAGRIRRRFREKYQ"
FT   gene            613762..614664
FT                   /locus_tag="STHERM_c05320"
FT   CDS_pept        613762..614664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05320"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01501"
FT                   /db_xref="GOA:E0RQJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ7"
FT                   /protein_id="ADN01501.1"
FT                   /translation="MRETTGRAPHTPTLWHSVGAERIKDRIFLGVAFLATVWGLLSLAG
FT                   LLVYVFSDAIGWLDWQFLTSPPSRFPEKAGVGPVLAGSFYLIVLVGVMVFPFGVGAAIY
FT                   LEEYAREGRLTRLIETNIANLAGVPSIVYGLLGLGVFVGVMHLPIGCLLVAGLTLMLRV
FT                   LPIVIVSAQEAIRAVPDSHRFASLGMGTTRWQMITSVVLPEAFPGIMTGIILALANAMG
FT                   ETAPLIMVGVAHSIFTPPRGLLSAFGALPLQIFAWSDYPKPEFQHGVVPAAIVVLLVTL
FT                   MLLNGIAVYLRHRFSKRRW"
FT   gene            614673..615509
FT                   /locus_tag="STHERM_c05330"
FT   CDS_pept        614673..615509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05330"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01502"
FT                   /db_xref="GOA:E0RQJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ8"
FT                   /protein_id="ADN01502.1"
FT                   /translation="MDREVQFQVADGRFRSVPEGKEEVIIETRGLSVYYGYHMALYDIN
FT                   LPIYKNRITAFIGPSGCGKSTLLRCFNRMNEVVADVRIEGEVLFHGKNVYDPDVDPVLL
FT                   RRRIGMVFQQPNPFPKSIYDNVAYGPRMYGIKDKATLDEIVEESLRAAALWDEVKDVLG
FT                   KSALALSGGQQQRLCIARTIAVKPEVILMDEPASALDPISTARIEELMQELARQYTIVI
FT                   VTHNMQQAARVSDYTAFMYLHEDWGAGYIEEFGPTRELFLNPKKKRTEDYISGKFG"
FT   gene            615634..615978
FT                   /locus_tag="STHERM_c05340"
FT   CDS_pept        615634..615978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01503"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQJ9"
FT                   /protein_id="ADN01503.1"
FT                   /translation="MHVHYVEIVSTSVEAQCSFLKQVYGLSCDTMVEDLGNARVATMPN
FT                   GVLVGVRSPLGDHEQPIVRTYFEVSDIMAAVRRAEAAGALIAYPPTKQGETGTWAICIL
FT                   DGIQYGLWQK"
FT   gene            616463..618382
FT                   /locus_tag="STHERM_c05350"
FT   CDS_pept        616463..618382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01504"
FT                   /db_xref="GOA:E0RQK0"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032477"
FT                   /db_xref="InterPro:IPR037176"
FT                   /db_xref="InterPro:IPR037398"
FT                   /db_xref="InterPro:IPR042517"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK0"
FT                   /protein_id="ADN01504.1"
FT                   /translation="MRRYLPYLAPLMLVLMLLIACEGGIVNLSGDLVSRAAFESGCDYV
FT                   DADTARIWLTAADAGWADVHYKVNGGGQLNVRMNRDGTYFWYEVNGLSEGDVIDYWFTI
FT                   GFNAGAQDTGWYSYTHTAGGSTPTPTPTPAGSTTFVIEAEDYAAMSGVQTESCVEGGLN
FT                   VGWIDAGDWMAYASRYFEGGEYLIEYRVASLNGGGQLSADLDAGSIVLGSVSIPSTGGW
FT                   QNWTTVSHTVTIPAGNHAFGIYAVSGGWNINWIRFTYLGGSGSTPTPTPSSSPSFIPLS
FT                   PGMELTIQFLNKTGGRVDDSRIYAAIIGRDGGNRWCYLTPEGTAKVIEAGDTSDQWFFR
FT                   LDTIAGFQVPPVFTSARLYMSMDSPLVMSAVVDATGSVGIVQPDLGNPSDPNQEIIFDW
FT                   AEFTVHSGTFWGNTTQVDQFGFPYTLAVYSDGGTLVKKVGIDRPRDEVFSLFDSYVPSE
FT                   FRSLNHYPYRILAPAKESFGEGKPNASYFDAYVDTVWNQYRNQTLTITHPLGTFQGRVL
FT                   SDHRMEFTRLEDGQKFYIQRRPNDTEILEGSGVLASGNTVELALEAWICAAFNRHVVHY
FT                   PDSSYWNDPAYYYLDSPANWYAAFWHEISLGGLAYGFCYDDVNDQSTLIEAPNVRAVVI
FT                   ELYW"
FT   gene            complement(618536..619927)
FT                   /gene="phoR"
FT                   /locus_tag="STHERM_c05360"
FT   CDS_pept        complement(618536..619927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="STHERM_c05360"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01505"
FT                   /db_xref="GOA:E0RQK1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK1"
FT                   /protein_id="ADN01505.1"
FT                   /translation="MHETTSRPSGESATASSRSDPLWPVRLLLPLLPILALSLLPLALP
FT                   LTPPLLALLLQTLLIASLLLHHALHLRRTLRTLKRRLLTTPPPLLPHTRTLTNPFSRAL
FT                   QPLEEALLHTLGQTHTRLQDLTAESHLYHTVLTHMEEGIVVTDGRLRITYANPRALEIL
FT                   SLPPEHRLKPLPQFLRSTSLLEHIHRTLSSGTPLTHTLTTPPPSSRTIRLHLIPLPPSP
FT                   SERLLLVASDITRLERLEQIRRDFVSSVSHELKTPITTVLGYLETLKDLPPDDEATRTR
FT                   FLETALSHTHRLHQIIEDLLLLSRIEQAEAPVPLERAPLAPLIRRAVELVRQARGETHP
FT                   LTLEGPEDLALPLNPGLMVQALYNLIHNALTHTPPGTPVVVRWRSTGSSVLIQVEDRGP
FT                   GIPPEALPRIFERFYRVDTSRSRATGGTGLGLSIVKHIVQAHKGTIDVHSTPGHGTTFT
FT                   IRLPG"
FT   gene            complement(619869..620549)
FT                   /locus_tag="STHERM_c05370"
FT   CDS_pept        complement(619869..620549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05370"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01506"
FT                   /db_xref="GOA:E0RQK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK2"
FT                   /protein_id="ADN01506.1"
FT                   /translation="MTILVVDDEPDIVELVRFHLEREGYDVVSTGEGRDALEKARNLLP
FT                   DAIILDLMLPGMSGLEVCRLLRQQDRTSHIPILMLTAKSEETDVVVGLELGADDYITKP
FT                   FSPRILLARLKAVLKRTRPPEGRSDEPIVVGELVIDPHRYSVRVRGREIILSATEFAIL
FT                   SFLARNPGWVFSRQQIIDAVKGEDYPVTERAVDVQILSIRKKLGDARDYIQTVRGVGYR
FT                   LQPV"
FT   gene            complement(620558..621211)
FT                   /locus_tag="STHERM_c05380"
FT   CDS_pept        complement(620558..621211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05380"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01507"
FT                   /db_xref="GOA:E0RQK3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK3"
FT                   /protein_id="ADN01507.1"
FT                   /translation="MRHHLEDEITDLRNNIFSMGILVEETLHKAYRALKEQNTDLAQEV
FT                   FEDEEEINRLQHTLEHRCAEILATEHPVAGDLREILTSFKIIANIERIGDHAVHFAKAL
FT                   MRLRNREVLRDLSQFFSMAEEGISMFHDALTAYIERDAEKAREVASRDSRIDEMHGQIL
FT                   QHLFRLIKEHPDQPEDFTSLLFLNRFLERLGDHVTNICEWVVFSTTGVHEELNQ"
FT   gene            complement(621296..622171)
FT                   /locus_tag="STHERM_c05400"
FT   CDS_pept        complement(621296..622171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01509"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK4"
FT                   /protein_id="ADN01509.1"
FT                   /translation="MSRRPSSCVDNPHAVTPPRATDLDPPPVPPYRKPIMRTHIPAILL
FT                   LLALPGSLHGQTFPLSPQQEETLETTGELTIYFDGTPERILYHGPLSPLIRTDLEDLSP
FT                   TIGVESLFRLPMPSSLREGSDPILDLYNILHRVSTMKGIQYYSASRGRMRTMFHDAYRI
FT                   ASPEAREPVPDLTFTELPHEPVSITIFQDDSSFGKNLYRITYRVEGSFILLSMENLDTL
FT                   AYMGLIPLVSPGGLRTHLVIVPRGEELMFYGICGVRTIRFFGMEKRYASFYNRIVALKN
FT                   WFQSQLPLRP"
FT   gene            622133..623248
FT                   /locus_tag="STHERM_c05390"
FT   CDS_pept        622133..623248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05390"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNActransferase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01508"
FT                   /db_xref="GOA:E0RQK5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK5"
FT                   /protein_id="ADN01508.1"
FT                   /translation="MRIVYTGGGTAGHVFPALAVHRVLEERVPGLEAVWIGSRKGPERG
FT                   WVEEAGVRFYGVPAGKWRRYLSVKNVVDVGRVGVGVMASLLLLRRLRPRVLFSKGGYVA
FT                   VPPVIAASILGIPVVVHESDLDPGLATRITARYASRILTSWPETATFFPREWEPRVVCT
FT                   GNPVRPEVRSGDPGKVREFFPVRPGRPLLLVLGGSQGARQVNELVWAALPRLLEWCEVI
FT                   HQTGPDVERAPRREGYHPVAFLGRELPHVLAAAQVVVSRAGAGAVAELAACGKAAVLVP
FT                   LGRELGSRGDQVRNARRLAERGAAVVLEGGEAVPARLVQVVEGLVRDEGRRRALEERIR
FT                   ELARPDAAEAIARVIEGFLSESPTRRHGGDE"
FT   gene            623245..623775
FT                   /locus_tag="STHERM_c05410"
FT   CDS_pept        623245..623775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01510"
FT                   /db_xref="GOA:E0RQK6"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK6"
FT                   /protein_id="ADN01510.1"
FT                   /translation="MNLTALDVVFLGVIGFFIVQGLIKGFIQGFMSVLAVGGGLTAGAL
FT                   FSSRAAGLFDALLGASPWSPVLGFLSLFIVVYAVVKLLENALQSLIERVHLENLDKALG
FT                   FFLGILKGIVVVAVILLILEAQPFVDTTRMLGTSLFARLLLPLLPDPTGVVDAAREAAG
FT                   AGMLRGGGGTGSL"
FT   gene            623787..624959
FT                   /locus_tag="STHERM_c05420"
FT   CDS_pept        623787..624959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05420"
FT                   /product="DNA polymerase III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01511"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK7"
FT                   /protein_id="ADN01511.1"
FT                   /translation="MFENIIGHSQAVSQLSRELKEGSFPSSVLISGPPYAGKLTMALEI
FT                   SRVLSCERDAAWDCPCDSCRRQRLLLEPLTLVVGPKRFLQEIRASWDTLMRAPGVATRF
FT                   LFVRAVRKLTRRFDPVLWEGEEGKVRQAFDLVAEITELLEGFYPSSEGGELGEGLVKAG
FT                   ERILGFCRKLEAFVPRDGVPVAMVRRILSSVHLSSSRTPHVVILEHADTLQEASRNSLL
FT                   KELEEPSAGTYFILLTRRRTAIIPTILSRVRHYQLFERSTEEMRRVLARIFRLADPPDH
FT                   LSAFFHQFSALEEEGLAAKARGFVRMLMGTAAFDPALLDVPREEWEAWYEVALDELSSF
FT                   LPSSPAGEVEHVSRLLSRACFRVRDLNMNPQTVLEALFLERELAYSGGRP"
FT   gene            624956..626122
FT                   /locus_tag="STHERM_c05430"
FT   CDS_pept        624956..626122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05430"
FT                   /product="putative sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01512"
FT                   /db_xref="GOA:E0RQK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK8"
FT                   /protein_id="ADN01512.1"
FT                   /translation="MRGFLERTLGKLEKLDREQLKRVFEDFVEEYGRLEDVLNSLPEAI
FT                   LVLDEDDRLAFANRLALRLGVVEEDSEGRRLEDAVRDTQIREHVRALLSREETVRGREF
FT                   TFDLGGRRRIFRVDVLPLVRAGMIRGTLVLMEDVTDQRAQEVRLKRMESLASLTTLAAS
FT                   VAHEIKNPLGAISIHLQLIERLLSQKGCLSTEEVSPYVGVIKEEIERLNRIVVDFLFAV
FT                   RPINLEREELSVRELVEETLSLVGPELAQAGVRVDIRIPEDIPSLSLDRRYIKQALLNL
FT                   IKNAVQAMPEGGVLTVWAQLRDGRLALSFSDTGVGIPEHLKEKIFEPYFTTKDTGSGLG
FT                   LTLVYKIVQEHGGEIEVQSKEGKGTTFTLLFPIPATVARRITWNGEQP"
FT   gene            626119..627480
FT                   /locus_tag="STHERM_c05440"
FT   CDS_pept        626119..627480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05440"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01513"
FT                   /db_xref="GOA:E0RQK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQK9"
FT                   /protein_id="ADN01513.1"
FT                   /translation="MRFNVLVADDEKNIREGLKTFLEMEGYEVFLAEDGDRAKKILDEE
FT                   DIDLVIADLKMPGMPGDELLRYVVGGYPTVPVIILTGHGTIESAVQAMRDGAFDFLTKP
FT                   LNLDRLGLLVKRALSTRELVLQHRELQRELERQKKFGMLIGKSPQMKQIFEVIQQVAPT
FT                   RASVLITGESGVGKERIADAIHYFSNRRDKPLIKVHCAALAESLLESELFGHEKGAFTG
FT                   AHATRRGRFELADGGTLFLDEIGEISPAVQVKLLRVLQEKKFERVGGERTIEVDVRIIA
FT                   ATNKDLKREVEEGRFREDLYYRLNVVHIHVPPLRERKEDIPLLIAAFLKELAEENGKKI
FT                   EGIDPKARAILYNYSWPGNVRELRNCIESAVVMCKGTIILAEDLPPQIREEAEGGGLIR
FT                   IAVGTSLEEAEKEIIRATLAYCKGNKSRAAQILGIGRKTLHRKIQEYGLEEVVP"
FT   gene            complement(627484..627885)
FT                   /locus_tag="STHERM_c05450"
FT   CDS_pept        complement(627484..627885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01514"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL0"
FT                   /protein_id="ADN01514.1"
FT                   /translation="MDPLIERMFRIIRAELASFRRSLGFLTDEEADPYYREAWEELEAS
FT                   LDGYAGSFHTRDRVRPSLSPEILAAFRVLGVEPGSPYDTVKQAYREKLKKVHPDRAGKE
FT                   QEEAATRETQRLNEAFETLSAWYREGRSR"
FT   gene            complement(627938..629281)
FT                   /locus_tag="STHERM_c05460"
FT   CDS_pept        complement(627938..629281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05460"
FT                   /product="aspartokinase 3"
FT                   /EC_number="2.7.2.4"
FT                   /note="aspartate kinase 3 chloroplast precursor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01515"
FT                   /db_xref="GOA:E0RQL1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL1"
FT                   /protein_id="ADN01515.1"
FT                   /translation="MVVMKFGGTSVQDAERMDRVLSIAEEELNEGVVLVASATAKTTDR
FT                   LIQLTQASARGDEESVQSILNLIKTHHFQIAHDFLEGEYLEKAVARLETLFAELGTIVK
FT                   GMTLLKEVSPRTLDAVVAFGEILSTTLLYHRALQRGLKARLLDSRNYIITDDSFGNATP
FT                   DIRETYRRLSSGVKVGAGDLVIMQGFIASTPDGTTSTLGRGGSDYSAAIVGAGLHASRI
FT                   EIWTDVHGVMTADPRIVPEAQPIPQLSYEEAAELAYFGAKVVHPSTIQPAVEKNIPVLV
FT                   KNTMDPNGPGTTITHRSPYKGLKAIATKRNITLITIQSYRMLNAYGFLSRIFDVFAEYR
FT                   TPVDLIATSEVSVSMTIDNKANLHPITRELSKIGKVVVEEEKAIISLVGEDVWKTHETI
FT                   LNAFSALQGIPVRMITMGSSHINLSLVVADGDGEESVRRLHRAFFEKG"
FT   gene            629338..631776
FT                   /locus_tag="STHERM_c05470"
FT   CDS_pept        629338..631776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01516"
FT                   /db_xref="GOA:E0RQL2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL2"
FT                   /protein_id="ADN01516.1"
FT                   /translation="MWGMKAEERISARACGKIREAIADAEGNEVVLAAWLDGAGTVDRV
FT                   EVVSRGDVESAPAVLRHLERVDVVIHNHPSGVLAPSKADLSVAGILGEEGVGFYIVDNE
FT                   VRHVYVVVEPLPERPLTPLPEEELAALLSPGGPFSAMPHYEYREAQVGLLREVVRAFND
FT                   DGILVAEAGTGIGKSYAYLIPALLWGTNNEERVVVSTATITLQQQLVEKDIPYVQKVLG
FT                   TRVKVTLVKGRQNYLCRHRLAEVLEEGAEDLFADPDLLKALADWAVSTPTGDRADIPFH
FT                   VPDEVWGQVCSEAELCMGLRCPDRERCFVLRVRKEAAASRLLVVNHHLLFSDLSMRMEG
FT                   RGFDTAAVLPGFSRLILDEAHNLEDSASSFFSQVLSPEGVLRVLRRIHSRGRRGAKGVL
FT                   RRLEKTLGGLEQAEEWIADLNRIAERAEALRGVWLALLPEEGTVRMDGDAVSRCAPGFE
FT                   SLFALQEEILGFLGEVDRLIKSLDEAMKDHPAVQEFLLHVRRLRDVARFCQAYRDRADA
FT                   EQVYWVERVRRTRGEPSFRLVITPLDPGALLREHLYEAVKTLVFTSATLTVGGSFTFWE
FT                   ETVGLVGMGDRLRERAFPSPFPYEEHVLLSVPTDAPPPEDAGYQAYLSSLLKEVLVLSE
FT                   GHALVLFTSYRMLEDTYRDVAPVLLDHNLLVLKQGEDERSRLLSRFKEIPASILFGTES
FT                   FWEGVDVPGEALQLVVLCRLPFRVPSHPVLQARVERLAAEGKSPFYHRQLPEAIMRFKQ
FT                   GFGRLMRRTTDRGVVLVTDSRIVSRSYGRLFLSSIPRTRLAVTHTEGVLREMERFLYPG
FT                   "
FT   gene            complement(631858..632127)
FT                   /locus_tag="STHERM_c05480"
FT   CDS_pept        complement(631858..632127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01517"
FT                   /db_xref="GOA:E0RQL3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL3"
FT                   /protein_id="ADN01517.1"
FT                   /translation="MKVRPLGDRVLVKIELSETKTASGIYIPQTAQEKTQMGTVVAVGD
FT                   DKDNIKVKVGDKVLYDKYAGTSIKIEGEEHLILSMNDILGVVEE"
FT   gene            632623..633960
FT                   /gene="rrsA"
FT                   /locus_tag="STHERM_c05490"
FT   rRNA            632623..633960
FT                   /gene="rrsA"
FT                   /locus_tag="STHERM_c05490"
FT                   /product="16S ribosomal RNA"
FT   gene            634198..634274
FT                   /gene="trnA1"
FT                   /locus_tag="STHERM_c05500"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            634198..634274
FT                   /gene="trnA1"
FT                   /locus_tag="STHERM_c05500"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            634336..637340
FT                   /gene="rrlA"
FT                   /locus_tag="STHERM_c05510"
FT   rRNA            634336..637340
FT                   /gene="rrlA"
FT                   /locus_tag="STHERM_c05510"
FT                   /product="23S ribosomal RNA"
FT   gene            637383..637497
FT                   /gene="rrfA"
FT                   /locus_tag="STHERM_c05520"
FT   rRNA            637383..637497
FT                   /gene="rrfA"
FT                   /locus_tag="STHERM_c05520"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(637700..638572)
FT                   /locus_tag="STHERM_c05530"
FT   CDS_pept        complement(637700..638572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05530"
FT                   /product="GTP-binding protein"
FT                   /note="era homolog"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01518"
FT                   /db_xref="GOA:E0RQL4"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL4"
FT                   /protein_id="ADN01518.1"
FT                   /translation="MKVAVCAIVGRPSSGKSTLLNTLCGRKVAITSPVPQTTRNRIRGI
FT                   VTEERGQIVFIDTPGYHQSEKKFNLFLKEQVIEALKEVDEILYLVDSTRSIGEEEHELI
FT                   ELVKQAGKPVVIALNKIDIPEHHAEGMVPLLKAHFPSAPIVKISAYTGEGLEDLKARLF
FT                   EAAEEGPQLYPEEFYTDQEPRFRIAEIIREKAIHQTREELPHALYVEVLDVEERPDETL
FT                   WARALICVERESQKGIIIGRGGEKIKTIRLQSEKELSGIFERPVRLDLRVKVVPKWRRN
FT                   EGLLRRLLT"
FT   gene            638666..639250
FT                   /locus_tag="STHERM_c05540"
FT   CDS_pept        638666..639250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01519"
FT                   /db_xref="GOA:E0RQL5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL5"
FT                   /protein_id="ADN01519.1"
FT                   /translation="MRFQEKDERKEQGDQQALMEKFLRTRSIILSGEVNKELVEKVVKQ
FT                   LLLLEQMGDEPVKVFIDSPGGDVDAGFAIFDMIRFVGVPVYTIGMGLVASAAALILLAA
FT                   PKEYRLGLPNSHYLIHQPWSGMRGVATEIEIHAKEIERTRHKINQIISEETGRPLEQVE
FT                   KDTDRDYWLNAGEALSYGLISRIISSGKELV"
FT   gene            639254..640189
FT                   /locus_tag="STHERM_c05550"
FT   CDS_pept        639254..640189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05550"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01520"
FT                   /db_xref="GOA:E0RQL6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL6"
FT                   /protein_id="ADN01520.1"
FT                   /translation="MGRPHLVFFLLLFRLVGVRGEEYVVATYNVENLFDAVEDGAEYDE
FT                   FRPSSFWTEEKVLVRLEAVSRVVRSLDADVLILQEVENERVLGRLVSGYLADAGYRWHF
FT                   LPEEEGAVHVAVLSRIPVEGVRVHALKDPRVAALRSVVEVEYRLGGEQVFLFGVHLISR
FT                   AGPAWRDEIRRNQLFLIARRLEEIRRTAPGVHVLVGGDFNMEADAVETFFDRALFPQDV
FT                   HSVWSMMVPGTMPPGSYWYEGRWERIDGFFFTEGLRDGVGLDVTGGEVVAFPWLLDERG
FT                   RPWSWDMGTGSGYSDHLPVKVILTDLTRMK"
FT   gene            640233..640433
FT                   /locus_tag="STHERM_c05560"
FT   CDS_pept        640233..640433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01521"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL7"
FT                   /protein_id="ADN01521.1"
FT                   /translation="MSKAHRGKGLKDQPKKGRGKCPLCGRTGVKLLYEVSAHEKKLSVC
FT                   KPCSKAVAHGKREEALAALAE"
FT   gene            640503..641333
FT                   /locus_tag="STHERM_c05570"
FT   CDS_pept        640503..641333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05570"
FT                   /product="xylose isomerase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01522"
FT                   /db_xref="GOA:E0RQL8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL8"
FT                   /protein_id="ADN01522.1"
FT                   /translation="MRLGGPLFAEVRSPEEWVTLLRRWGYRAAYAPVSPEASSEEIAAY
FT                   REAAERADIVIAEVGVWNNPLSRHPGERKAALDACVRALSLADELGARCCVNIGGSLGE
FT                   KWDGPCADDLGEEAFDLIVETVRSIIDEVKPLRTFYTLETMPWMYPHTAESYERLIKAV
FT                   DRKAFAVHFDPVNMIWSPERFFHNAEVIRDFVRRLGPWIRSCHLKDVRLQDRFLVHLEE
FT                   VIPGRGNLDYRTLLSELDRLDDVPGMLEHLSTPEEYVQARDYVTQVAREIGVGL"
FT   gene            641357..641638
FT                   /locus_tag="STHERM_c05580"
FT   CDS_pept        641357..641638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01523"
FT                   /db_xref="GOA:E0RQL9"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQL9"
FT                   /protein_id="ADN01523.1"
FT                   /translation="MSPFEALMLLCFGAAWPFSIHTSYVSRSTRGKSLLFLLVLLIGYT
FT                   SGIIHKLFYARDPVLILYILNWTMVGIDTLLYLRNRRMEREALRRASR"
FT   gene            complement(641646..642701)
FT                   /locus_tag="STHERM_c05590"
FT   CDS_pept        complement(641646..642701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05590"
FT                   /product="2-hydroxyacid dehydrogenase-like protein 2"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01524"
FT                   /db_xref="GOA:E0RQM0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM0"
FT                   /protein_id="ADN01524.1"
FT                   /translation="MKHLPSILMYDTKPYDREFFESVNQRYGFTIKYLSDRLTEDNAIL
FT                   AKGYDAVCLFVNDYVTPKVAEVFASAGVKLIALRCAGYNNIDLPSVYGKIHVVRVPAYS
FT                   PHAVAEHTVALLLALNRKVHRAYWRTREFNFSLTGLMGFDLHGKTAGIIGTGQIGRLVA
FT                   QILGDGFGMRILLHDPYPAGEWAASHGFSYVPLETLYRESDVISLHCPLTPQTIHLIND
FT                   ESLSLMKKGVFIVNTGRGKLIDTKALIQALKRGHIGAAGLDVYEEETEYFFEDHSDTHI
FT                   QDDVLARLLTFPNVLVTSHQAFFTREALTNIAETTLKNIDDFFSGRSLENEICYQCDKA
FT                   SCRKKETGRCF"
FT   gene            642787..643932
FT                   /locus_tag="STHERM_c05600"
FT   CDS_pept        642787..643932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05600"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="D-mannonate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01525"
FT                   /db_xref="GOA:E0RQM1"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM1"
FT                   /protein_id="ADN01525.1"
FT                   /translation="MKWNFWYHTCHIRRVCHEECVMAPTIVVRWFGPKDDHVPLQWIRQ
FT                   VPGVEGVVSALFDIPVGEVWPKGRIEELKSLICSHGLSFEVVESVNVHEDIKLGLPSRD
FT                   RYIENYILTLRNLASVGVKVVCYNFMPVFDWIRTDLAYTLDDGSSTMAYDRRLLEGKGV
FT                   EDLVSAMFGQSKGFSLPGWEPERLAAVRSTIEQYRAMGEDELFDNLRYFLSAVVPECER
FT                   LGIRMAIHPDDPPWGVFGLPRIVTTEENILRILALVDSPANSCALCTGSLAARSDNDVA
FT                   RIIRRVGERGRLAFVHLRNLKKQGEGIFYESAHPSFCGSLDMYELVAALHGIGFDGYLR
FT                   PDHGRHIWGEEGRPGYGFYDRALGIAYILGLWEGIEKSASR"
FT   gene            643996..645159
FT                   /locus_tag="STHERM_c05610"
FT   CDS_pept        643996..645159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01526"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM2"
FT                   /protein_id="ADN01526.1"
FT                   /translation="MPMEGTNREAPGGNEDYLKYYDLLKRIGVLDELQHYRNEISNLEE
FT                   IISQAVELLSKSSIEEVLEVVVQGLMDKFIPSYLTLILQEAGVEGKILVKCYERLREIP
FT                   PPFEITSLDGYREFFERHPSSISFSLFEYKVPSPGLVEPLRAVEAEILVPVIGMGGVYG
FT                   LIVFGKKVLGEDYTPQELAYIGRLVEFVSISLQNNIHYRSSIMDFKTGIYNASFFMRRL
FT                   EEELYRVKRYGGHLGLIILDVDHFKLFNDRYGHLAGDEVLISIARNIKQNLRKGDVAAR
FT                   YGGEEFVVLLPGANRNAAYIVAERVRHSIELMKVYFEDKILHVTVSVGVTSCTRYRLLD
FT                   PRKLIEEADQALYLSKERGRNRTTVYRKGLLSLAEEYREALLEQVRT"
FT   gene            complement(645163..645528)
FT                   /locus_tag="STHERM_c05620"
FT   CDS_pept        complement(645163..645528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01527"
FT                   /db_xref="GOA:E0RQM3"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM3"
FT                   /protein_id="ADN01527.1"
FT                   /translation="MNRIEWKWVFVSMGIFLVTEVVLRVGLTLFGILTLGIGFILFLFI
FT                   KPAVYFLGGLLSGYISPGITLMEPALGAVLINVLSTVLYTPVFGIGKLLGLMISSLAAF
FT                   FFALIGARTGERLQYLS"
FT   gene            complement(645558..646853)
FT                   /locus_tag="STHERM_c05630"
FT   CDS_pept        complement(645558..646853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05630"
FT                   /product="two-component regulatory system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01528"
FT                   /db_xref="GOA:E0RQM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM4"
FT                   /protein_id="ADN01528.1"
FT                   /translation="MTQGTEKKHRILIVDDTPPNIQLLGSILQEHYIVSFAESGPEALS
FT                   RLEKTPFDLILLDIMMPEMDGFEVCRRVRSNPKTKDIPIIFLSAKADRESVMKGLELGG
FT                   QDYVVKPYDPRELLKRVQTQLSLREQQKKIEELSQKARPAAIPLTKLTGLEFLTRKQFY
FT                   EKLMFLTIHENLSSRLNLVRDTPLLTENDPALSLAEIEKILLLTRNHLSKNKDGLLKAG
FT                   MEEARELMTAFSKAELQKHLVIIREALKQHNVISNGLFFVKTYFETLKDHVSHTEDGTD
FT                   RPVSDMVASVLEEVLPLLPETVTVTTATPPVQDPSPLSRDHLFLILAHGLLTAAESILS
FT                   GEGEGDVSFSAYAHGGILYLEISDTGTGLKVQERRRLLRAFEEEDLGVGILALGLATVK
FT                   ELVETQYKGTFRIEETEAGTKTSVHIPLRMVQ"
FT   gene            complement(646850..650668)
FT                   /locus_tag="STHERM_c05640"
FT   CDS_pept        complement(646850..650668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01529"
FT                   /db_xref="GOA:E0RQM5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM5"
FT                   /protein_id="ADN01529.1"
FT                   /translation="MTSSRGGGEISSLEESLEEVSLDMGAPGASLCLTITYELQEIARW
FT                   EAPDAVTLLDALLLSTDEGRFWIEGFELRNFTHLSILDGRIHLYPLKVGGFLYGILAVD
FT                   SPSHPEAFLSHKSRYEQAWFSALPWERIFTPGFRLDIAKNLLPSLRTGLLYLDVRTRSI
FT                   DLHLPGSSTSPSTSLTLSEPEFLATVEPDARKSLEEFLAAPHDTFHGRFSFPGRGRTSF
FT                   LVIPLPVQGRILPFLLLDVHAETLYFESLQEQRRLFTSVLDSFTDYILVTDSDRRILYA
FT                   NTAFETWAYLLEGRPLPSLVGKPISLVSRAIDAHLRPLLEEAEKSDTVILREISWQHRA
FT                   EEITTEVTIFPLHKDYETARWLIILHNITHRKRTERLLSQQKQFYRQMLEALPIGVYTL
FT                   DPLSDYTVSLWNPYMERITGVPRQKALGVPETRLFPPPLSEELEVLNRKILEDPLTRVL
FT                   VPSMEVEFPHQEESRIVKVQKRGVLTPEGELDHILVLLEDITEQRRTEEELERYRNHLE
FT                   EEVARKSAELARAAMEMDAILRSTESVAICSMDRDLRIQIFNPTLARLSRMYFKRPPRR
FT                   EMRFTDLFPTRTMQRQVETAVSRVLSGQTFTTRFSVSRRNLLPLHLEVVISPKRNEGGE
FT                   ILGATVIAMDITQRATVERQMRLFKAIADTAPYGTVIIDANHTIVYANPYMARIHGYRL
FT                   EEVMGQHLSIFHTEEQYEKLIEELTRAEDVGVMPSQEIWHVYQGQLPFPMLTTATFIKD
FT                   EEGHVTYIGIVSLDMSLQKEAEQKLKEAKEEAERAMRAKSEFLANMSHEIRTPLNAIIG
FT                   FTDLLASSFPSGKEASYLDAIRSSGKNLLMLINDILDLSKIEAGKMTLSYSPVDLRSFI
FT                   EEIANIFRTQVEHKGLSFILDYAPALPPTVEIDELRLRQVLFNLIGNAIKFTEQGHVKV
FT                   QVRGSLHTEESKVDLTISVEDTGIGIRPEEREAIFQSFHQSSGQDTRKYGGTGLGLTIS
FT                   KRLVEMMGGTISVESEYGKGTTFTVNIPDLTCSTERMVSATEETGGDVPMYEGKVILVV
FT                   DDKDLNRTLLKEYLAPTGATVIEASNGQEALSRAEAHPPDLILMDIRMPVMDGLSFIKE
FT                   YYRDPSHRNIPVIALTASVLKERHEEFLRNGFVEVLTKPIQKDALFSTLRSFLPTETSR
FT                   TAAPPPPREEHLEFTAEDLARRAQILSLYDREIAPLLEEAKETWLNTTLEELGSRAKEA
FT                   GTRIGSPFLSGWGASLEEAVQSFNIHRIRTLIKEFEEKIGRLKEESL"
FT   gene            complement(650738..652651)
FT                   /locus_tag="STHERM_c05660"
FT   CDS_pept        complement(650738..652651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05660"
FT                   /product="biosynthetic arginine decarboxylase (ADC)"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01531"
FT                   /db_xref="GOA:E0RQM6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM6"
FT                   /protein_id="ADN01531.1"
FT                   /translation="MARKEIKAWTIKDSDEYYGISRWGGDFFGISESGEVTVKLSTPER
FT                   KTEEVSLYEIAQKVVQGGLSFPVLLRFRDILRAKIHELNNAFLSAIKESGYRGTYRGVF
FT                   PIKVNQQQQVIEDIVEIGRPFHYGLEAGSKAELFIALSHLRDKESLLVCNGYKDREFID
FT                   LALYGTKLGHKVVLVIERLSEIRTIIERSRALGILPFLGIRVKLSSTTPGKWSESSGDQ
FT                   SIFGLTSHQVVSAVKILKEEGMLDRLVLLHYHLGSQIPDIRHIRSAVKEAARYYAALYK
FT                   EGATMGHLDIGGGLAVDYDGSQTNFHSSRNYTLKEYATDVVEEVMEILDPEGIPHPTLV
FT                   SESGRFVVAYSSVLLFNVLDSSSLTVAPDQLSVPEECSPTLKELIDIYNSISVKNVQEA
FT                   FHDIIYYRDLIRSQFIMGDIPLWERGLAELYFWNGIEKLVKVAKQLKYVPEEIEEAEAS
FT                   LAHIYYGNFSVFQSLPDAWAIDQLFPIVPIHRLNEQPEIPAIIADTTCDSDGKIDTFID
FT                   IYDTRPYLLLHPLKDEDYIIGIFLVGAYQETLGDLHNLFGDTHIVNVALDEDGEIVFVN
FT                   EVEGDTVEDILSYVEYIPKAILHRLKRKVEQALKEKKIGLPEKKAIMEAFEEGMRGYTY
FT                   FE"
FT   gene            652620..653300
FT                   /locus_tag="STHERM_c05650"
FT   CDS_pept        652620..653300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05650"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01530"
FT                   /db_xref="GOA:E0RQM7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM7"
FT                   /protein_id="ADN01530.1"
FT                   /translation="MVQAFISLRAIPFSLPLLWIRSLSLYYDSDHMWKRGGLSVNGAVT
FT                   GKARLFLTFFSIGAVTFGGGYAMIPLIQRDLCERKRWLEEKEMLDILAAAQSVPGAVAI
FT                   NTASLVGMRLAGVGGALAAMLGMVLPSFLVILLVAGVLYRFVHVELVGHAFAGMRAVVL
FT                   GLLASVVLSVGRSTVKDAWSGVIAVGAVVCVVVLGVHPVLVLLGAGVLGLLASLWRTGR
FT                   RSDE"
FT   gene            653293..653880
FT                   /locus_tag="STHERM_c05670"
FT   CDS_pept        653293..653880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05670"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01532"
FT                   /db_xref="GOA:E0RQM8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM8"
FT                   /protein_id="ADN01532.1"
FT                   /translation="MSEVWGLFVSFFKIGAFAFGGGYAMIPLIASEVEGHGWLSARVFA
FT                   DVVAIAEMTPGPVAINMATFVGFRVAGVPGALVATVGVVLPSFLLVLVVGRWLARWEKA
FT                   PLKEAVFSGLRPAVVGLIGSAVWVVGRGALLDHPPEALRIPLGPGVDGISLLIAAAAFL
FT                   VFRTLRLHPVWVILGGAAAGMLVGLMVPGWGG"
FT   gene            653920..654006
FT                   /locus_tag="STHERM_c05680"
FT   CDS_pept        653920..654006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01533"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQM9"
FT                   /protein_id="ADN01533.1"
FT                   /translation="MDNLDGNSKKKYVILQIGWKRSYLKERR"
FT   gene            653973..654410
FT                   /locus_tag="STHERM_c05690"
FT   CDS_pept        653973..654410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01534"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN0"
FT                   /protein_id="ADN01534.1"
FT                   /translation="MEKVLFEGEAVIRIHRDLEYALIALAHLSRVRGLVSSRELASSTG
FT                   LPEARLRKILQRLGRAGVLRAVQGVHGGYVLERSLSELTIGEVARALDERVILPCGRDG
FT                   CEVPEFCVMRPGVIDLVSLLEQHVYSLPLSRFIGGAYEFAR"
FT   gene            654352..654732
FT                   /locus_tag="STHERM_c05700"
FT   CDS_pept        654352..654732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05700"
FT                   /product="putative metal-sulfur cluster biosynthetic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01535"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN1"
FT                   /protein_id="ADN01535.1"
FT                   /translation="MSTACPSPVSSEVRMSSHDDARGKKPPVSREVVYEALSNVYDPEL
FT                   GLPITDLGMVYRVDVFPDRIELDFTLTYPGCPLGEVIEKAIRAEVGKVAHTDNLVVRLV
FT                   WDPPWTPDFMSEAARFSLGYPI"
FT   gene            654743..655519
FT                   /locus_tag="STHERM_c05710"
FT   CDS_pept        654743..655519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05710"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01536"
FT                   /db_xref="GOA:E0RQN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN2"
FT                   /protein_id="ADN01536.1"
FT                   /translation="MAELRIEGLRAEIEGKPILQGVDLVLRTGEVHALMGPNGSGKSTL
FT                   AHVIMGHPSYTVTGGRILLDGEDVLELPPEERAVRGLFLGFQYPAEVSGLTTGKFVKRV
FT                   LEKHPARNMPVTQMIKELKEALTRMGLSQEFINRSLNEGFSGGEKKRMEIVQMLMLRPR
FT                   FAILDEIDSGLDIDALKDVAEGINSLRGPEFCAFVITHYQRILEHVHPDFVHIMYRGRI
FT                   LTSGGRDLVETLEAKGYEWLRKEFGIEEDEHEYVHN"
FT   gene            655500..656897
FT                   /locus_tag="STHERM_c05720"
FT   CDS_pept        655500..656897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01537"
FT                   /db_xref="GOA:E0RQN3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN3"
FT                   /protein_id="ADN01537.1"
FT                   /translation="MSTSTIDFGEYKYGFSDVVKPVVQEEKGLSEEVVKRISYYKEEPD
FT                   WMREFRLRAYRIFKSKPMPTWGVDLSALNFDDIYYYVRPTDRAGRSWDEVPETIKRTFD
FT                   RLGIPEAERKYLAGVGAQYDSEMVYHSIKEELASKGVIFCDPETAVREYPDLMRKYFGT
FT                   VVPPGDNTFAALNSAVWSGGSFVYVPKGVHVDIPLQAYFRINTQNMGQFERTLIIADEG
FT                   SFVHYIEGCTAPVYTTASLHAAVVEIIALPGARVRYSTIQNWSGDVYNLVTKRAVAYEH
FT                   ATVEWVDGNIGSRKTMKYPSVYLMGPYAHGEVLSIAFAGKGQEQDTGAKMIHAASHTSS
FT                   VITSKSISKDGGIATYRGLVRVEEGVRGARSHVVCDALIMDPQSVSRTFPYMEIKSPHV
FT                   HMEHEAKVSRVSEQQLFYLMSRGFSEDEAAAMIVNGFIDPLVKQLPMEYAVELNRLIEL
FT                   EMEGSVG"
FT   gene            656929..658011
FT                   /locus_tag="STHERM_c05730"
FT   CDS_pept        656929..658011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01538"
FT                   /db_xref="GOA:E0RQN4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN4"
FT                   /protein_id="ADN01538.1"
FT                   /translation="MAREKASGMGLPARSEEEWRRTDVTVLDWERRSNAGVRVLVEGDE
FT                   AGAGESPAVLAMLERLSGRLDNVFLARALGSEEVVWVRTGGGERVVRIRQGERVRSDVH
FT                   VLVEARPGDQGVVRLVHEGGRGSVLNVLVSVWVGEGARVVLVDEGARRADAARVVHVWG
FT                   EVERGAVLEHASLVTGSWFTKQRVHVRLAGEGAEAFLRGVMVAGRGDHYDARTVQEHVG
FT                   PQTRSLAQYHAVAGEDGRTVYQGLIEVAGSARGTDAYLSNKNLLLSEEAASYSIPTLSI
FT                   GTDDVRCSHGSTTGHVREEELFYLRSRGIPEEEAVGLLAAAHIRAVTDHLPSSLAERVA
FT                   RRAERKVKRMKGVALRGEVA"
FT   gene            657995..658297
FT                   /locus_tag="STHERM_c05740"
FT   CDS_pept        657995..658297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01539"
FT                   /db_xref="GOA:E0RQN5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN5"
FT                   /protein_id="ADN01539.1"
FT                   /translation="MAKWHRTVPVDSFQRAASVQCGKRRIALFKLEDGVYAIDDVCSHE
FT                   FSLLSEGEVWEGEVYCVKHGSRFDIRTGKVLSLPATKDVRTYEVKVEDGYVYVRC"
FT   gene            658284..659525
FT                   /locus_tag="STHERM_c05750"
FT   CDS_pept        658284..659525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05750"
FT                   /product="probable cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01540"
FT                   /db_xref="GOA:E0RQN6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN6"
FT                   /protein_id="ADN01540.1"
FT                   /translation="MSVARGYHVEALRAEFPILSRRMGGRPLVYLDNAATTQRPSRVIE
FT                   AMRSYAREHHANVHRGLHTLSVEATSLYEEARREVARFIGAGSEREIVFTRNATEAINL
FT                   VAHTWAEAFLEPGDVVVLSEMEHHSNLIPWQLLARRKGVQLAFLPFDENGMLDLASLDE
FT                   LWTERVKLVSLVHVSNVFGTVNPVEEIVEYAHRRGALVLLDGAQAVPHLPISIEALGCD
FT                   FLAFSGHKMYGPMGIGVLYAREELLEAMPPFLGGGEMIRSVTLETATWNEVPHKFEAGT
FT                   PNVEGAVGLAEAVRFLREVGMEAVAAHERELTAYALEALKQVPDITLYGPGIPHQAGIV
FT                   SFTLKDVHPHDIAQLLDREGVAVRAGHHCAQPAMRKLGVPATARASFGLYTTKEEIDIL
FT                   VSSLIKVQEFFRHA"
FT   gene            659518..659958
FT                   /locus_tag="STHERM_c05760"
FT   CDS_pept        659518..659958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01541"
FT                   /db_xref="GOA:E0RQN7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN7"
FT                   /protein_id="ADN01541.1"
FT                   /translation="MHDELYQEILLDHYRHPRNKRPLPHIPESRAHENPTCGDSVKLEV
FT                   KLHDGVIEEVAFDGKGCAIDTASASIMTELLKGKTVEEALALAEKVIRMIRGEDPTPFE
FT                   EFGDLVVFSGLSAYPVRVKCATLPWHALLDEISKLRSDIPSR"
FT   gene            complement(659868..660788)
FT                   /locus_tag="STHERM_c05770"
FT   CDS_pept        complement(659868..660788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01542"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN8"
FT                   /protein_id="ADN01542.1"
FT                   /translation="MDHLTALVLAYQRGGVPFEALFHYLAWFVYTYPSREEERSDFLLF
FT                   FYPRLKALARRFVYTGVPFLHYLRSSMRWQYRTFKRVQQERASLERSLVRREHEEAVLL
FT                   FDPSMKLEEGEADAVMEEIVEWIRGSAPHRKQRFLCLLLRELPSLPPRWERPLAAALDM
FT                   EEERLAGCFLMLQERVTERKARYLRLSRKINELRMEIRLLEDRLSREGKGCDRDAFRKG
FT                   LERRRRQLARLERRRNGIPLKPRHSDIAEVLGIPKGTVDSGIHYLLKELSSRRPPQREG
FT                   ISLRSLEISSRRACQGSVAHLTLTG"
FT   gene            complement(660879..661850)
FT                   /locus_tag="STHERM_c05780"
FT   CDS_pept        complement(660879..661850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05780"
FT                   /product="DHH superfamily protein, subfamily 1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01543"
FT                   /db_xref="GOA:E0RQN9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQN9"
FT                   /protein_id="ADN01543.1"
FT                   /translation="MQVPQDVIDWIQEREHILVIGHKDPDGDCVGSQMALSLFLGRVGK
FT                   KPLPLSPGPFTSAEVRQFAPFFKTRFDEEELAFLEKVGIVVVDTSSPERTGPFRDLISR
FT                   HPTLVIDHHSAGTPFGDLRWVEPSAPSTTFLVQLLIEAMAGNISQEEAFYLFYGLATDT
FT                   GFFRFLEQGSGEAFRAASRLVDAGISPRTLSLAINGGQSFLSRRWIGMMLERMEPLCDG
FT                   KFVILCETRADRERFSDEHRESDLLYHLVLDIEGCEALAALREEPNGRCKVSLRSKVFL
FT                   DVGALAREFGGGGHVHAAGFETDLPLSEAKALIIERFLQFCK"
FT   gene            complement(662004..662402)
FT                   /locus_tag="STHERM_c05790"
FT   CDS_pept        complement(662004..662402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01544"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP0"
FT                   /protein_id="ADN01544.1"
FT                   /translation="MKTMRRLAGFLLFLVAGHLLIAEVLPSDLYVKTVYVTKVYAHEKG
FT                   YKVLYVKSNLDIGEVYIPLSWVAEKKAVIVPGNDPAFPYMSIYWKKGEFFKVILYVPEK
FT                   PDHPGWGILPRTEDVSALFEVDTLQMEF"
FT   gene            662569..663258
FT                   /locus_tag="STHERM_c05800"
FT   CDS_pept        662569..663258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05800"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01545"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP1"
FT                   /protein_id="ADN01545.1"
FT                   /translation="MQILVTGARRGLGRALVETFLERGHSVHALGRSLSKELEALVEAH
FT                   PDRCFFYAVDVTEESQLEAVRREVGERVDAIDILVNNAGVHLEQDRPDLSRVDFSVYLP
FT                   TFLTNSVAPLMVIRAFLDLILRSPRKWIANISSEAGSIGNCWRESEYSYCMSKAALNMA
FT                   TRILQNRLGKEGAVVRSIHPGWFSSDMGGAAAPITPEQAAAKVADVILTLPEHPLYVDL
FT                   EGKALPW"
FT   gene            complement(663259..665640)
FT                   /locus_tag="STHERM_c05810"
FT   CDS_pept        complement(663259..665640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05810"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01546"
FT                   /db_xref="GOA:E0RQP2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP2"
FT                   /protein_id="ADN01546.1"
FT                   /translation="MKLFERNRTRGSLILPVIPVRDTVLLPGMGIQMASEKPIGIQAVL
FT                   EARDHAQNRLFFCHAKPEAPPDFKPEAVYEVGTIGQIIHLQQNREGHVRIIVQGLERAR
FT                   IQQFTSLTIPLRAQIKPLEENLELTDEVAALMRLLREEFLEYARNAGGIPPKVKETVEQ
FT                   TDSPLVLFSSILHHLPLPTATKAALLALEDPREYLSRLGEELKAEQEVLSLRQEITARV
FT                   KRRMEQSQKEYVLQEQLKEIQRQLGKDVDDPAGLKDLEERLKAKVLPDEVQTKAERELD
FT                   RLKKLQPLSPEAGVLRTYLEWIVDLPWTERTTDSKDIRRAQEILDEDHYDLVKVKERIL
FT                   EFIAVRQLSEESRGPILCFVGPPGTGKTSLGRSLARALGRNFVRMSLGGVRDEAEIRGH
FT                   RKTYVAALPGKIIQTMKKAGSINPVFLLDEIDKMSSDFRGDPASALLEVLDPEQNHAFV
FT                   DHYLEVPYDLSHVMFVTTANSLHTIPYPLRDRMEIIEVSGYSDVEKFHIAVNHLIPRQQ
FT                   KENGLDWAAITFRREAVYHVIHHYTLESGVRELDRTIGRIMRKIATEVVEKKVHPEKEG
FT                   RPFSKVITAKAVERYLGPPRIPRNTRPLEPRVGLAYGLAWTELGGRLLPVEAVSFEGRG
FT                   DLILTGSLGDVMKESAFAGLSFLKAHARSFNLNDEIFSRRDIHIHVPEGAIPKDGPSAG
FT                   ITLTAAMLSVLTGIPPRHDVAITGEITLTGRILPVGGIKEKVLAAHRHDIPSVLLPKEN
FT                   EKDLTDVPREVRQRLSFVFVESLAEALAVLFPETPFTLRT"
FT   gene            complement(665637..666875)
FT                   /gene="clpX"
FT                   /locus_tag="STHERM_c05820"
FT   CDS_pept        complement(665637..666875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="STHERM_c05820"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01547"
FT                   /db_xref="GOA:E0RQP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP3"
FT                   /protein_id="ADN01547.1"
FT                   /translation="MSRVMKNDRACSFCGKSVQYARKLIAGPGVYICDECVNVCKRIID
FT                   EEEENLTWELTEELPTPQEIHSYLDQYVIGQDHAKKVLSVAVYNHYKRILHGHKLSEDV
FT                   ELEKSNILLLGPTGSGKTLLARTLAKKLKVPFAIADATTLTEAGYVGEDVENILLKLIQ
FT                   AAGNNIAAAERGIVYIDEIDKIAKKGENISITRDVSGEGVQQALLKIVEGTVAAVPPQG
FT                   GRKHPNQEMIRIDTTNILFIAGGAFVGLDKIIESRVSEHPMGFGAEVKSRREKNLAELY
FT                   AQMHPDDLIKFGMIPEFVGRFPIHVGLRELKKEDLVRIIKEPRNSVLKQYKATLKLDDV
FT                   DLVVEDEAVEAIADLAIHRKTGARGIRAIFEHIMMDVMYEIPSIPGPKRVVITRDVVLG
FT                   EQKPEIQLLKKSA"
FT   gene            complement(666853..667473)
FT                   /gene="clp"
FT                   /locus_tag="STHERM_c05830"
FT   CDS_pept        complement(666853..667473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clp"
FT                   /locus_tag="STHERM_c05830"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="endopeptidase Clp"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01548"
FT                   /db_xref="GOA:E0RQP4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP4"
FT                   /protein_id="ADN01548.1"
FT                   /translation="MNERMSHLVPIVIEQTGMGERSYDIYSRLLKDRIVFIDGEINDLT
FT                   ADLVVAQLLFLESQDPEKDISVYINTPGGSVTAGLAIYDTMQYVKPDVQTICLGQAASM
FT                   GALLLTAGTPGKRLALPSSRILIHQPWGGVQGQATDISIQAREMVRIKKLLIHYFARHT
FT                   GRPEEEVAQDLERDYYMTPEEAKAYGLIDDILIRSKHESRHEK"
FT   gene            complement(667508..668860)
FT                   /locus_tag="STHERM_c05840"
FT   CDS_pept        complement(667508..668860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05840"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01549"
FT                   /db_xref="GOA:E0RQP5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP5"
FT                   /protein_id="ADN01549.1"
FT                   /translation="MIKDKEIQKLDNSAVRLTITIDQHDAQKMYDELLARLQKDAQIPG
FT                   FRKGKVPTYILEKKFGEGLRYETAERLIQEGLREAFDQIEEKPLSYSVPSLTSDFPTDF
FT                   SKDVTFTVEYDVYPEFTLPDYSDITVEEPKVTISKEDIARELEKLRKQNSYVVEKQDGE
FT                   VKEGDIVTVDYWELDGEGNPVEESRREDYVFTVGTRYNLYEFDDDLIGAKKGEVRTITK
FT                   EFPEDYRFEEFRGKTITVQVEIKAIKEQRLPDLDDEFAQDIDEAYQTLDDLKKAIEERL
FT                   MEQAKAVIRQKKIDQFLTELAKRTEIPIPASMLKAEMDASYQQLAQQYRTTVEALDKVL
FT                   EQDGKTREQIYEEWKPSATEALKKRLIITRLIEERKIEVSDDELETFFKEVAEGAGASA
FT                   DQVKAYYAQMGQLEQIRYDLKERKLFDQLLEEIKVKKGPKVPFVDLVGANE"
FT   gene            complement(668942..669013)
FT                   /gene="trnG1"
FT                   /locus_tag="STHERM_c05850"
FT                   /note="tRNA-Gly-GCC"
FT   tRNA            complement(668942..669013)
FT                   /gene="trnG1"
FT                   /locus_tag="STHERM_c05850"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            complement(669031..669112)
FT                   /gene="trnL2"
FT                   /locus_tag="STHERM_c05860"
FT                   /note="tRNA-Leu-TAG"
FT   tRNA            complement(669031..669112)
FT                   /gene="trnL2"
FT                   /locus_tag="STHERM_c05860"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            complement(669216..669291)
FT                   /gene="trnK1"
FT                   /locus_tag="STHERM_c05870"
FT                   /note="tRNA-Lys-CTT"
FT   tRNA            complement(669216..669291)
FT                   /gene="trnK1"
FT                   /locus_tag="STHERM_c05870"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAG"
FT   gene            complement(669303..669376)
FT                   /gene="trnR3"
FT                   /locus_tag="STHERM_c05880"
FT                   /note="tRNA-Arg-TCG"
FT   tRNA            complement(669303..669376)
FT                   /gene="trnR3"
FT                   /locus_tag="STHERM_c05880"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGA"
FT   gene            complement(669385..669458)
FT                   /gene="trnH"
FT                   /locus_tag="STHERM_c05890"
FT                   /note="tRNA-His-GTG"
FT   tRNA            complement(669385..669458)
FT                   /gene="trnH"
FT                   /locus_tag="STHERM_c05890"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   gene            complement(669574..670050)
FT                   /locus_tag="STHERM_c05900"
FT   CDS_pept        complement(669574..670050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01550"
FT                   /db_xref="GOA:E0RQP6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP6"
FT                   /protein_id="ADN01550.1"
FT                   /translation="MSTYMHWLLYRRPLIRRSWRILSEREKRHVQERRRAFRDAYRKLL
FT                   ETREKEEAEKALEGFWKEWGARAPRMTAALLWRKDRLFSYLELPYEWKEKVRTSNLAEN
FT                   MFRHMRSFLRRYPGYMSRAHADEAVGLYVVGMQIHSQAGRRTPYQLQLNFNTPP"
FT   gene            670223..670771
FT                   /locus_tag="STHERM_c05910"
FT   CDS_pept        670223..670771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05910"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01551"
FT                   /db_xref="GOA:E0RQP7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP7"
FT                   /protein_id="ADN01551.1"
FT                   /translation="MQSIVLVGLKHVGKTSAGTSLARLLGLPFFDVDEELVRIHEAETG
FT                   TRRSVREIYRLLGKEGFKELERKAARFLATWAPHPCVIATGGGICDNPEALAALKERGV
FT                   VVYLQEEPRILYERILEGGLPPFLEGPDPWAAFLSLYERRHTAYLAQADLVVHARGIWE
FT                   DELARSILAALEEHGYARK"
FT   gene            670758..671813
FT                   /locus_tag="STHERM_c05920"
FT   CDS_pept        670758..671813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05920"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="5-enolpyruvylshikimate-3-phosphatephospholyase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01552"
FT                   /db_xref="GOA:E0RQP8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP8"
FT                   /protein_id="ADN01552.1"
FT                   /translation="MPGNSFGTLFRITTFGESHGHAVGVIVDGVPPLLDLSEEDIQKEL
FT                   DRRKPGQSEVGTPRKESDIVHIYSGVFQGKTTGTPLMMILYNQDTRPGDYEAIARLFRP
FT                   GHADYTYHKKYRIRDYRGSGRASGRETAARVAAGAVAKKILAQRGISIIAYTLRAAGIQ
FT                   CRTFDPVVIEKNPMRACDPEAAEKMVERIRTIKEETDSVGGIVECRIRGVPPGLGEPVF
FT                   DKLDADLAKAMLSIGAVKGIEFGAGFRAADMRGSEHNDQMNAQGFLTNNAGGILGGIST
FT                   GEEIVFRVVVKPTSSIARPQRTIDIDGNETEIITEGRHDACICPRIVPVVEAMAAIVIE
FT                   DHYKRQEAMWK"
FT   gene            671858..672535
FT                   /locus_tag="STHERM_c05930"
FT   CDS_pept        671858..672535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05930"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01553"
FT                   /db_xref="GOA:E0RQP9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQP9"
FT                   /protein_id="ADN01553.1"
FT                   /translation="MSTRRRPPRERASDRAYRTIKQAIMEGKLPCGTRLSKRGMAEFCG
FT                   VSVIPVVEALNRLESEGLVESHPYYGSRVIVPNEEQLADMYILREAVEAQAVRILCYTI
FT                   GIDEIEALRKTAAYVDSLAGKAHEDTDFDEAHYSFHFELVKLTRSTLLLESLERIHLFT
FT                   LLVKSEEKYQEVPLIKEYSHLDVVNAIARRDPDEAARTMRRHIYRSYLVSPPLWAELDP
FT                   PER"
FT   gene            complement(672475..673650)
FT                   /locus_tag="STHERM_c05940"
FT   CDS_pept        complement(672475..673650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01554"
FT                   /db_xref="GOA:E0RQQ0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ0"
FT                   /protein_id="ADN01554.1"
FT                   /translation="MGVRGTHAVIYLSHLRHNLREIRRRVGEGRMVCAAVKADAYGHGA
FT                   VEVGKVLVEEGVEMLGVATPEEGAELAGVGARVLLLGLTDGAGLELAVEAGLELAVGDR
FT                   EYVREVARVARAKGRRVRVHVEVDTGMGRTGCAPEEAVGVVEEVEGAGVLELAGMWTHF
FT                   PSSDEADDGFTEAQVERFLQVVGRVRARGISPGLLHAANSGGIIGHPPSWLDMVRPGIS
FT                   LYGYYPSEEQERTLSLLPVMEFVSQVVFLKKVRKGTPVSYGRTWRAPRDTWIATVAAGY
FT                   ADGYSRLLSSRAEVLIRGRRYPVVGRVCMDQFMVDVGPHPRVRRYDRVVLFGPDPSGPS
FT                   AEELARLVGTIPYEITCAVSRRVPRLYVEESPYLSGGSSSAHRGGLTRYER"
FT   gene            complement(673654..674730)
FT                   /locus_tag="STHERM_c05950"
FT   CDS_pept        complement(673654..674730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05950"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="OTCase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01555"
FT                   /db_xref="GOA:E0RQQ1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ1"
FT                   /protein_id="ADN01555.1"
FT                   /translation="MGVHPLLAFLGKTGLLLWVSFSGRRREPMGVNLAGRSFLSLFDFT
FT                   PEEIRYLLRLSHELKGLRRAGVRRRLLEGRHVVLIFEKTSTRTRCAFEVAAADEGAHVT
FT                   FLTNSQLGKKESLEDTARVLGRFYDGIGFRGYAQETVEALARYSGVPVWNGLTDECHPT
FT                   QALADVMTIEEYVRKPLSQVRLVFVGDARNNVARSLLVISAKLGMHFVAVCPPALSPDE
FT                   EFLARAEEVARGTGARIEITDDLDGVEGADALYTDVWVSMGEEDRLEERIRLLEPYRVD
FT                   MALVERTGNPEVLFLHCLPSFHDTNTEMGRLVYERFGIKEMEVSDEVFRSRHSVVFEEA
FT                   ENRLHTIKAVMLATLGAV"
FT   gene            674774..674850
FT                   /gene="trnA2"
FT                   /locus_tag="STHERM_c05960"
FT                   /note="tRNA-Ala-CGC"
FT   tRNA            674774..674850
FT                   /gene="trnA2"
FT                   /locus_tag="STHERM_c05960"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCG"
FT   gene            complement(674899..676557)
FT                   /locus_tag="STHERM_c05970"
FT   CDS_pept        complement(674899..676557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05970"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01556"
FT                   /db_xref="GOA:E0RQQ2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ2"
FT                   /protein_id="ADN01556.1"
FT                   /translation="MAAVWKIINFIGGLSVFFYGMRLMSLGLRKRAGGRLRKVLKSFSD
FT                   TPLKGVFSGTFVTSVVQSSSATTVLVVSLVNAGLLALEEAIGIVFGANIGTTFTAWIVS
FT                   FFGFKFSLSSLVLPVFALALPLMFNRSEKVREVAEALFGFSLVFLGLSIIKDQVPDVQV
FT                   TEQSATFFRFFHHESFLSVLAFVLLGTLATMILQSSSTTVAITLTLLYKGWISFPLACA
FT                   AVLGENIGTTVTALLASIPMNRQAKRIAYAHTLFNVTGVLWMLAVFPWFVKLVDIVVPG
FT                   PVSDAGLVTYHLSAFHTMFNIINTFLFIWFVKPYAALLRRILPEEAAKEELVLVASPFP
FT                   ESLESNLVLIEKALSRMAERVFDMALVILHSLGGDDADLDRMAEQAREMELRFDEMEEA
FT                   IHVTLTRCATESMAEEQAKRLMAYQLISRALESMSDSLYRVARLLKQRGDLDIPFHKRG
FT                   MEELQDYLQIILDFLRYNVSYLSGELAAYDVEHAYRLEQRIDGMRDSLRKRARKKLTKG
FT                   ADVRGELLFMDVVRHLEHVGDYSLDVSQAIKEMAG"
FT   gene            complement(676570..677220)
FT                   /locus_tag="STHERM_c05980"
FT   CDS_pept        complement(676570..677220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01557"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ3"
FT                   /protein_id="ADN01557.1"
FT                   /translation="MPIAGTFCIPRIRESLHAFKKAFPSINRRLSVQREDFTDTLLEHI
FT                   LLAYQFLNRLLSRGIDIFSPAGLYALLEVNHLVMCGNDPATRLSFHLHIEETRRRYQEN
FT                   IDLILPWVRKARGKLPPFAFITEFYIKCLSHPQLFVEGNHRTGNILVNYLLVSEGFPPF
FT                   IVTPETGYEYLELSGAVKFSSKEKVLDTVLPLKKAKKRLMGLFREHGDARYLA"
FT   gene            677310..679547
FT                   /locus_tag="STHERM_c05990"
FT   CDS_pept        677310..679547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c05990"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c05990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01558"
FT                   /db_xref="GOA:E0RQQ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ4"
FT                   /protein_id="ADN01558.1"
FT                   /translation="MNRADNLFDAAKSLHDEPLAARMRPRTLDEFVGQEHILGPGRLLR
FT                   RAIQADRLSSVIFYGPPGCGKTTLARVIANHTKSAFLSLNAVLSGVQEVRAAIEKARQE
FT                   MAYHGRRTILFVDEVHRWNKAQQDALLPWVENGTVILIGATTQNPYFEVNSALISRSRI
FT                   FQLTPLTREHLRTIAERALKDPERGYGKYRIIMDDDALEHLITVADGDARTLLSAIELA
FT                   VETTPDTFPPPEGEVIHITREVAEDSIQRKAVLYDKEGDFHYDIISAFIKSLRGSDPDA
FT                   AFYWLARMVDAGEDPHYIFRRMLILACEDVGMADPHAITVVLSCAQAFDRVGLPEGQYH
FT                   LAHAALYLATCPKSNSVLGYFDALKAVREEKTHEVPRHLKDASRDAKGFGHGDGYLYPH
FT                   SYREHWVAQNYLPRELKGRVFYQPSQQGYEARIREEVLRRRELQLTAAAQVEEEVLTFT
FT                   PEKGMEEWWRRTETDLRPHLEELRDHIFQRAQIVRHHRVLVAERPAGFLVWEAIRRAPE
FT                   GQVVCAVSSEEEAQRIRHQAAGIDDLLAPVLLVDTGPLPTCVQEARLGYQTFERILVRN
FT                   ILGPSPDKERLLADLASLLEPGGIAVCAEAFFRASQRLSPLVPWRGDETPLREALTSVE
FT                   EHLFTNPEDPRVNWDQGTLTELARRAGLALTQVARYEYTTKRTLTREDVLRWVGDPNRG
FT                   YGLHLATLEPALATAIRQKLLETLPGREVPWRRPILVFRLSPALSMSRLTR"
FT   gene            679603..681543
FT                   /locus_tag="STHERM_c06000"
FT   CDS_pept        679603..681543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06000"
FT                   /product="D-alanine-D-alanine ligase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01559"
FT                   /db_xref="GOA:E0RQQ5"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ5"
FT                   /protein_id="ADN01559.1"
FT                   /translation="MEEKVRDTDKPPERRRRRIPAARARCLGPLSDLESHVAPDWWSRI
FT                   FNSYYMKTDGDVVDDLAITRREVDLFTSVLDLREDEAVLDLCCGQGRHSLELARRGFTK
FT                   VEGLDRSHYLIQRAKAQAAKEGIPVRFREGDARKLPHPPDQFDVVMILGNSFGYFETSK
FT                   DDLLVLKEVARVLKPWGRVLLDLADGDFLRAHYVPRSWEWIDPKHFVCRERALSADRQR
FT                   LISREVIVHTEKGVEVDQFYAERLYTPELIRSLLEEAGFQEVSFHGTLTPDSARGQDLG
FT                   MMERRILVSARIRKEWTPVKPKKKNVSTQVAVVMGDPSKPDPLKPFMVFDDDDFYTIDR
FT                   LKAALKECTGYSFTYLSRHETLIQDLMRLKGKIDYVFNLCDEGFFNDPRKELHVPALLE
FT                   MLGIPYTGATPQGLAFCYDKSLVRGVAKEMGVPVPRAFFIDPTSIVFEVPFGFPMIVKP
FT                   NLGDSSFGITQKSVVWSLDELSACISEIRDTFGYEKPVLVEEFLTGKDLTVGIIGNPPD
FT                   DYMVLPIVEEDYSALPPELPRICGYEAKWLPDSPYWKALQSIPAGLPEATEKSIVEWCV
FT                   RLFERLECRDYARFDWRCDADGNPYLLEVNPNPGWCWDGHLAKMARLAGMEYPQMLQAI
FT                   LKAAERRLGIR"
FT   gene            681601..682188
FT                   /locus_tag="STHERM_c06010"
FT   CDS_pept        681601..682188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01560"
FT                   /db_xref="GOA:E0RQQ6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQQ6"
FT                   /protein_id="ADN01560.1"
FT                   /translation="MRQHAANLLTVVRIGLAPVFFVLFLLVPEWVPTSPWLALGLVWVL
FT                   YLVMEFSDLFDGMVARSTGTVSDLGKVLDPFADVVARLTYFLCFVEAGIMPAWVFLLVL
FT                   YRELAMTFLRMMLARKGIALGAKTGGKVKTVLYAVATFLGLVRYSVGGVIPESPLVPVL
FT                   GLVFFVVLGAGVVAAYISFLEYVRAGWEQLRS"
FT   gene            complement(682212..683264)
FT                   /locus_tag="STHERM_c06020"
FT   CDS_pept        complement(682212..683264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01561"
FT                   /db_xref="GOA:E0RQY3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY3"
FT                   /protein_id="ADN01561.1"
FT                   /translation="MKGKAMNHLMRVLIINAPHRAVLEERPIPHPARHEVLIRVHRAGI
FT                   CGSDLHIYEGSNPFVSYPRIPGHELAGEIVSWGSEVRDAPPPGTKVVVDPVISCGKCIA
FT                   CRMGHPNVCCDLQVVGVHRDGSFAPYLVVPAANVYPIPEHLTWNEAVFIEPYSIAANVR
FT                   HRLQVTPDDTVLIIGAGIIGTLTLQAIRLTGARTIICDISEPALERARRMGAEETINTE
FT                   GRDLADAVLAYTGGEGPTAVVDAVGAPSLFESIVRSCAPGARIVLLGFSSVPTPVRQSE
FT                   IIRKELSILGSRLNNRRFPEVVSWFAEGKIDPTPLFVGEYSLKEAPSLLDRISKERALP
FT                   GKLILRLQEE"
FT   gene            complement(683375..683881)
FT                   /locus_tag="STHERM_c06030"
FT   CDS_pept        complement(683375..683881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06030"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01562"
FT                   /db_xref="GOA:E0RQY4"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY4"
FT                   /protein_id="ADN01562.1"
FT                   /translation="MPKITIIYDSETGNTRALAEEVAEGVREGGVEAVLTHVDQADAAA
FT                   ILSSDGLIVGSPTYCGGMSWKLKRFFDQHVDAAWGKAKGKIGAAFTTSGGLGGGNEATL
FT                   FSILSALMNYGFLVFGLPDYSAPGVTAHYGAVAVEAPGEAQKKAARMLGRQAAEYVKQM
FT                   RGNAR"
FT   gene            complement(683951..684832)
FT                   /locus_tag="STHERM_c06040"
FT   CDS_pept        complement(683951..684832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01563"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY5"
FT                   /protein_id="ADN01563.1"
FT                   /translation="MTLRRILLLFLLTIPLTARDFPQSILTIHPFPDTYTSPLLPHGTL
FT                   RLWYETYTLKESPTDSFHIGISGAATPLAWRNLIALRIYFDSILVVGPLAPGDEPASVM
FT                   EWWMNAVQYQYGALLGVRLSPLVLAAEYSRMSFHPLRWRIRDDLHLTDPATDRLGLLIT
FT                   TPPLSPLPWLTIIPSLRAAYVDLFDYWQAHGLPEFREDAYLRAGLLLTLPLHPLIHPYL
FT                   ETWNDLLLFPDTTGYAARFETGILLPSPAGGLRLHLVTNTFSDTQEVEEGPFPMTTAGF
FT                   GFTFIVSSPGGR"
FT   gene            complement(684958..686793)
FT                   /locus_tag="STHERM_c06050"
FT   CDS_pept        complement(684958..686793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06050"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01564"
FT                   /db_xref="GOA:E0RQY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY6"
FT                   /protein_id="ADN01564.1"
FT                   /translation="MRSPTGPFRHQAPLDAPRPTRILPILTRLWRYLRPYRTPLLVALL
FT                   AVLATTVASLAAPLYLKTAVNAMASGPGAVNLSALLSAVLTMAALYLASTGLTWIQVRA
FT                   LITVTQGTLHRLRTDLFSHLQRLPIPYLDRTPHGDLMSRLTNDVATLETTLSQTLTQLA
FT                   SNILLLVGSLAMMLALSPLLTLLTALIIPLAVLTTRTLARMSREAFRNQQHLLGTLNAM
FT                   VEETAGGLRELKAFGRERRFLEDFTTTNERFTATAYRAMVVSSILPPIMNALNGLSFPI
FT                   IALAGGYLALEGHLSVGVVAAFLTYARQFSRPINEISNQFTLIQSALAGAERIFQLLDV
FT                   EEERDIPEARPLTTTSGHLTIEHLTFGYDPARPVLRDITLDAPSGSLIAIVGPTGAGKT
FT                   TLVNLLMRFYDPQEGRILLDGKDTRTITRASLRSHMGMVLQDTHLFTDTIRENIRYGRP
FT                   DATDEEVEEAARIAEAHHFIQHLPQGYDTLLTDRGSSLSEGQRQLLTIARAVLTDPAVL
FT                   ILDEATSSVDTRTERHLQKALRTLMKGRTSFVIAHRLSTVREADLILVIREGRIVEQGT
FT                   HEELMRRKGLYWQFHQHHQDEAELPTPGAGGGSSS"
FT   gene            complement(686786..688504)
FT                   /locus_tag="STHERM_c06060"
FT   CDS_pept        complement(686786..688504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06060"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01565"
FT                   /db_xref="GOA:E0RQY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY7"
FT                   /protein_id="ADN01565.1"
FT                   /translation="MKLLARYIARYWYFALGSLLFMGTEVAVNLAQPALMGRVVDEGII
FT                   PSDMGAIVRLGLILFGIVLIGVAGGIGCTITASAAATRTARDLRDLLYHKVLRLSLKEE
FT                   SRFGAGTLITRLTGDIVQVQTIVHMLLRMMIRAPLLALGGLVMSFLLSPRLTLIMLASL
FT                   PLLAGILIFLIRKGIPLFVEAQGEMDRLNTVVRENLEGVRVVRAFVRTDYEEGRFGKVN
FT                   DRLKEVMTKASSLMGLAFPLVFLIMNLSIVAVLWAGGFLVQEGTVQVGTIIALTNYLLQ
FT                   ILFALMMIGFFFMGLSRAQASLLRLSELIEAPEESLSLESVQILPSRSPASLVVEDLSV
FT                   AYDGTPALSDISFEAPAGTRIGVIGPTGAGKTTLVMALLRMTEPSGGRVLLDGEDIQAL
FT                   SLEELRARIAVVFQKPVLFRGTVADNLRWGFPGATEEQMIEALKKAQAWEFVSRLPGVL
FT                   EARIEQGGTNLSGGQRQRLAIARALVRPASLLILDDATSALDAATESRLLSSLRTLPVT
FT                   TLLISQRMSAITTCDLILVLDDGRLAGAGPHPLLLEQCPLYRELYETQIEGALHA"
FT   gene            complement(688511..688951)
FT                   /locus_tag="STHERM_c06070"
FT   CDS_pept        complement(688511..688951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01566"
FT                   /db_xref="GOA:E0RQY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY8"
FT                   /protein_id="ADN01566.1"
FT                   /translation="MIEELSSAFEDLMFLKRKVFRSLLAEEGVYPGQPGILFHLFHHPH
FT                   TDQKGIAEALGITPASATVMLRRMEQAGLITRARDPHDRRRILVSLTPDGRIKVERLKE
FT                   KIGSFHRTMFSVLTPEEQEACTAIFRRIADHLSRTFGIHHKE"
FT   gene            689088..689405
FT                   /locus_tag="STHERM_c06080"
FT   CDS_pept        689088..689405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06080"
FT                   /product="probable transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01567"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQY9"
FT                   /protein_id="ADN01567.1"
FT                   /translation="MDTERIVRSFFAGFIKLHILHHASQGPIYGLAMIRELKRHGYELS
FT                   PGSLYPALHGLEAEGFLSSEERLVDGRRRRYYVITEEGRRVLEMARHRIGELVREVLHG
FT                   E"
FT   gene            689420..690649
FT                   /locus_tag="STHERM_c06090"
FT   CDS_pept        689420..690649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06090"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01568"
FT                   /db_xref="GOA:E0RQZ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ0"
FT                   /protein_id="ADN01568.1"
FT                   /translation="MNGISRPEDDAVRKKAFAFIVLFGVVSLLADMTYEGARSLVGQFM
FT                   QVLGASAAAVGLAVGAGEFLGYAIRLFSGKLADRTRRYWTVAIAGYAVQLGAIPLLALV
FT                   GRWELAVLLIFAERLGKGLRNPSRDALLSYAASRTGRGLGFGLHEAMDQIGAFLGPALL
FT                   SLLFLLTGTRGAGSEATYRLGFALLGIPAVLAVLAVLAARFLFPRPSDLEASSHAPHLG
FT                   RTTFSPAYGWYLASAALLAAGVADFPLVAFHLGRAGALPEPLIPALYAGAMAVDAGAAL
FT                   LVGVLYDRIGFAVLPVMWTLEVFTAPLLFLGGPAAVVAGMALWGISMGTQESVMRAVIA
FT                   DLVPHDRRATAYGLFHTVFGGAWFAGSALMGLLYDRAPAYLVVFSVTVQVLSVMALLIA
FT                   WRVHRREHAS"
FT   gene            690808..691110
FT                   /locus_tag="STHERM_c06100"
FT   CDS_pept        690808..691110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01569"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ1"
FT                   /protein_id="ADN01569.1"
FT                   /translation="MAEPVNLDLSVQEGAIVSKTLLERPSGSLTLFAFSRGQRLSPHSA
FT                   PYDAYIVLLEGSLEVTIGEERAALTAGSGILMPAGVLHALEAVEDARFLLVMLRA"
FT   gene            691168..692637
FT                   /locus_tag="STHERM_c06110"
FT   CDS_pept        691168..692637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01570"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ2"
FT                   /protein_id="ADN01570.1"
FT                   /translation="MTLTPHTKISEILAAHPDMADSLAGVAPEFSLLKNPIARATLAKV
FT                   ATVEKAAAMAKIPVEDLLSRIASLLRERGVEVELVAKPTREERVHILKELIMDLHRGAP
FT                   FDEVKRRFSELVKDVDAPEIAEMEQQLIAEGLPVEEVQRLCDVHVQVFREALEERERPT
FT                   VPPGHPVHTFMEEDSHAASLLEQVEKAMEEGPAWERIVPLLEELSRIDLHYLRKEHQLF
FT                   PRLEEHGVTGPSQVMWAIHDQIRAGIKELVRLASSRDAERFASLFREVATAVREMIYKE
FT                   ERILFPLALETLSEEEWRKVREGEEEIGYAWVSPPPPLPETASPGEAARPAAVPAPEGM
FT                   RPASELPALLGTSVLFPFSTGQLTVEQADLILRHLPVDISFVDEHDKVRYYTDTPHRIF
FT                   PRSPGVIGRDVRNCHPPKSVHIVEKILTAFKEGKKDVAEFWIQMKGRFIHIRYFALRDG
FT                   QGRYRGCLEVSQDVTEIRRLEGEKRLLDWED"
FT   gene            complement(692634..693188)
FT                   /locus_tag="STHERM_c06120"
FT   CDS_pept        complement(692634..693188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01571"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ3"
FT                   /protein_id="ADN01571.1"
FT                   /translation="MEHAEAVIRKALVVRAAPGEDLVPALMEAASAAHIREALISPVLG
FT                   SLERLRLVLPVGREEGRILFSDPIEHEGPVEIVGGGGFLCRNEEGEPEVHLHLVVCLAS
FT                   GELAGGHVLPHGNPVLATVECGLLVPAGVHLVRRRDPLLGVPVLHPEPRPSLTHALHGH
FT                   HHRGGSGRTRRRGAPLPHGLP"
FT   gene            693460..694452
FT                   /locus_tag="STHERM_c06130"
FT   CDS_pept        693460..694452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06130"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01572"
FT                   /db_xref="GOA:E0RQZ4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ4"
FT                   /protein_id="ADN01572.1"
FT                   /translation="MKRYAVLVPVLVLLMSCATTSQSGEEPAPASHTITIKVVNAFAPQ
FT                   NIMSLTADRFKEVLERKGGGRFIVQILDVERTEEKANELCSSGAAHLQFTGGYPLQVFA
FT                   PEYSFFNAPYVMKDFAHFTRVWNGPLGEAARKMVAEKGNMLWIGNVYRGFRQTTANKPI
FT                   YSVDEVQGLRLRLPGVQTWVTVWKAMGADPVTVPLSGLYDSLKTGKAEASEGDIPQIHS
FT                   YKLYEVQKYLIITNHLVQTGGVLVNKPFYESLSEADRKAVWDAAVEAIEWATNKVMSEE
FT                   GMLLMDLQKKGMQVIIPDAASFREKGKTAVEELFRTLWSVTTWEEVLSQ"
FT   gene            694478..695593
FT                   /locus_tag="STHERM_c06140"
FT   CDS_pept        694478..695593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06140"
FT                   /product="possible M24 family peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01573"
FT                   /db_xref="GOA:E0RQZ5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ5"
FT                   /protein_id="ADN01573.1"
FT                   /translation="MTKWHPEEIAEKLGRVRALMEEKGLDAVYLKRQTNFSWITGGGRN
FT                   VVGITLELGVAGILVTPTRCHAVCNNIESPRMREEERLEEKGFEVHDFLWYEDREVEIV
FT                   RKLAGGGRLGADHPFPGAQDISAEVKRLRYALTPWEVERYREVGYLTSLAIEETAREVR
FT                   PGDKECAIVGRLAHKLWAHGLDYVTIFVAADERISAYRHPISTEKEVKRRAMLCVNARK
FT                   YGLVVSLTRFVNFGPIPEDWYRQYLDNVRIDCTFMAATRPGVPVVEAFTKGIEAYKALG
FT                   YPEEYKLHHQGGAIGYEGRDYKVTFTTQEVVQTNQAFTWNPSITGTKSEDTMLATPDGP
FT                   QLLSKPILFPSISLEVDGIRFERPGVLEMPG"
FT   gene            695633..696610
FT                   /locus_tag="STHERM_c06150"
FT   CDS_pept        695633..696610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06150"
FT                   /product="tricarboxylic transport"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01574"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ6"
FT                   /protein_id="ADN01574.1"
FT                   /translation="MRWRGLTFILLCMLVGGVLWAEGQKEEESYPSRPIEIMVPWSVGG
FT                   ATDVVFRTFQMVLPKYLPVPVIIVNRPGGGAVPGYTEALGKKPDGYYFVAWATPSITKI
FT                   HMSKTPYDVDSFEPVINLVNAPCWLLVPADSPYQNLKDFVEDAKKRPGQINVANAGAGG
FT                   GTHLIMLAFERTAGVKVNHVPHAGGGPAVTAAVGGHVDAVICSPPEGVPQLQGGQLRCL
FT                   AVFSAERLPQFPDYPTAREQGIDFTLGQWRGLAAIKGTDPEKIKIIHDAFKAAMEDPDF
FT                   KVLAEKAGIITDYKGTEEFKKFVQEQSELYKQIIIENKLGDRYQ"
FT   gene            696681..697130
FT                   /locus_tag="STHERM_c06160"
FT   CDS_pept        696681..697130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01575"
FT                   /db_xref="GOA:E0RQZ7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ7"
FT                   /protein_id="ADN01575.1"
FT                   /translation="MVDLVWGMAVFLFAVILVAATFGFPETQIALSPAVFPRVIGGVLM
FT                   VLSILLAVRGGLQLRNGKPGKGASDERAVWMRLVLLVVASIGYVFSLGFVGFVGAGIPY
FT                   MAVVFLIFGERRPLLVGLLSFGIPLVIYSVFRLGFQVPLPRGVLW"
FT   gene            697150..698634
FT                   /locus_tag="STHERM_c06170"
FT   CDS_pept        697150..698634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01576"
FT                   /db_xref="GOA:E0RQZ8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ8"
FT                   /protein_id="ADN01576.1"
FT                   /translation="MDFVQGMLYVFTPLHFVYLFIGVAGGIVVGALPGITGSVGIILLL
FT                   PFLFYLEPASALLMLSGMFCGAIYGGSIPAILISTPGTPSSAATVLDGYPMAQRGEAGR
FT                   ALGIATIASATGGIVSTLCMILIAPQLARVALAFGPEEYFALMIFALTIIASVSTGMIL
FT                   KGLISGFLGLLIACVGIDELTGYARFSFGIPQLMAGFPMLAVLIGLFAISQVFVELKNI
FT                   GKELPRYHQRIERVIPPLRELGRLMKVIVPFSFLGTFIGIIPGTGGTIASFLAYNEARR
FT                   FSKNPDGFGKGVPEGIAAPEAANNGTTGGAMVPLLTLGVPGDVITGVMLGALILIGVRP
FT                   GPLLFKEDPQLISSLFVGFFAAQLLILVLGLVGARLFPLILRIRVSHLFPVILMLCLVG
FT                   AFSLNNSLYDVGVALAFGVVGYFMRKASFPVAPMVLGVILGPLAERELGKALIISHGDW
FT                   STLVRSPIAVAFYGLAVLSIGYALWRSRGHVHTSRL"
FT   gene            698683..699729
FT                   /locus_tag="STHERM_c06180"
FT   CDS_pept        698683..699729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06180"
FT                   /product="oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01577"
FT                   /db_xref="GOA:E0RQZ9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0RQZ9"
FT                   /protein_id="ADN01577.1"
FT                   /translation="MSYGIGIVGTGGIADKHALAVGQVEGAKLVAVMSRSEERAKAFAE
FT                   RHGCRAYTSMSEFLDDPELDIVSICTPSGYHMEPALEAIAAGKHLVVEKPLEITLERCD
FT                   AIIEAAAQKGVKVMGIFQSRFYDASRVLKDAVEKGRFGRLVLGDAYVKWYRSQEYYDRG
FT                   EWKGTWRFDGGGALMVQAIHAIDLLQWYMGRVKTVQAYAAILGHERIEVEDTAVAALEF
FT                   ENGALGVIEGSTAVYPGFLKRIEISGTAGSAVMEEEDFKAWTFAKEIPEDEEIRRRFSG
FT                   ATRTQGGAADPGAISLEGHVRQFQAFVDAMKEGREPPVDGYEARKAVAIILAIYESAKT
FT                   GRKVKVDY"
FT   gene            complement(699723..700460)
FT                   /locus_tag="STHERM_c06190"
FT   CDS_pept        complement(699723..700460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06190"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01578"
FT                   /db_xref="GOA:E0RR00"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR00"
FT                   /protein_id="ADN01578.1"
FT                   /translation="MYRRVNAKTHLSREIADHIKDLIRRKKLNPGEKLPNEIELAQLFG
FT                   VSRPTIREAIKTLVSQNIIEIVRGKGTYVSRTPGLQEDPLGLEFLMDENLQLALIEVRL
FT                   IVEPPVAKLAAERRTPEDIARIEEILARMEQEIRDGQIGLVPEMEFHRSLAEATRNPVI
FT                   MRLVPLITDAIRKIYGEAPRTLEEHREALEEHRDILSHIREGHGEKAGQAMKHHLEKSY
FT                   RRTQRKQWAKTIPHSFPSREETQ"
FT   gene            700602..701558
FT                   /locus_tag="STHERM_c06200"
FT   CDS_pept        700602..701558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01579"
FT                   /db_xref="GOA:E0RR01"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR01"
FT                   /protein_id="ADN01579.1"
FT                   /translation="MSRRLAGLLLIGMLALAGCGRGQDERADASSSVRVAVSLFPYYDL
FT                   ARRVGGDAVKVHLLLPWGASPHGYEPTPRDIQVVQSAQYVIYTSEELEPWMERLTRALP
FT                   EKVEVLTLEDVAGGGLHPVEEEHGGEHDHEASEVHHHAPHLWLDPLALEGLARAYAEEL
FT                   LRAMPDREEEIRSRLSAYLEGLEVLDRRMRELVDAAPRRTVVFAGHRMLDAWAARYGVQ
FT                   VVYPFESASPSAEVLPRQVREVLGHVLEEEGAPGVLYEAVSEVRLGGFLEAEGIAVYPF
FT                   YGLHTLPKEMAEEGYGYVEVWEMNLDSLRKVLYGAAD"
FT   gene            701542..702240
FT                   /locus_tag="STHERM_c06210"
FT   CDS_pept        701542..702240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06210"
FT                   /product="ABC transporter"
FT                   /note="nucleotide binding/ATPase protein [zinc]"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01580"
FT                   /db_xref="GOA:E0RR02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR02"
FT                   /protein_id="ADN01580.1"
FT                   /translation="MAPLIEVRGLAAGYGTQEVLTDVSFSVEEGEFLVILGPNGSGKTT
FT                   LVRTLLGFVRPMGGDVRFATKGLRIGYVPQDVDTRAQFPATVEEVVCSGLYTRRLPRPE
FT                   ARRRVEEVLGLLGIRDLRRKRLDALSGGQRQRTLLARALVADPDLLVLDEPTGALDPRT
FT                   RECFYLTLSEIKGRHPVTVIMVTHDVTGVLPYVQKVLLLDRRVQFFGTPEEFANQAAQH
FT                   YFSHGEVACD"
FT   gene            702280..703101
FT                   /locus_tag="STHERM_c06220"
FT   CDS_pept        702280..703101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06220"
FT                   /product="ABC transporter"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01581"
FT                   /db_xref="GOA:E0RR03"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR03"
FT                   /protein_id="ADN01581.1"
FT                   /translation="MIELLSLGFVQRAFLTGLALSLPASLLGMFLILRRFSMVGDGLAH
FT                   VSFATVALGLLVGTQPFILSLPLVVAASLLLLFLVERRGAYGDAAVGMISGAAVALGVV
FT                   LASVAGGFNVDLFAYLFGSILTVTWDEVWMSLLWAAVVVAGVVVWYRPLFMVTYDPEFA
FT                   QVQGLPVRRYERILMVATAVTVVLGIRLVGVLLISSLIVFPASCAFLLRKGFAATLTVT
FT                   ALVGVGGVFLGMTASLAWNLPTGPAIVLAYALVFLLLALIPLLSRAVRGRS"
FT   gene            703165..704445
FT                   /locus_tag="STHERM_c06230"
FT   CDS_pept        703165..704445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01582"
FT                   /db_xref="GOA:E0RR04"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR04"
FT                   /protein_id="ADN01582.1"
FT                   /translation="MSLRERALAYHRHPVPGKLAVRPTKPCETAEELSLAYTPGVAEPV
FT                   REIARRPEAVYDYTAKGNLVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADIDV
FT                   FDIEVDTTDPDEFIRTVKLISPTFGGINLEDIRAPECFSIERRLIEECDIPVFHDDQHG
FT                   TAIIATAGLLNACELAGKRLEEVRVVFNGAGAAGISCARMFIAAGVKKEHIVMCDRKGV
FT                   IHTGRDDLSPEKAEFAAETPFRTLEEVLRDADVFVGLSVGGVLSQGMVRSMAKSPIIFA
FT                   MANPDPEISYPEAKAVRPDLIMATGRSDFPNQINNVLGFPFIFRGALDVRATRITEGMK
FT                   MAAARALAELAREPVPEEVSRAYGGERFTFGPEYIVPKPFDPRVIAYESVAVARAACEE
FT                   GVARRPITDWDGYRNSLLRRVARYWDT"
FT   gene            704643..705137
FT                   /locus_tag="STHERM_c06240"
FT   CDS_pept        704643..705137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06240"
FT                   /product="NADH-quinone oxidoreductase subunit E"
FT                   /EC_number="1.6.5.11"
FT                   /note="NDH-1 subunit E; NADHdehydrogenase I subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01583"
FT                   /db_xref="GOA:E0RR05"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR05"
FT                   /protein_id="ADN01583.1"
FT                   /translation="MAHIDRPWKAYPPRRDNLLLILHDIQDHNPRNYLPDDEVEEVARY
FT                   LDIPVSELDGIISFYSMFSRRPRGRYVIRMCDSLACRLAGSLDLYFALQEGLGIKRGQT
FT                   TPDGLFTVELVNCLGCCDKGPSLMVNDELHTRMTREKLDLLIEELARREGVAYEPRTVH
FT                   S"
FT   gene            705112..706368
FT                   /locus_tag="STHERM_c06250"
FT   CDS_pept        705112..706368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06250"
FT                   /product="NADH-quinone oxidoreductase subunit 1"
FT                   /EC_number="1.6.5.11"
FT                   /note="NDH-1 subunit 1; NADHdehydrogenase I chain 1"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01584"
FT                   /db_xref="GOA:E0RR06"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR06"
FT                   /protein_id="ADN01584.1"
FT                   /translation="MNHARFILEFAVDRDAFDMEAYISRGGFMGLRQALARPPAKVIAE
FT                   VKSSGLRGRGGAGFPTGVKWESVQRHKEPYVVANADEGEPGTFKDRYIMEHAPYLLIEG
FT                   MTIAGYAVGARRGFIYIRGEYPAIAKGLIKAVEDARKHHFLGEKILGTDYSFDISLRMG
FT                   GGSYVVGDETALLNSLMGNRGYPMMKPPYPTEEGLWGHPTLVNNVETLAYVPAVFTKGA
FT                   SWFTQIGPEHSPGLKLFCVSGDVHAPGLYELPMGVPLHELLEAAGGVKGRLKAVQIGGT
FT                   AGPVYDDRALSFPLDYDSLRAEGGALGSGAVVVMNHTRNMAEFLEVTTRFFSEESCGQC
FT                   FPCRYGTRQLEFMARNIMMGKGKEEYLDEMREIVTTMSVASFCPFGKSVALPVGNVLDL
FT                   FGDEIRTFIAHQRYVKEAG"
FT   gene            706368..708158
FT                   /locus_tag="STHERM_c06260"
FT   CDS_pept        706368..708158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01585"
FT                   /db_xref="GOA:E0RR07"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR07"
FT                   /protein_id="ADN01585.1"
FT                   /translation="MAKQAKTVTITINGTPLEVEEGTLLVDAASRADVEIPTLCYHEDL
FT                   SPRGICGICLVKVNGEYVRSCITRVREGMEVVTSDPVIRETRRKILELILATHPDDCLK
FT                   CIKHGKCELQDLAERLEVRSIPYDKYERGLPVDRTSPSIVRDMNKCIGCGRCIEVCHHV
FT                   QSVGAIFFHNRGSHTIVANAAGQTMGTSVCVACGQCVVYCPVGALYEKEAVERVWEALA
FT                   DPEKVVVAQIAPAVRVALGEEFGMKPGELVIGKIYAALRRLGVDYVFDTNFSADLTIME
FT                   EGTEFLHRLEKGERLPLITSCSPGWIKFAETYYPDLLPHLSTCKSPQQMMGAVVKTYFA
FT                   QAKGIPPSRIVSLSIMPCTAKKFEAQREEMRDSGFWDVDIVLTTRELARMIRQAGIRFD
FT                   QLKEEPADPVLSSYSGAGTIFGATGGVMEAALRTAYEIKTGKSLPKVEFAQVRGVKGVK
FT                   EAVIELNGTQIRVAVAHGLSNARKVLDRVREAKERGEPLPYHFIEVMACPGGCVGGGGQ
FT                   PLPSPLKKREERLMGLYAEDSALPVRKSHENPEVRALYEHFLKEPNGELPHTLLHTHYE
FT                   PRDPYRLRKNPLREQVSTPE"
FT   gene            708326..708646
FT                   /locus_tag="STHERM_c06270"
FT   CDS_pept        708326..708646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06270"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01586"
FT                   /db_xref="GOA:E0RR08"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR08"
FT                   /protein_id="ADN01586.1"
FT                   /translation="MPRFRYRHRHGRMHHLGMPLPLEEADSGGTVTLSQLREGEGALVV
FT                   GFKGGPGPYRRKLLAMGFIPGTSIVVKRRAPLGDPVEVELRGYLVSVRRDEAEILLLRR
FT                   AS"
FT   gene            708643..710886
FT                   /locus_tag="STHERM_c06280"
FT   CDS_pept        708643..710886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06280"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01587"
FT                   /db_xref="GOA:E0RR09"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR09"
FT                   /protein_id="ADN01587.1"
FT                   /translation="MRTYTCALIGTPNTGKTSIFNAITSRTEYIGNWPGVTIERTDGIL
FT                   TTVYQGEDVRLRIVDLPGIYHLGSSAPEERVAFDFFLKEKVDLVINVMDGLSLQKNLYL
FT                   TLQLLEEGLPVHVVITKKDLLEQNGIRISPEALSRRLGVPVSLVNSHSRQDARLLVNSL
FT                   VQSCLSPPSPPHPVTYDEVVEEWLSRWQHELSFLGVPAPRLRTLLLLFLEGEEVIFSLH
FT                   PSLRERKAELAASRTQLEARMGEDLDVYLARRRYEEIESILKEAHEAAEKLTLTERIDR
FT                   VVLHKVWGIPIFWAVLFLLFWATTSLGGVFIDFFDGIFQILAVDLPLYGLSRIGAGPFV
FT                   QTLVEGVGTGIQTVATFVPIIYILFFLLTILEDCGYMARAAFVADRGMRGLGLSGKAFV
FT                   PLLLGFGCTVSSILATRTLESRKERLLTIFMAPLMSCGARLPVYVIFAAAFFPRSAGLV
FT                   VFSLYFVGIVLAVGTGLLFKHTLFKAERTPLVMELPPYHLPNMSLVLKITWIRFSAYIK
FT                   RAGITITTAVFILSLLNAVVIENGKVSFESGSPDSLLIRTGKAITPVFEPMGVEEENWP
FT                   AVAGLFTGLFAKETIIGTLQAMYGIEAEEEAEEPFSLQVALSGLVDAGRALLRGLYELL
FT                   VPSPGGEEEEGGFSLVRERFTPAAAYAYLLFVLIYSPCVAALSAILQQAGVGTMLANAG
FT                   YLTLLAWIVGTFYFQVVEGGSLLWLGVAGGLLLGLMVVLYLVGRSTRPKEAVS"
FT   gene            710883..711353
FT                   /locus_tag="STHERM_c06290"
FT   CDS_pept        710883..711353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06290"
FT                   /product="iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01588"
FT                   /db_xref="GOA:E0RR10"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR10"
FT                   /protein_id="ADN01588.1"
FT                   /translation="MRQEDLTSRMEDYLEAIYVLAKTKRVARVRDIAEALGVSRSTVSN
FT                   TLHTLSDRGFIEYAPYDIISLTEEGEEAAKDVFRRHTILKRFFRVVLGADEQMAEENAC
FT                   RIEHAISEELLERLVQYLEFIQECIPAPFRYDPEKGAFVCEDREDEDVSPPA"
FT   gene            complement(711339..712631)
FT                   /locus_tag="STHERM_c06300"
FT   CDS_pept        complement(711339..712631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01589"
FT                   /db_xref="GOA:E0RR11"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="PDB:4D7S"
FT                   /db_xref="PDB:4D7T"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR11"
FT                   /protein_id="ADN01589.1"
FT                   /translation="MKSSAFSHPTYTLVWKVGILAVTLYYAIRIPLTLVFPSLFSPLLP
FT                   LDILASLALIADIPLDFAFESRKTSGRKPTLLAPSRLPDLLAALPLDLLVFALHLPSPL
FT                   SLLSLVRLLKLISVQRSATRILSYRINPALLRLLSLVGFILLAAHGIACGWMSLQPPSE
FT                   SPAGTRYLSAFYWTITTLTTIGYGDITPSTPIQTVYTIVIELLGAAMYGLVIGNIASLV
FT                   SKLDAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPH
FT                   PLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYF
FT                   INRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDR
FT                   ILSRYPEIAAQIQELAVRRKEELEGGTSRRG"
FT   gene            712705..713364
FT                   /locus_tag="STHERM_c06310"
FT   CDS_pept        712705..713364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01590"
FT                   /db_xref="GOA:E0RR12"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR12"
FT                   /protein_id="ADN01590.1"
FT                   /translation="MGKEGAVHHSSSALSQKVRAEISFLVWWTFLLVCLSAFLYPEGFD
FT                   IWNDPLSLLGVPFTEEEGLPNPWGMGLFVLAFLVDGLFSFRIASRIRAEGGGGLSLLFT
FT                   LAGIGSLLMLAPCTLLNPLHRLGAGLLVGSLWLCTVVLSRANWGAFSGARKAFHLCVHL
FT                   VLVVYAIRFFLDAPSHEFLQKLALAGLLLGLLDCVRTEEGRLPGPRWALVHLKRSA"
FT   gene            complement(713361..714050)
FT                   /locus_tag="STHERM_c06320"
FT   CDS_pept        complement(713361..714050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01591"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR13"
FT                   /protein_id="ADN01591.1"
FT                   /translation="MGTMNERASLPSQGKGLLVRALGFSLALLGVYLLADGGNSAETST
FT                   EKEDTMASLSGVKVVMIIAHENFRDEELLETREELLDAGASVAVASSSRTPATGMLGAR
FT                   VTPDKTLQEIRVDDYDAVIFVGGTGAQEYFSNRQALDLARQAYEKGKIVGAICIAPSIL
FT                   ARAGILRGKRATCWSGESGTLLANGATYTGRPVERDGRIITANGPSAARQFGRALVEAL
FT                   SAGVTSP"
FT   gene            complement(714082..714894)
FT                   /locus_tag="STHERM_c06330"
FT   CDS_pept        complement(714082..714894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01592"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR14"
FT                   /protein_id="ADN01592.1"
FT                   /translation="MECLVILDYSGTVSLESVRFGTEERLRKALEESGLAALEVTPSFL
FT                   WKQVIETFWDRASKGGITYVESIVRALGTVCEAPEAQREQAARAFVRSYLRASTVDPVW
FT                   ARFLRIAGPHLPILIATDHYLEAEQAILAHLEDEGIAARPWPDASEGCMVACSARIGAR
FT                   KEETTFWEEVRRAYGSHPRVIHLVDDFGANEAPARRHPLTRRLQGRIERISTALLPLEA
FT                   REVTIHPFVLPRLDDEDRAADTVRSFVRSLADTLTAEGFLPKDARERV"
FT   gene            715048..716406
FT                   /locus_tag="STHERM_c06340"
FT   CDS_pept        715048..716406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06340"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01593"
FT                   /db_xref="GOA:E0RR15"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR15"
FT                   /protein_id="ADN01593.1"
FT                   /translation="MEREHVSRELVLEWVRQRLWHKVKQELVSWHPSDIAEFLASLEEE
FT                   EASTDALILFLMLPPELKADVFSEFDSELQRQILERITSDQVKEILSELSHDDRIELLE
FT                   NLPGNLTRRVLNLLSPDDRSITLELLGYPEESVGRLMTPDYVSLKPHWTIEKALDHIRR
FT                   YGKDAEIINMLYVIDEEGHLLDDILLRKVILAPPDATVESIMDWHYVAINAYADQEEAV
FT                   RLIRKYDLNALPVVDDDNILLGIVTVDDIIDVLDEETTEDVHKESAVVPLETSYTQASP
FT                   FLLYTKRVVWLFFLGISGFLSSGVISRFQGVLSSFISLSLFIPMLMDTGGNTSSQAATL
FT                   VIRALAVGELTPRRWFLVMRKELLVGLLLGGSLGLVLATIGYLWTGHPGIALTVGLSTV
FT                   GIALWANLIGSTLPLLCTWVGIDPALISSPLLTTILDVTGLLIYFTITSLVLL"
FT   gene            complement(716403..716819)
FT                   /locus_tag="STHERM_c06350"
FT   CDS_pept        complement(716403..716819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06350"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PRA-CH"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01594"
FT                   /db_xref="GOA:E0RR16"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR16"
FT                   /protein_id="ADN01594.1"
FT                   /translation="MSRWRRLSEEARDLLDFAKMGGLVPVVTQEVHTGEVLMVAFLDPE
FT                   AWELSLATGYAHYYSRTRRRIWKKGETSGHVQRIVEVRIDCDNDAVLFLVEQERGTACH
FT                   TGRRSCFYRTLTPRGLAEEEATLPWRGVSPEDQS"
FT   gene            complement(716816..718405)
FT                   /locus_tag="STHERM_c06360"
FT   CDS_pept        complement(716816..718405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01595"
FT                   /db_xref="GOA:E0RR17"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR17"
FT                   /protein_id="ADN01595.1"
FT                   /translation="MTEGGAVQDDALIQKMRTAGIDPDLTYAILERVNAAEPEAAPSFE
FT                   LPSPGDPRIVDTTRPLSLTLPRAAFLSRAEELSIPSSLIDRYGGEDPVVLDDAALSLLG
FT                   VALYPRTAYGVLNGGAATSYADLTRNRAFEPDLFELYRASFEAVAPRVKGSAKGACPAF
FT                   YQEDTSGGPSFLALTLRNLLLCVALYRRMAEQWHTPLRGTVLPLFQMTSPATHDQVMAH
FT                   LEKLRGHPLLEALFAHTGYRVDPTLTAQQPLVAALTHREEGLPRRIFTRAYGKDGELLP
FT                   LPGGHGQNFMVLEGIYRRLHEEGFRFVYLTNVDNLGAFVEPRTLAYTAFSRAQASFEFS
FT                   YKTPVDVKGGILVRAGDVLSCRDIGPAIPKEAVAAFEKEGRPVLFNCAIGLFDLTYLTT
FT                   HLEHIIRTLPLRVSEQEKDAGRYAQVEQITWEVMDLIERPLVFGVDKFRRFLAAKLLLE
FT                   TFLTGGLHFGRPELEAFFASRPELARTARALSAGFRRVMEEAYGYVRTEERWRPLRLDE
FT                   ALVRMQACGGIA"
FT   gene            complement(718398..719471)
FT                   /locus_tag="STHERM_c06370"
FT   CDS_pept        complement(718398..719471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06370"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="glucose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01596"
FT                   /db_xref="GOA:E0RR18"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR18"
FT                   /protein_id="ADN01596.1"
FT                   /translation="MKREWFSQHPPAGAVLLAADIGGTNTNIALFEQQGGRLAMLAHWE
FT                   FASRELANLEEALSQVIEDLQETLGTGIHIHGLCASGAGPVEENVCHLTNLPWIIDGEA
FT                   IHRDLGVKTVVINDFSAICYGVPILESQAEEKLVPIPHTDGRIPPRRGVVRAVIGAGTG
FT                   LGVGFLVEDRGEFHAYPSEGGHIDFPADDEGGDALRRYLASRYAPTPDAEAVVSGQGIA
FT                   NIFAFLVETGRIEQDETTRTILSHPPEDRPPLIARHRSSHEGCRRTMELFARLYGHIAA
FT                   AFALTFLPTAGLYLAGGIAAKNLPLFLESPAFMEAFEANCRPNIRAVLSRIPVYIITDY
FT                   SISLYGAAYAAGILIHD"
FT   gene            719588..720106
FT                   /locus_tag="STHERM_c06380"
FT   CDS_pept        719588..720106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01597"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR19"
FT                   /protein_id="ADN01597.1"
FT                   /translation="MLHAIGERVPRMDETAFVAWNAEVCGSVELGPHASVWFGASVRAD
FT                   IAPITIGAHTNVQDNASVHVDVDLPVVIGSYVTIGHNAVIHGCTIGDGSLIGMGAVVLS
FT                   GAVIGEESLVGAGALVTEGKEFPPRSLILGSPARVVRSLTDEEVARIRRNALLYAELAR
FT                   SARQEYREV"
FT   gene            complement(720161..720787)
FT                   /locus_tag="STHERM_c06390"
FT   CDS_pept        complement(720161..720787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01598"
FT                   /db_xref="GOA:E0RR20"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR20"
FT                   /protein_id="ADN01598.1"
FT                   /translation="MNYFIPILVLGITATVAYFWGRRKNRWMSGFIAQETEEVLTPEDT
FT                   HYVNIGGTIGYHFTYRLGPPFTEAKGTFTLLPRQSILYLPFSLLLGHRDRYFLTLFTDR
FT                   PLLGEGHLVHEPYYRKLLRTIPNRAALTEEHITCGGKPYVLLYDRKKAADRLKELASRL
FT                   PDVEGLHHFCVYADNRNFYLFMEPARGRIQRLLSALLPHLSSFFA"
FT   gene            complement(720784..721710)
FT                   /locus_tag="STHERM_c06400"
FT   CDS_pept        complement(720784..721710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01599"
FT                   /db_xref="GOA:E0RR21"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR21"
FT                   /protein_id="ADN01599.1"
FT                   /translation="MKQGVFFLGKGGVGKTTTASAFAAGCAAWGGMDVLAVSLDPAHNL
FT                   GDVLGTSLREKPSKVGEHLSAMEIDVGKWISRYLASLRKELASTYAYTSVASLDSYFSL
FT                   LRYSPGTEEYALLWAIKEIVSRYQEYDLVVFDTPPTALTLRFLALPFLSEKWLEGLKGL
FT                   RTAILERRQTVLRLDPEAPVRGARRPEEDQLYHRLLGLQRRLASLRELFLARSTVVLVV
FT                   NPDELSLRESIRIRDELTGLRIPIAVVCHNKAREADESWERKIRNAFRTTPVVRIPFRE
FT                   EEALDPDRLPVRELVDRIIDHVRKEQP"
FT   gene            complement(721722..722003)
FT                   /locus_tag="STHERM_c06410"
FT   CDS_pept        complement(721722..722003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01600"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR22"
FT                   /protein_id="ADN01600.1"
FT                   /translation="MKEKARRLWTALKETITQVHRRKATEILLFELSEMENIFALLVLG
FT                   SFIGIPSPNPILTLELLPHMEEELWTMVSRADFAQDPLGGLISLLELD"
FT   gene            complement(722074..723765)
FT                   /locus_tag="STHERM_c06420"
FT   CDS_pept        complement(722074..723765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06420"
FT                   /product="carbon starvation protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01601"
FT                   /db_xref="GOA:E0RR23"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR23"
FT                   /protein_id="ADN01601.1"
FT                   /translation="MSTWIVLGALVFYFIFYFSYGRNIQKKLLKSHEAPEAPAKRLYDG
FT                   VDYVPTSKYVLFGHHFASIAGAGPITGPAMAVAWGWLPGLLWIWIGNVFIGAVHDYLSL
FT                   TVSVRYDGRSVQYVAQDLIGKVAGKAFGWFILFLCILVVAAFGDIVAGQFASNPHLFPT
FT                   FLFFCIAAIFTGLIMYRTKVGIGYGSIIGAALIVVSFWLGSMVSIPASKITWFLVIFVY
FT                   IIIAASLPVNILLQPRDYLNSFLLYFGLLAGGVAALIGFSSFDSLPVFTSFSAKVIGGQ
FT                   PSPFWPTVPLVIACGALSGFHSLVASGTSSKQLREEKDALFVGYGGMLTEGFLSTLVVV
FT                   SIATFGNEVFGDPAKVLAAGPLDRFVKSYGAMVSGTIPFLFSASFMQLFAALWVSSFAL
FT                   TTLDTTNRLGRYILHELALPLKDRSPGLYSIFQNKWIASFVVATIGLLLASSGGYTRLW
FT                   PAFSGANQLLASIAMLTATVWVKRKLNPRYTNLVFIPAIFLWITVTVGLIWYEIVIVPT
FT                   YFGDFTNALKVSTGIIVGTINIVMLILNVVIMVGFFRHFREQEASV"
FT   gene            complement(723876..724835)
FT                   /locus_tag="STHERM_c06430"
FT   CDS_pept        complement(723876..724835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06430"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01602"
FT                   /db_xref="GOA:E0RR24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR24"
FT                   /protein_id="ADN01602.1"
FT                   /translation="MVRKRNILKSLGFFLLVVGIVLFAFFPFLQMISTSLKYQWDWGNP
FT                   SLIPRKLNLEAYAELLNIGQELKNVPESVRRLLEEQELTEAQKRAILARYRDTSDVFPF
FT                   LQYFRNSLFLSSSAALLSLLIATFGAYSFSRTRYRGRGLIQRGVLFVYMFGGILLLIPL
FT                   YQIFVRMGWLQTSGGTLAALLIIYLVQTLPVSLYMLGNYFRTIPFSIEEAALIDGCSRF
FT                   GTIWRIIIPMSIPALFTVFIYAFMIAWNEYLFASVFLKSYKGLYTLPFGLRSLYHSKNA
FT                   IWDRIMAASVLTALPVIPIFMAIQKRLVAGLSAGGVKE"
FT   gene            complement(724829..725701)
FT                   /locus_tag="STHERM_c06440"
FT   CDS_pept        complement(724829..725701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06440"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01603"
FT                   /db_xref="GOA:E0RR25"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR25"
FT                   /protein_id="ADN01603.1"
FT                   /translation="MKRELRIEEREALLGRRLILPALLVITGLIVYPIFYNIYLSFFDV
FT                   HVYGANRFIGFKNYLDIVLDREFWGAFYTTIVYVIGTTLGTTLMGLLVALVMNREFPLR
FT                   GLVRSLILLPYVAPLISVVFSWQFLFDPVNGIVMHTLVEQLRLLPERINLIGSPKNGIW
FT                   VAVLFSIWKNFPFTYLMLLSRLQAIDQNLYEAAEIDGASALQKFWYLTLPELYFVMGAV
FT                   ILLRFIWNFNKFEEIFLLAPNVKVLSVYTYYTAFTGTLDLGKGAALAVVQFSILIIFIL
FT                   FYVRKVLKW"
FT   gene            complement(725726..727102)
FT                   /locus_tag="STHERM_c06450"
FT   CDS_pept        complement(725726..727102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06450"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01604"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR26"
FT                   /protein_id="ADN01604.1"
FT                   /translation="MRTRPYALLVMIGLILLVTACGKQEARKPQEPVAFEFWTSQTQSD
FT                   RMATIQLLVDTFQATHPEITINVIPVEENDLPTQIHAASAAGTLPGLVEMGAENAVAFG
FT                   AEGLLDTAAGTRVIEKVGKDRFYEGALTLVDDGSGTYYAVPFHGWVQGLWYRIDWFEEA
FT                   GLKPPSTWEDMLEAARYFYKPEENQYGILVGTKPEVYAEQCFTHIALSNNARLFDRDGN
FT                   LVFDSPEMREAIEFYAELAKYTPPGPQTWRARDYYFQNKLAMFFYSTYIMDDLALAEVA
FT                   QGSLTGENFPELTGAEFDPELVNKTGFVPIITHTQPAGYGVVVTMGITKGLSEAQLSAV
FT                   ETFLLYLFSENAYVSYLHMAPGGMNPTIKGIAETDRFLEDPRGVYKRFGKEKLAQIISG
FT                   LNSIQTFSIVEGRRIEAASTIFSKQIIPQMIYAITQEGVPIDQAMREAEQKMREIVEGR
FT                   "
FT   gene            complement(727193..727804)
FT                   /locus_tag="STHERM_c06460"
FT   CDS_pept        complement(727193..727804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01605"
FT                   /db_xref="GOA:E0RR27"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR27"
FT                   /protein_id="ADN01605.1"
FT                   /translation="MHTLRTILLHETHPVEALFTGILVFVLFLAQPSLPLRAVHTGILA
FT                   LMAVLSGKRLKPGYFILFVGGITFFQLLIPRGQVLLELGPFPVTREALLVGLKKGLTLC
FT                   GLVFLSLFSVRKDLPLPGRLGTYFSRVFGYYAALMSTRDRISLRHPLESLDRILLHTAS
FT                   SLPHSPDAPTTTTPRGRILLGILVLIHTVLTSLGWIIPGI"
FT   gene            complement(727773..728315)
FT                   /locus_tag="STHERM_c06470"
FT   CDS_pept        complement(727773..728315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01606"
FT                   /db_xref="GOA:E0RR28"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR28"
FT                   /protein_id="ADN01606.1"
FT                   /translation="MTHSRSRLMDITAFLGALSMFCATLEYLVPKPLPYLRLGLANIPL
FT                   ILALPLLPFRYYLLLILTKAAGQALVNGTLASYVFLFSLGGSAASGLAMYALFRLFRSA
FT                   VSPVGLSTMGALVSNAVQLALSVWFIFGPSSLVIAPLFLIVGTASGLVVGLLTLAFVRS
FT                   STWYRSLHAHAADHPPA"
FT   gene            728454..730034
FT                   /locus_tag="STHERM_c06480"
FT   CDS_pept        728454..730034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06480"
FT                   /product="glutamate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01607"
FT                   /db_xref="GOA:E0RR29"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR29"
FT                   /protein_id="ADN01607.1"
FT                   /translation="MNLRRPNANEATATFNRSRSVVPMSGLCSRCVDGCRGGCEVWLAS
FT                   FRGREVLYPGPFGEVTAGADKDYPVDYSHLNIQGYASGAKGIENPSPDTAIFPNVDTET
FT                   EYGWSKKVKMRVPIFTGALGSTDIARINWEHFAVGAAISGITIVCGENVCGVDPQLELD
FT                   KNGKVKHSPEMDRRITTYRRYHEGYGEILVQMNVEDTRLGVAEYILEKHGIRTIELKWG
FT                   QGAKCIGGEIRVKSLERALELKRRGYVVTPDPENPAVQAAYKDGAIREFERHSRLGFVD
FT                   RESFFAEVERLRKLGFERITLKTGAYAMTELAKALRWGAEAHIDLITIDGAPGGTGMSP
FT                   WPMMNEWGIPTFYLEALAYEFAEKLSAKGLRVPDLAIAGGFSSEDGVFKAIAMGAPYVK
FT                   AVCMGRALMIPGMVGKNLEHWAKNNDLPKTVAQYGTTKEEIFVTYEELKAKYGNEVDSF
FT                   PWGAIGIYTYAQKFKVGLQQLMAGSRNFTLSSISREDLVALTEEAARISGIPYLMDAYR
FT                   EEAERILEG"
FT   gene            complement(730104..730835)
FT                   /locus_tag="STHERM_c06490"
FT   CDS_pept        complement(730104..730835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01608"
FT                   /db_xref="GOA:E0RR30"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR30"
FT                   /protein_id="ADN01608.1"
FT                   /translation="MMDTKILGVCIAAVLLVGACGTQPAPREATPTSGGTQVKLVALTF
FT                   DDGPDPVMTPRVLDKLETYGVKATFFVIGQLVNERTTPVLERIVRMGCEIGNHSWGWES
FT                   MNTMPPEEIEESVDKTTKAIEKYAGTTPRFFRPPNLAVSDTMYEVIDLPFASGILAFDW
FT                   AGQNTTAEQRAKHVLDAVRDGAIILMHDVQPEPHPTPEALDIIIPELLAQGYEFVTLSE
FT                   LFERKGIDPRSKTHDMWVFVE"
FT   gene            730948..731625
FT                   /locus_tag="STHERM_c06500"
FT   CDS_pept        730948..731625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01609"
FT                   /db_xref="GOA:E0RR31"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR31"
FT                   /protein_id="ADN01609.1"
FT                   /translation="MQIRNARPRRKEARSLFGRGLFASIPVVVGYLPVGMTFGLAAVGT
FT                   GFPAWTAVLTSALVFAGASQFVLVSLLPQGLLPAVVLPLFLNLRHVVYTGIIARRIPLS
FT                   RPALTLAGLTDEVFAVALQGPAEERFLQGVALGAYLAWVGGTALGAFGGAALLVGSPIE
FT                   GSLVFSLTALFFVLVIPSVQEGRLRAVLWGAGIGLVFHVLGLSSLGVLAAGLATPLVLR
FT                   RRR"
FT   gene            731625..731930
FT                   /locus_tag="STHERM_c06510"
FT   CDS_pept        731625..731930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01610"
FT                   /db_xref="GOA:E0RR32"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR32"
FT                   /protein_id="ADN01610.1"
FT                   /translation="MDRYGAILLVAVGTYLIRLLPFFRKGGTGEGMERVLKDSAAAVMA
FT                   ALWISSFVSLPLEGWSLVRDGLALLGVGGSYLLWGRMGVSVLVGVGLHALLSLWRG"
FT   gene            732014..733399
FT                   /locus_tag="STHERM_c06520"
FT   CDS_pept        732014..733399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06520"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="PYNP"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01611"
FT                   /db_xref="GOA:E0RR33"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR33"
FT                   /protein_id="ADN01611.1"
FT                   /translation="MSSGVLEPLPLKQGGLPSRKGGDRAILEAMRIVDIIVKKRDGGEL
FT                   SADEIASLVRRYVAGEVPDYQVAAWLMAVFFRGMGPQEVSALTREMMRSGRVLSFPGMR
FT                   CVDKHSTGGVGDKISLPLAPAVAACGVPVPMMSGRALGHTGGTLDKMESIPGYRTGLSP
FT                   EEVERLLGECGYAMFGQTEQMVPADRKLYALRDVTGTVESIPLITASILSKKCAEGAQG
FT                   LVFDVKTGSGAFMKRREDARALARSLVEGARELGREAVALVTDMGQPLGRMVGNFLEVE
FT                   EAVEVLKGGGPADVRELVCALGGEMLVLGGKAGSVEEGRRMVGEVLDDGRAYERWVRNV
FT                   AAQGGDVEELERRLGRWRAPVVREVRAVEEGVVGAVDAYRVGLAGVVLGVGRSRVEDAV
FT                   LPDVGVECVRKRGERVVRGEVLARVYARDEARAEEAARMVGEAYRVGEETPSGSLVLER
FT                   ISP"
FT   gene            733427..735556
FT                   /locus_tag="STHERM_c06530"
FT   CDS_pept        733427..735556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06530"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01612"
FT                   /db_xref="GOA:E0RR34"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR34"
FT                   /protein_id="ADN01612.1"
FT                   /translation="MARWQKPPIDKNRVLGISERFGLDLLTSTILVRRGLDSPEELSFF
FT                   MERHLRYLHNPFLFEDMPLAVERVIQAKEEGERILVFGDRDADGISSTVLLTEFLEEMG
FT                   MEVDWRVPMGDEQYGLSLDAVEEHARNGGSLIITVDCGISSVREITRAAELGLDVIVLD
FT                   HHEPKEELPPAYAIIDPKVEGSGYPFRDLAGCGVVAKFLWALTFGLSDHFNQEVSLLNI
FT                   RPGNEAYIVEVIQTENLIELDRVQESIVPGMVPVDRTRIYDLIAQSPIYVYDLPLQQRL
FT                   FQAAFGRGVELQAFDLKPLVERLYPSLKGRSLLRLKDRSRGALYREKPPEEIDVLFSLF
FT                   QAVLMEETGVLRSMERVMDLVGLGTLADLMPLRNENRILVREGLVRLSDPERPGLRALM
FT                   ARQKLLGKKLAPRDVLWQVGPIINASGRMGSPDVAVRLLLCRDPAEAEALGDELIKLND
FT                   ERKRLGEDLWQRIQPQAYESFTRFKEKFVLVYHDAVQRGVTGILAARLAQKFKVPAAIL
FT                   APLEEEGRLVGSLRSFQGVGVLNLLTACEDLLMEYGGHDFAAGFSLHPERLEEFIERLV
FT                   EVVEDLGLPLRGEEPLTIDAEIPPSWMTPDIMKVVEFFAPYGEQNPPLRLLYREAVVRD
FT                   IQFIGRNGQPHIKFHLAMGGALWPAVYWGASDKVNVEFSEDDEVDVVFTPTWNTYQNQE
FT                   TIQLTVVDMRRCEGS"
FT   gene            735541..736455
FT                   /locus_tag="STHERM_c06540"
FT   CDS_pept        735541..736455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06540"
FT                   /product="M23/M37 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01613"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR35"
FT                   /protein_id="ADN01613.1"
FT                   /translation="MRRILIVLFVAALPLLADPSTLLAPSFAREGDVYPVLITRASGPL
FT                   TAVLVSEVGSALAASPLLPLEGTRRTLYGFLAVPPGYGSSTASLMVRDGGGMVLISRRV
FT                   TLLPRTYRKEEIPLTPGLTQIRTDQSERRIREARELSDLLFTVSPDAPGLSSLWFLPVS
FT                   EGRFSSWFGDERLYRYANGGTDSSRHTGVDIAAPEGTPVHVPARAVVVLVRDRIVTGRT
FT                   VVLRHGPGIYSLYYHLSSIAVEEGDEVEPGDLLGTVGSTGLATGAHLHWEVRVQGVPVD
FT                   PLALVGGSLLDKLRELLIMEGRS"
FT   gene            736467..736691
FT                   /gene="rpsU"
FT                   /locus_tag="STHERM_c06550"
FT   CDS_pept        736467..736691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="STHERM_c06550"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01614"
FT                   /db_xref="GOA:E0RR36"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR36"
FT                   /protein_id="ADN01614.1"
FT                   /translation="MIVIIHIPVDNGEPLEKALKRFKRVVEKEGVIREWKKREFYIKPS
FT                   ELKNQKKKALQRKLLKKLRKMQEKESSRR"
FT   gene            complement(736747..737529)
FT                   /locus_tag="STHERM_c06560"
FT   CDS_pept        complement(736747..737529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06560"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="inositol-1-phosphatase; I-1-Pase; IMPase"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01615"
FT                   /db_xref="GOA:E0RR37"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR37"
FT                   /protein_id="ADN01615.1"
FT                   /translation="MSFLSVAREAALIGREVHLRYLTGGFHISTKSGVRDRVTTADIEA
FT                   EKAIVAFIREAFPTHNILAEEHSYEPTSSPYTWIIDPLDGTNNFSRGFPFFACSVALKE
FT                   GDEVIVGAVCDSVRGEIFTAEKGGGAFLNEEPIHVSEVSDLATSLLVTGFYQTQSEEVV
FT                   RNLEVLKRLFRRGILGIRRTGAAALDLCYVACGRVDGFWEPILNPWDFAAGALIVREAG
FT                   GMCTTYEAEPLPFGTSPVLATNGRLHTVLSEVIREALS"
FT   gene            737639..738271
FT                   /locus_tag="STHERM_c06570"
FT   CDS_pept        737639..738271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01616"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR38"
FT                   /protein_id="ADN01616.1"
FT                   /translation="MRRSWLLVPFLLLACTGAPPSVLEVSHSLVYSRNPASGEQELLLL
FT                   CSASVLDDDGIDDIEVVYVIRDEAGLYWEVKEEAWDIFSQEGQHWLSFTLASPGADPFP
FT                   AGTYRLLVRDYGGREAERTFLVKEHPASYPAERFPSLFVQEGSVQSRSTEPLKVVGYDG
FT                   EGRLLFSRELKPGAFLSREQIPEQVAVLYALIEREGYLLRSGPYAVY"
FT   gene            complement(738265..739197)
FT                   /locus_tag="STHERM_c06580"
FT   CDS_pept        complement(738265..739197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06580"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01617"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR39"
FT                   /protein_id="ADN01617.1"
FT                   /translation="MSDFLREQAKKDFERARMREFFERILSFTSPERQELLPLDEVKKL
FT                   LRPKGERYLGLKTVPIDKIVGSEGRYLDFNKKFLPRHGHTRGRWESIDQAHLAYKELPP
FT                   VKLYEVGGVYFVRDGNHRVSVAKSKGSKFIDAEVTSLNAEIPLHPDMTLDELRKRVIDY
FT                   EYAEFREKTDMERVLPGVEIRFSTPGRYDELYEHILVHKYYINMDKDYEIPFEEAFRSW
FT                   YENVYRPIVEVIRKENILSMFPGRTEGDLYLWCVKHWDDLKRQYGQDYDLRTAVIQFAQ
FT                   RHGTTWKRRLSRWWKRLTSWLRRPPADPQ"
FT   gene            complement(739220..739876)
FT                   /locus_tag="STHERM_c06590"
FT   CDS_pept        complement(739220..739876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STHERM_c06590"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:STHERM_c06590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN01618"
FT                   /db_xref="GOA:E0RR40"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0RR40"
FT                   /protein_id="ADN01618.1"
FT                   /translation="MRILCVSDEVDPIIYSPRVKEHFPDIDLVISAGDLPMEYLGFLAS
FT                   MFNKPVLFVFGNHNLKYLGLFRPSIPIPFSAQPVPPHKFGATYISDRVLKVKGLLIAGL
FT                   GGSYRYNNGLNQYSDFQMWLKVLRLVPRLLYNRIRYGRFLDILVTHAPPYGINDRPDPC
FT                   HRGFKSFLWFLKTFKPRYHLHGHIHLYNGLEKRESRYHQTTVINVFKYYLLEPSL"
FT   gene            complement(739873..741402)
FT                   /locus_tag="STHERM_c06610"
FT