(data stored in ACNUC1104 zone)

EMBL: CP001700

ID   CP001700; SV 1; circular; genomic DNA; STD; PRO; 10467782 BP.
XX
AC   CP001700; ABTI01000000-ABTI01000131;
XX
PR   Project:PRJNA21085;
XX
DT   23-AUG-2009 (Rel. 101, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Catenulispora acidiphila DSM 44928 chromosome, complete genome.
XX
KW   .
XX
OS   Catenulispora acidiphila DSM 44928
OC   Bacteria; Actinobacteria; Catenulisporales; Catenulisporaceae;
OC   Catenulispora.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-10467782
RX   PUBMED; 21304647.
RA   Copeland A., Lapidus A., Glavina Del Rio T., Nolan M., Lucas S., Chen F.,
RA   Tice H., Cheng J.F., Bruce D., Goodwin L., Pitluck S., Mikhailova N.,
RA   Pati A., Ivanova N., Mavromatis K., Chen A., Palaniappan K., Chain P.,
RA   Land M., Hauser L., Chang Y.J., Jeffries C.D., Chertkov O., Brettin T.,
RA   Detter J.C., Han C., Ali Z., Tindall B.J., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Catenulispora acidiphila type strain (ID
RT   139908)";
RL   Stand Genomic Sci 1(2):119-125(2009).
XX
RN   [2]
RP   1-10467782
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Catenulispora acidiphila DSM 44928";
RL   Unpublished.
XX
RN   [3]
RP   1-10467782
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (12-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; dc68d13be2d25631d704634e39ea4017.
DR   BioSample; SAMN02598445.
DR   CABRI; DSM 44928.
DR   EnsemblGenomes-Gn; Caci_R0001.
DR   EnsemblGenomes-Gn; Caci_R0002.
DR   EnsemblGenomes-Gn; Caci_R0003.
DR   EnsemblGenomes-Gn; Caci_R0004.
DR   EnsemblGenomes-Gn; Caci_R0005.
DR   EnsemblGenomes-Gn; Caci_R0006.
DR   EnsemblGenomes-Gn; Caci_R0007.
DR   EnsemblGenomes-Gn; Caci_R0008.
DR   EnsemblGenomes-Gn; Caci_R0009.
DR   EnsemblGenomes-Gn; Caci_R0010.
DR   EnsemblGenomes-Gn; Caci_R0011.
DR   EnsemblGenomes-Gn; Caci_R0012.
DR   EnsemblGenomes-Gn; Caci_R0013.
DR   EnsemblGenomes-Gn; Caci_R0014.
DR   EnsemblGenomes-Gn; Caci_R0015.
DR   EnsemblGenomes-Gn; Caci_R0016.
DR   EnsemblGenomes-Gn; Caci_R0017.
DR   EnsemblGenomes-Gn; Caci_R0018.
DR   EnsemblGenomes-Gn; Caci_R0019.
DR   EnsemblGenomes-Gn; Caci_R0020.
DR   EnsemblGenomes-Gn; Caci_R0021.
DR   EnsemblGenomes-Gn; Caci_R0022.
DR   EnsemblGenomes-Gn; Caci_R0023.
DR   EnsemblGenomes-Gn; Caci_R0024.
DR   EnsemblGenomes-Gn; Caci_R0025.
DR   EnsemblGenomes-Gn; Caci_R0026.
DR   EnsemblGenomes-Gn; Caci_R0027.
DR   EnsemblGenomes-Gn; Caci_R0028.
DR   EnsemblGenomes-Gn; Caci_R0029.
DR   EnsemblGenomes-Gn; Caci_R0030.
DR   EnsemblGenomes-Gn; Caci_R0031.
DR   EnsemblGenomes-Gn; Caci_R0032.
DR   EnsemblGenomes-Gn; Caci_R0033.
DR   EnsemblGenomes-Gn; Caci_R0034.
DR   EnsemblGenomes-Gn; Caci_R0035.
DR   EnsemblGenomes-Gn; Caci_R0036.
DR   EnsemblGenomes-Gn; Caci_R0037.
DR   EnsemblGenomes-Gn; Caci_R0038.
DR   EnsemblGenomes-Gn; Caci_R0039.
DR   EnsemblGenomes-Gn; Caci_R0040.
DR   EnsemblGenomes-Gn; Caci_R0041.
DR   EnsemblGenomes-Gn; Caci_R0042.
DR   EnsemblGenomes-Gn; Caci_R0043.
DR   EnsemblGenomes-Gn; Caci_R0044.
DR   EnsemblGenomes-Gn; Caci_R0045.
DR   EnsemblGenomes-Gn; Caci_R0046.
DR   EnsemblGenomes-Gn; Caci_R0047.
DR   EnsemblGenomes-Gn; Caci_R0048.
DR   EnsemblGenomes-Gn; Caci_R0049.
DR   EnsemblGenomes-Gn; Caci_R0050.
DR   EnsemblGenomes-Gn; Caci_R0051.
DR   EnsemblGenomes-Gn; Caci_R0052.
DR   EnsemblGenomes-Gn; Caci_R0053.
DR   EnsemblGenomes-Gn; Caci_R0054.
DR   EnsemblGenomes-Gn; Caci_R0055.
DR   EnsemblGenomes-Gn; Caci_R0056.
DR   EnsemblGenomes-Gn; Caci_R0057.
DR   EnsemblGenomes-Gn; Caci_R0058.
DR   EnsemblGenomes-Gn; Caci_R0059.
DR   EnsemblGenomes-Gn; Caci_R0060.
DR   EnsemblGenomes-Gn; Caci_R0061.
DR   EnsemblGenomes-Gn; Caci_R0062.
DR   EnsemblGenomes-Gn; Caci_R0063.
DR   EnsemblGenomes-Gn; Caci_R0064.
DR   EnsemblGenomes-Gn; Caci_R0065.
DR   EnsemblGenomes-Gn; Caci_R0066.
DR   EnsemblGenomes-Gn; Caci_R0067.
DR   EnsemblGenomes-Gn; Caci_R0068.
DR   EnsemblGenomes-Gn; Caci_R0069.
DR   EnsemblGenomes-Gn; Caci_R0070.
DR   EnsemblGenomes-Gn; Caci_R0071.
DR   EnsemblGenomes-Gn; Caci_R0072.
DR   EnsemblGenomes-Gn; EBG00001135202.
DR   EnsemblGenomes-Gn; EBG00001135203.
DR   EnsemblGenomes-Gn; EBG00001135204.
DR   EnsemblGenomes-Gn; EBG00001135205.
DR   EnsemblGenomes-Gn; EBG00001135206.
DR   EnsemblGenomes-Gn; EBG00001135207.
DR   EnsemblGenomes-Gn; EBG00001135208.
DR   EnsemblGenomes-Gn; EBG00001135209.
DR   EnsemblGenomes-Gn; EBG00001135210.
DR   EnsemblGenomes-Gn; EBG00001135211.
DR   EnsemblGenomes-Gn; EBG00001135212.
DR   EnsemblGenomes-Gn; EBG00001135213.
DR   EnsemblGenomes-Gn; EBG00001135214.
DR   EnsemblGenomes-Gn; EBG00001135215.
DR   EnsemblGenomes-Gn; EBG00001135216.
DR   EnsemblGenomes-Gn; EBG00001135217.
DR   EnsemblGenomes-Gn; EBG00001135218.
DR   EnsemblGenomes-Gn; EBG00001135219.
DR   EnsemblGenomes-Gn; EBG00001135220.
DR   EnsemblGenomes-Gn; EBG00001135221.
DR   EnsemblGenomes-Gn; EBG00001135222.
DR   EnsemblGenomes-Gn; EBG00001135223.
DR   EnsemblGenomes-Gn; EBG00001135224.
DR   EnsemblGenomes-Gn; EBG00001135225.
DR   EnsemblGenomes-Gn; EBG00001135226.
DR   EnsemblGenomes-Gn; EBG00001135227.
DR   EnsemblGenomes-Gn; EBG00001135228.
DR   EnsemblGenomes-Gn; EBG00001135229.
DR   EnsemblGenomes-Gn; EBG00001135230.
DR   EnsemblGenomes-Gn; EBG00001135231.
DR   EnsemblGenomes-Gn; EBG00001135232.
DR   EnsemblGenomes-Gn; EBG00001135233.
DR   EnsemblGenomes-Gn; EBG00001135234.
DR   EnsemblGenomes-Gn; EBG00001135235.
DR   EnsemblGenomes-Gn; EBG00001135236.
DR   EnsemblGenomes-Gn; EBG00001135237.
DR   EnsemblGenomes-Gn; EBG00001135238.
DR   EnsemblGenomes-Gn; EBG00001135239.
DR   EnsemblGenomes-Gn; EBG00001135240.
DR   EnsemblGenomes-Gn; EBG00001135241.
DR   EnsemblGenomes-Gn; EBG00001135242.
DR   EnsemblGenomes-Gn; EBG00001135243.
DR   EnsemblGenomes-Gn; EBG00001135244.
DR   EnsemblGenomes-Gn; EBG00001135245.
DR   EnsemblGenomes-Gn; EBG00001135246.
DR   EnsemblGenomes-Gn; EBG00001135247.
DR   EnsemblGenomes-Gn; EBG00001135248.
DR   EnsemblGenomes-Gn; EBG00001135249.
DR   EnsemblGenomes-Gn; EBG00001135250.
DR   EnsemblGenomes-Gn; EBG00001135251.
DR   EnsemblGenomes-Gn; EBG00001135252.
DR   EnsemblGenomes-Gn; EBG00001135253.
DR   EnsemblGenomes-Gn; EBG00001135254.
DR   EnsemblGenomes-Gn; EBG00001135255.
DR   EnsemblGenomes-Gn; EBG00001135256.
DR   EnsemblGenomes-Gn; EBG00001135257.
DR   EnsemblGenomes-Gn; EBG00001135258.
DR   EnsemblGenomes-Gn; EBG00001135259.
DR   EnsemblGenomes-Gn; EBG00001135260.
DR   EnsemblGenomes-Gn; EBG00001135261.
DR   EnsemblGenomes-Gn; EBG00001135262.
DR   EnsemblGenomes-Gn; EBG00001135263.
DR   EnsemblGenomes-Gn; EBG00001135264.
DR   EnsemblGenomes-Gn; EBG00001135265.
DR   EnsemblGenomes-Gn; EBG00001135266.
DR   EnsemblGenomes-Gn; EBG00001135267.
DR   EnsemblGenomes-Gn; EBG00001135268.
DR   EnsemblGenomes-Gn; EBG00001135269.
DR   EnsemblGenomes-Gn; EBG00001135270.
DR   EnsemblGenomes-Gn; EBG00001135271.
DR   EnsemblGenomes-Gn; EBG00001135272.
DR   EnsemblGenomes-Gn; EBG00001135273.
DR   EnsemblGenomes-Gn; EBG00001135274.
DR   EnsemblGenomes-Gn; EBG00001135275.
DR   EnsemblGenomes-Gn; EBG00001135276.
DR   EnsemblGenomes-Gn; EBG00001135277.
DR   EnsemblGenomes-Gn; EBG00001135278.
DR   EnsemblGenomes-Gn; EBG00001135279.
DR   EnsemblGenomes-Gn; EBG00001135280.
DR   EnsemblGenomes-Gn; EBG00001135281.
DR   EnsemblGenomes-Gn; EBG00001135282.
DR   EnsemblGenomes-Tr; Caci_R0001-1.
DR   EnsemblGenomes-Tr; Caci_R0002-1.
DR   EnsemblGenomes-Tr; Caci_R0003-1.
DR   EnsemblGenomes-Tr; Caci_R0004-1.
DR   EnsemblGenomes-Tr; Caci_R0005-1.
DR   EnsemblGenomes-Tr; Caci_R0006-1.
DR   EnsemblGenomes-Tr; Caci_R0007-1.
DR   EnsemblGenomes-Tr; Caci_R0008-1.
DR   EnsemblGenomes-Tr; Caci_R0009-1.
DR   EnsemblGenomes-Tr; Caci_R0010-1.
DR   EnsemblGenomes-Tr; Caci_R0011-1.
DR   EnsemblGenomes-Tr; Caci_R0012-1.
DR   EnsemblGenomes-Tr; Caci_R0013-1.
DR   EnsemblGenomes-Tr; Caci_R0014-1.
DR   EnsemblGenomes-Tr; Caci_R0015-1.
DR   EnsemblGenomes-Tr; Caci_R0016-1.
DR   EnsemblGenomes-Tr; Caci_R0017-1.
DR   EnsemblGenomes-Tr; Caci_R0018-1.
DR   EnsemblGenomes-Tr; Caci_R0019-1.
DR   EnsemblGenomes-Tr; Caci_R0020-1.
DR   EnsemblGenomes-Tr; Caci_R0021-1.
DR   EnsemblGenomes-Tr; Caci_R0022-1.
DR   EnsemblGenomes-Tr; Caci_R0023-1.
DR   EnsemblGenomes-Tr; Caci_R0024-1.
DR   EnsemblGenomes-Tr; Caci_R0025-1.
DR   EnsemblGenomes-Tr; Caci_R0026-1.
DR   EnsemblGenomes-Tr; Caci_R0027-1.
DR   EnsemblGenomes-Tr; Caci_R0028-1.
DR   EnsemblGenomes-Tr; Caci_R0029-1.
DR   EnsemblGenomes-Tr; Caci_R0030-1.
DR   EnsemblGenomes-Tr; Caci_R0031-1.
DR   EnsemblGenomes-Tr; Caci_R0032-1.
DR   EnsemblGenomes-Tr; Caci_R0033-1.
DR   EnsemblGenomes-Tr; Caci_R0034-1.
DR   EnsemblGenomes-Tr; Caci_R0035-1.
DR   EnsemblGenomes-Tr; Caci_R0036-1.
DR   EnsemblGenomes-Tr; Caci_R0037-1.
DR   EnsemblGenomes-Tr; Caci_R0038-1.
DR   EnsemblGenomes-Tr; Caci_R0039-1.
DR   EnsemblGenomes-Tr; Caci_R0040-1.
DR   EnsemblGenomes-Tr; Caci_R0041-1.
DR   EnsemblGenomes-Tr; Caci_R0042-1.
DR   EnsemblGenomes-Tr; Caci_R0043-1.
DR   EnsemblGenomes-Tr; Caci_R0044-1.
DR   EnsemblGenomes-Tr; Caci_R0045-1.
DR   EnsemblGenomes-Tr; Caci_R0046-1.
DR   EnsemblGenomes-Tr; Caci_R0047-1.
DR   EnsemblGenomes-Tr; Caci_R0048-1.
DR   EnsemblGenomes-Tr; Caci_R0049-1.
DR   EnsemblGenomes-Tr; Caci_R0050-1.
DR   EnsemblGenomes-Tr; Caci_R0051-1.
DR   EnsemblGenomes-Tr; Caci_R0052-1.
DR   EnsemblGenomes-Tr; Caci_R0053-1.
DR   EnsemblGenomes-Tr; Caci_R0054-1.
DR   EnsemblGenomes-Tr; Caci_R0055-1.
DR   EnsemblGenomes-Tr; Caci_R0056-1.
DR   EnsemblGenomes-Tr; Caci_R0057-1.
DR   EnsemblGenomes-Tr; Caci_R0058-1.
DR   EnsemblGenomes-Tr; Caci_R0059-1.
DR   EnsemblGenomes-Tr; Caci_R0060-1.
DR   EnsemblGenomes-Tr; Caci_R0061-1.
DR   EnsemblGenomes-Tr; Caci_R0062-1.
DR   EnsemblGenomes-Tr; Caci_R0063-1.
DR   EnsemblGenomes-Tr; Caci_R0064-1.
DR   EnsemblGenomes-Tr; Caci_R0065-1.
DR   EnsemblGenomes-Tr; Caci_R0066-1.
DR   EnsemblGenomes-Tr; Caci_R0067-1.
DR   EnsemblGenomes-Tr; Caci_R0068-1.
DR   EnsemblGenomes-Tr; Caci_R0069-1.
DR   EnsemblGenomes-Tr; Caci_R0070-1.
DR   EnsemblGenomes-Tr; Caci_R0071-1.
DR   EnsemblGenomes-Tr; Caci_R0072-1.
DR   EnsemblGenomes-Tr; EBT00001726513.
DR   EnsemblGenomes-Tr; EBT00001726514.
DR   EnsemblGenomes-Tr; EBT00001726515.
DR   EnsemblGenomes-Tr; EBT00001726516.
DR   EnsemblGenomes-Tr; EBT00001726517.
DR   EnsemblGenomes-Tr; EBT00001726518.
DR   EnsemblGenomes-Tr; EBT00001726519.
DR   EnsemblGenomes-Tr; EBT00001726520.
DR   EnsemblGenomes-Tr; EBT00001726521.
DR   EnsemblGenomes-Tr; EBT00001726522.
DR   EnsemblGenomes-Tr; EBT00001726523.
DR   EnsemblGenomes-Tr; EBT00001726524.
DR   EnsemblGenomes-Tr; EBT00001726525.
DR   EnsemblGenomes-Tr; EBT00001726526.
DR   EnsemblGenomes-Tr; EBT00001726527.
DR   EnsemblGenomes-Tr; EBT00001726528.
DR   EnsemblGenomes-Tr; EBT00001726529.
DR   EnsemblGenomes-Tr; EBT00001726530.
DR   EnsemblGenomes-Tr; EBT00001726531.
DR   EnsemblGenomes-Tr; EBT00001726532.
DR   EnsemblGenomes-Tr; EBT00001726533.
DR   EnsemblGenomes-Tr; EBT00001726534.
DR   EnsemblGenomes-Tr; EBT00001726535.
DR   EnsemblGenomes-Tr; EBT00001726536.
DR   EnsemblGenomes-Tr; EBT00001726537.
DR   EnsemblGenomes-Tr; EBT00001726538.
DR   EnsemblGenomes-Tr; EBT00001726539.
DR   EnsemblGenomes-Tr; EBT00001726540.
DR   EnsemblGenomes-Tr; EBT00001726541.
DR   EnsemblGenomes-Tr; EBT00001726542.
DR   EnsemblGenomes-Tr; EBT00001726543.
DR   EnsemblGenomes-Tr; EBT00001726544.
DR   EnsemblGenomes-Tr; EBT00001726545.
DR   EnsemblGenomes-Tr; EBT00001726546.
DR   EnsemblGenomes-Tr; EBT00001726547.
DR   EnsemblGenomes-Tr; EBT00001726548.
DR   EnsemblGenomes-Tr; EBT00001726549.
DR   EnsemblGenomes-Tr; EBT00001726550.
DR   EnsemblGenomes-Tr; EBT00001726551.
DR   EnsemblGenomes-Tr; EBT00001726552.
DR   EnsemblGenomes-Tr; EBT00001726553.
DR   EnsemblGenomes-Tr; EBT00001726554.
DR   EnsemblGenomes-Tr; EBT00001726555.
DR   EnsemblGenomes-Tr; EBT00001726556.
DR   EnsemblGenomes-Tr; EBT00001726557.
DR   EnsemblGenomes-Tr; EBT00001726558.
DR   EnsemblGenomes-Tr; EBT00001726559.
DR   EnsemblGenomes-Tr; EBT00001726560.
DR   EnsemblGenomes-Tr; EBT00001726561.
DR   EnsemblGenomes-Tr; EBT00001726562.
DR   EnsemblGenomes-Tr; EBT00001726563.
DR   EnsemblGenomes-Tr; EBT00001726564.
DR   EnsemblGenomes-Tr; EBT00001726565.
DR   EnsemblGenomes-Tr; EBT00001726566.
DR   EnsemblGenomes-Tr; EBT00001726567.
DR   EnsemblGenomes-Tr; EBT00001726568.
DR   EnsemblGenomes-Tr; EBT00001726569.
DR   EnsemblGenomes-Tr; EBT00001726570.
DR   EnsemblGenomes-Tr; EBT00001726571.
DR   EnsemblGenomes-Tr; EBT00001726572.
DR   EnsemblGenomes-Tr; EBT00001726573.
DR   EnsemblGenomes-Tr; EBT00001726574.
DR   EnsemblGenomes-Tr; EBT00001726575.
DR   EnsemblGenomes-Tr; EBT00001726576.
DR   EnsemblGenomes-Tr; EBT00001726577.
DR   EnsemblGenomes-Tr; EBT00001726578.
DR   EnsemblGenomes-Tr; EBT00001726579.
DR   EnsemblGenomes-Tr; EBT00001726580.
DR   EnsemblGenomes-Tr; EBT00001726581.
DR   EnsemblGenomes-Tr; EBT00001726582.
DR   EnsemblGenomes-Tr; EBT00001726583.
DR   EnsemblGenomes-Tr; EBT00001726584.
DR   EnsemblGenomes-Tr; EBT00001726585.
DR   EnsemblGenomes-Tr; EBT00001726586.
DR   EnsemblGenomes-Tr; EBT00001726587.
DR   EnsemblGenomes-Tr; EBT00001726588.
DR   EnsemblGenomes-Tr; EBT00001726589.
DR   EnsemblGenomes-Tr; EBT00001726590.
DR   EnsemblGenomes-Tr; EBT00001726591.
DR   EnsemblGenomes-Tr; EBT00001726592.
DR   EnsemblGenomes-Tr; EBT00001726593.
DR   EuropePMC; PMC3072421; 21490938.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001700.
DR   SILVA-SSU; CP001700.
DR   StrainInfo; 685605; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082785
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Catenulispora acidiphila ID139908, DSM
CC                            44928
CC   Culture Collection ID :: DSM 44928, NRRL B-24433, JCM 14897
CC   GOLD Stamp ID         :: Gi02233
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Forest soil from Gerenzano Italy
CC   Collection Date       :: before 2006
CC   Isolation Country     :: Italy
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Filament-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 22 - 28C
CC   pH                    :: 6
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Phenotypes            :: Acidophile
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10467782
FT                   /organism="Catenulispora acidiphila DSM 44928"
FT                   /strain="DSM 44928"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:479433"
FT                   /type_material="type strain of Catenulispora acidiphila"
FT   gene            370..2082
FT                   /locus_tag="Caci_0001"
FT   CDS_pept        370..2082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68956"
FT                   /db_xref="GOA:C7QFL7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU68956.1"
FT                   /translation="MPARRYHQGRQHRMEPQAVSDPQGYTPVPHPPAAPGDAIALWSHF
FT                   RARVESDSSLTKSEQAFLMIPEARTVIGDTIVLAVPDDFSKNYLEQRLEPMLTTHLAAM
FT                   FGPDIKFSLFVDKIMENTPAPAAAGPVAPPAPVIQQLAPPPAHWTPPPAMQSGAELQVP
FT                   AAFHSDPPAFAPDVPRPGLGGMALPPPRVSEPAPEENDPIAATLSLSTGRPGARSSTPD
FT                   DGAKAQQAKLNEKYVFETFVIGSSNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHL
FT                   LHAIGHYARNLYPGTRVRYVSTEEFTNDFINAIRDGAGNHLRKRYRDVDILMVDDIQFL
FT                   ENKEGTQEEFFHTFNTLHNASKQIVISSDRPPKQLNTLEDRLRSRFEWGLITDIQPPEL
FT                   ETRIAILRKKAQQEGLNAPPEVLEFIASKISTNIRELEGALIRVTAFASLNRAPVDLSL
FT                   AEDVLKNLMPDAAGPEITVSTIMAQTAMYFGITMEDLCGTSRSRILVTARQIAMYLCRE
FT                   LTDLSLPKIGQAFGGRDHTTVMHADRKIRSLLPERRAIFNQVTELTNRIKQSG"
FT   gene            2834..4024
FT                   /locus_tag="Caci_0002"
FT   CDS_pept        2834..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sco:SCO3878 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68957"
FT                   /db_xref="GOA:C7QFL8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU68957.1"
FT                   /translation="MKFRVERDVLSEAVAWTARSLPSRPAAPVLAGLVFEAVEGEGGED
FT                   HGSVTLSGFDYEVSSRAQIGADVTEPGRILIHGKLLADIAKSLPNRPVEFSTEGSKVLL
FT                   SCGSSRFTLQTLPVEDYPALPTMPTATGAVTASGLAGAVSQVAIAAGRDDTIPMLTGIR
FT                   VEIEGEKITLVATDRFRLAVRELQWKPEQDDMSATALIPSKVLSDTAKALTGGDWVSLA
FT                   LSGGDAGEGLIGFESGEGTSGKAKGSRRMTSRLLSGEFVKYRSLFPNEYNITATVETAP
FT                   FLEAAKRVSLVADRTSPIKLAFTQGEVTLEAGAGDEAQASEAMDAVLDGEDISVSFNPS
FT                   FLLDGLQVIDTQYAQLSFTVASKPAVLMGRPALDAPAQEEFRYLMMPLRVPGQSAG"
FT   gene            4110..4988
FT                   /locus_tag="Caci_0003"
FT   CDS_pept        4110..4988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: sco:SCO3877 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68958"
FT                   /db_xref="GOA:C7QFL9"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL9"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU68958.1"
FT                   /translation="MEIGLVGLGKMGGNMRERIRQAGHTVVGYDRDPKLADVGSLKELV
FT                   QTLAAPRVIWIMVPAGEATDATVNELADLLHTGDMVIDGGNSRWTEDIKHAELLKAQGV
FT                   AFVDAGVSGGVWGLQNGYALMVGGDEADIARVQPVFDALKPAGDSGFVHAGGVGAGHFS
FT                   KMVHNGIEYGIMQSYAEGWELLEAAPNVTNVREVFRSWQEGTVIRSWLLDLLVRALDDD
FT                   EHLAGIRGYADDSGEGRWTVEAGIDMAVPTPAITASLYARFTSRQEDSPQMKAIAALRN
FT                   QFGGHAVKKES"
FT   gene            4998..6143
FT                   /locus_tag="Caci_0004"
FT   CDS_pept        4998..6143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV_4319 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68959"
FT                   /db_xref="GOA:C7QFM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU68959.1"
FT                   /translation="MRVTHLSLADFRSYASLDVALGGGVTAFVGPNGQGKTNLVEAIGY
FT                   IATLDSHRVATDQPLVRFGAPRAIVRANVEREGRTQLVEIELNPGGANRARLNRNPVPR
FT                   PREVLGVLRTVLFAPEDLALVKGDPGERRRFLDELLVARWPRFAGVRADYDRVLKQRNT
FT                   LLRTAAMARRNKASGPNISTLDAWDHHLALAGAELVAARLALISALSPLVDKCYVEIAE
FT                   GGQTRIGYRSTISAEPDPTAAALTEQFMTALGEARANELDRGITLVGPHRDEMVLELTS
FT                   SSGDNMPARGYASHGESWSYALALRLAAYDLLRSDGSDGGEPVLILDDVFAELDAKRRR
FT                   RLAERVSGADQVLITAAVDADVPEQLIGQKFTVADGQVSAA"
FT   gene            6140..6658
FT                   /locus_tag="Caci_0005"
FT   CDS_pept        6140..6658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sgr:SGR_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68960"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM1"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU68960.1"
FT                   /translation="MNPQPVDNGSGAEGGDPQDSGVDLARAALAAARARGKDNGAGWSG
FT                   NRRRNSNSGQRSGSGPDERDPQLLSSAIPRMIEARGWSVPAAVGGVMGRWGEIVGSHIS
FT                   AHCTPVEFHDGVLMVRTDSAAWATELRMLAPQLLAKLNAELGTSRAAHGGRDAAGAIAT
FT                   LKVVGPGGR"
FT   gene            7225..9210
FT                   /locus_tag="Caci_0006"
FT   CDS_pept        7225..9210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4321 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68961"
FT                   /db_xref="GOA:C7QFM2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU68961.1"
FT                   /translation="MADVEPTGGSTPSLDGIYNADSISVLEGLEAVRKRPGMYIGSTGE
FT                   RGLHHLVYEIVDNSVDEAMAGYADTIEVWLLADGGVKVVDNGRGIPVGINTKTGKSALE
FT                   VVMTILHAGGKFGDGGYKVSGGLHGVGVSVVNALSSRVEVEVHTDGFVWNQVYKHGVPE
FT                   TEVQKGGPAADTGTSTIFWADVDIFETTVYSFETLSRRFQEMAFLNKGLTISLTDERPE
FT                   FRDENGEQRSVKYHAEGGIADFVRHINSRKGEPVHPNVIDFEGEDKDRTLAAEIALQWN
FT                   SQYSESIYTFANNINTHGGGTHEEGFRAALTTLINKYARDQKLLKEKDDNLAGEDIREG
FT                   LTTIVSVKLAEPQFEGQTKDKLGNPEAKTFVQRLVYEKLGEWLEENPNEAREVIRKTIQ
FT                   ASTARMAARKARELTRRKGLLESSSLPGKLSDCQSNDPTKTEIFIVEGDSAGGSARSGR
FT                   DPMTQAILPIRGKILNVEKARIDKVLQNTEVQALISALGTGVHDDFDISRLRYHKIILM
FT                   ADADVDGAHINTLLLTLLFRFMKPLVEAGHVYLAAPPLYKVKWTNNDFNYAYSDRERDQ
FT                   LLEAGVGAGKRRKDETVQRFKGLGEMNAEELRITTMDREHRILRQVTLDDAAQADDLFS
FT                   VLMGEDVEARRNFIQRNAKDVRFLDI"
FT   gene            9293..11920
FT                   /locus_tag="Caci_0007"
FT   CDS_pept        9293..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4322 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68962"
FT                   /db_xref="GOA:C7QFM3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU68962.1"
FT                   /translation="MDETPQGDRIDPVDLQTEMQRSYLDYAMSVIVGRALPDVRDGLKP
FT                   VHRRVLYAMYDGGYRPEKGYYKCARVVGEVMGIYHPHGDSPIYDTLVRLAQPWSLRMVL
FT                   VDGNGNFGSPGNDPAAAMRYTECKMAPLAMEMVRDIDEDTVDFRPNYDGRSSEPVVLPA
FT                   RFPNLLVNGSTGIAVGMATNIPSHNLREVNDGVQWFLQNPEATNEELLEALIERIKGPD
FT                   FPTGALIVGRRGIEDAYRTGRGSITMRAVVNTEEINGRMCLVVTELPYQVNPDNLALKI
FT                   AELVKDGKVAGIADVRDESSSRTGQRLVIVLKRDAVAKVVLNNLYKHTQLQDSFGANML
FT                   ALVDDVPRTLSLDAFIRHWVTHQIDVIVRRTRFRLRKAQERAHILVGLLKALDAIDEVV
FT                   ALIRRSPTVDEARSGLIELLTIDEIQANAILEMQLRRLAALERQRIEAEHNELMAKIAD
FT                   YTAILESPERQRRIVSEELQAISDKYGDDRRSQLVPYEGDMSIEDLIPEEDVVVTITRG
FT                   GYTRRTRTDLYRSQKRGGKGVKGAQLKQDDIVDHFFVTTTHHWLLFFTNKGRVYRAKAH
FT                   ELPDTARDARGQHVANLLAFLPDEKIAQVLDLRDYEQTPYLVLATKNGLIKKTPLKDYD
FT                   SPRSAGVIAINLREDDELIAAELVSPEDDLLLVSKQAQGLRFTATDEALRPMGRATSGV
FT                   IGMRFREDDELLSMDVVRPDTFLFTATSGGYGKRTAVEMFPLRGRGGLGVIAAKTVDER
FT                   GGLVGAAVVDEGDEVMAITLSGGVIRTRVSEVRPTSRDTMGVRVINLGKGDTVLAIARN
FT                   GDPGEVEDELGEEAGAPAEAAGADVVAEARENGAVVEASEGSEVIDESEGSDESDGSEA
FT                   SSEE"
FT   gene            12855..13391
FT                   /locus_tag="Caci_0008"
FT   CDS_pept        12855..13391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68963"
FT                   /db_xref="GOA:C7QFM4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4323"
FT                   /protein_id="ACU68963.1"
FT                   /translation="MGTVAYQQSDSAQGQAGTRQQAGGGWGARPNSPAGAPTGAPRYQQ
FT                   QQAPAAAPRGRKARLRVAKVDPWSVMKTTFVLSIAFAVVSVVAAALLWSALNALGVFDS
FT                   INHTLASVAPANQPNSVTLTSVLSFGKVLSFTALVSVVNIVLFTALATLAAYLYNMCSS
FT                   LVGGIEVTLADDTAS"
FT   gene            13459..13535
FT                   /locus_tag="Caci_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            13459..13535
FT                   /locus_tag="Caci_R0001"
FT                   /product="tRNA-Ile"
FT   gene            complement(13602..14144)
FT                   /locus_tag="Caci_0009"
FT   CDS_pept        complement(13602..14144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_4895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68964"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68964.1"
FT                   /translation="MSAVQIAGCSAAGKSAIATALAHQGLTTIDSDADPHLARFVDPQG
FT                   TIVAQPPPAPDLPWLAEHSWAWDPNRLDELIQTAAPATLYVCGGADNQHEMANRFTQVF
FT                   LLEIDEPTMLARLDARRDYHEWGHVGDTREYLRRKLPILQDTLRASGAIVIDARQPLDQ
FT                   VVAAVLRYTPPMAPFSF"
FT   gene            complement(14277..14699)
FT                   /locus_tag="Caci_0010"
FT   CDS_pept        complement(14277..14699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0010"
FT                   /product="Curculin domain protein (mannose-binding) lectin"
FT                   /note="PFAM: Curculin domain protein (mannose-binding)
FT                   lectin; SMART: Curculin domain protein (mannose-binding)
FT                   lectin; KEGG: pfl:PFL_2127 putidacin L1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68965"
FT                   /db_xref="GOA:C7QFM6"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM6"
FT                   /inference="protein motif:PFAM:PF01453"
FT                   /protein_id="ACU68965.1"
FT                   /translation="MVKRTIGAIAGAAALAAALSVAGTGTALAATGGDHLNKGDTMYAN
FT                   DDIHNPAGTKLVFQPDGNLVEYRYDGHVCWATGTNGRGGTRVTYQNDGNLVMYASTDDS
FT                   RPIWASGTSGDNGLNVNINARGEIWVGYDQLTNACE"
FT   sig_peptide     complement(14610..14699)
FT                   /locus_tag="Caci_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 30"
FT   gene            complement(14928..15650)
FT                   /locus_tag="Caci_0011"
FT   CDS_pept        complement(14928..15650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: saq:Sare_0152 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68966"
FT                   /db_xref="GOA:C7QFM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU68966.1"
FT                   /translation="MKRVDDRPQHARIAADLRAKILAGDITGTLPPFKRLMELYSTTTN
FT                   TAQRAVALLKAEGFVEGQRGKALIIRADRIRIVDAASQFEPPASTITYQILHIGPARPP
FT                   ADAAQKLGLAEGETALLRKRLMLRDEEPVEIEWSFYPESVVTGTALDKPLPQRDLATAP
FT                   TVLAALGWKQAGLVDEIQVREPTTEELQTLELPDEIPVMRTLRTITDAEGTVLEVTVMI
FT                   TSGHLYGVRYQQKLTPPA"
FT   gene            15874..16083
FT                   /locus_tag="Caci_0012"
FT   CDS_pept        15874..16083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68967"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68967.1"
FT                   /translation="MPRFEFKYASDLVVGDWAQIGGKWVEVLGCATDPSGWTRLILDRS
FT                   PLPETVVHQTVDMPWSPMRPAGSA"
FT   gene            16080..16481
FT                   /locus_tag="Caci_0013"
FT   CDS_pept        16080..16481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68968"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68968.1"
FT                   /translation="MRRPEDIGAFLAEHSDGRVIGQMPAMFGIAVTPAEAEFQRRLLAA
FT                   GHTGSYLALLGLAATLTFDAGEYFHTGEQNRRDLSEWHGYHRGLQTALACLVMHETGSN
FT                   PRQAALMVAEHTETLIRCRWANRPAKGGG"
FT   gene            16485..16967
FT                   /locus_tag="Caci_0014"
FT   CDS_pept        16485..16967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0014"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68969"
FT                   /db_xref="GOA:C7QFN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU68969.1"
FT                   /translation="MDVWSKEFAGRPECLAEARRFTYAVLGRGDGAHIAALVADELAGN
FT                   AIRHTASGRPGGEFILRLARFGNRCRVRVDDQGGPTTPEVCAATDFEEAGRGLTIVASL
FT                   SAQWGVEGDEHARSVWAEITFEEIPGISGPDGPAVDLPPQARARRKVGMTTEDWTR"
FT   gene            16967..17629
FT                   /locus_tag="Caci_0015"
FT   CDS_pept        16967..17629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0015"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68970"
FT                   /db_xref="GOA:C7QFN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68970.1"
FT                   /translation="MALHVDYAAQRAFSRIIAGLRSARLDAELSQNALATGLPVRGRAV
FT                   SEWETGAIEPTLGHLIQWSWELGRRLVIVGRDGELRYGPVRQRPGELWEAFERRRLAVP
FT                   LRNRRLALGMAQGELGELVGVSRDSIQRWELVRVPPRPIAHVVWAQKLGYSLDTRPVAD
FT                   GGPRLRRVGSAGLALPGLSGQIGQQGQPGLTGQAERSASGPGSPAGELRAAADGRRG"
FT   gene            complement(17749..18954)
FT                   /locus_tag="Caci_0016"
FT   CDS_pept        complement(17749..18954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0016"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   sgr:SGR_3958 putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68971"
FT                   /db_xref="GOA:C7QFN2"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN2"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACU68971.1"
FT                   /translation="MTGFEHDPYQPEQPATGDPQPWGHPSSGPVLGPAHASASAYPPAY
FT                   PSASSPSPAASEPMPPYTPPITSITPGYGNPGEAGGLGGPGSFGGPGGFGGPGGPGGPG
FT                   YTTHPAFSPEPPRRPRRKRRMGMALIIAGTIAASAAAGGIAGTIASHNNSSNSASSSVP
FT                   LNNTSVNTPVSNQTGTPTTTVGQVAKAALPTVVQVSVESYQGKSVGSGVILTADGLILT
FT                   NNHVITDAANGNGQITITFNNGKTAQASIVGYDSGSDLAVIKAQSVSGLPTASLGDSSK
FT                   IQIGDTVVAIGSPDGLQSTVTSGIVSALNRQVTVSSESSSRFSSGSQVTYSAIQTDASL
FT                   NPGNSGGPLLNAQGQVIGINSAIYSPTSSANAQGGSVGLGFSIPIDQVKTMLAKLEGGQ
FT                   MS"
FT   gene            19091..19840
FT                   /locus_tag="Caci_0017"
FT   CDS_pept        19091..19840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68972"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN3"
FT                   /inference="similar to AA sequence:KEGG:SGR_419"
FT                   /protein_id="ACU68972.1"
FT                   /translation="MDRDPLPDARALVRERYPQAVYAVLAGSVLTAHRTPGSDLDIVVA
FT                   LPPGDPLAPRRESLVFRDWPVELFVHDEQTLDQWLAKEYRERKPSLYRMVGRGTPIVGD
FT                   PADRQAYCRAVLDAGPDPMGPAQLEAARYGLTDLLDDLFHAGDPGERQVIAATLWTAAG
FT                   HHALVAGNRWDGTGKWLLRELRDHDPDLADRWLAAQHDAAAVEAFARDVLDRLGGPLFD
FT                   GYQAVAPRAETTKTTKTTKTTEFTRST"
FT   gene            complement(19886..20500)
FT                   /locus_tag="Caci_0018"
FT   CDS_pept        complement(19886..20500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68973"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68973.1"
FT                   /translation="MRIRPVLAVAGSVFLFSSNGFAAHAATQAPSGNSLPATGTAVSLT
FT                   EDGDMVLECNGVLHRFEVLGTGQVRVGARVAGDQPTVAVRTEAEQLTGYDADLGTVTVS
FT                   EKTPADGDFVAPAVGREFPAAESLAQDLTISMQHSPCGGGEPATFTNKAAFPLLNTNMT
FT                   AFPPRNAVFLMTDPVELTDIANPSGPSIMLTEFPLTITQAA"
FT   sig_peptide     complement(20423..20500)
FT                   /locus_tag="Caci_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            complement(20593..21360)
FT                   /locus_tag="Caci_0019"
FT   CDS_pept        complement(20593..21360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0019"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68974"
FT                   /db_xref="GOA:C7QFN5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68974.1"
FT                   /translation="MSYWSRSFPGLAENLAEVRQFIQMVLGDAPGAELVVLAGSELAGN
FT                   AIVHTASGAPGGQFVVHLAAFADRWQVRVDDAGSPTEPRVLVDSMDEHCDWDSESGRGL
FT                   AMVASISRKWGVLGDRAARAVWAEIPCPVPPGGGIESVMSGGMLEALESVARALENENR
FT                   PPYQELDTSSATAPATAAVPSVAIAPARWPGTMPSDPARAERIRRQASHAAFQRALIES
FT                   AYAETLGPRPLPYWPPFPNPLALQGSSPGTRPR"
FT   gene            complement(21461..22336)
FT                   /locus_tag="Caci_0020"
FT   CDS_pept        complement(21461..22336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0020"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: nfa:nfa38930
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68975"
FT                   /db_xref="GOA:C7QFN6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68975.1"
FT                   /translation="MGMSAVRSPYAAKLGGRIRQFRMERALSSGELAAAASVTSSAVSK
FT                   VEHGKMVPSRDVLARIVTALNLPAEEQESLFDLLGQAAADAASNRGYGKGLTLLNQIAD
FT                   RERVCSAVSTFSNSIIPRLLQTAEYARDANRLTPWLSEREVGKAAMTHTERQSVLFEDG
FT                   REFTFLITEGVLRTWPGELTVMAAQFDRLRQMAVHPGVRVGILPWTSAMRGLPMVTFTL
FT                   YDDREVAVEMFTGELLMAQPDKVSTHVAQFRRFEESAVYGEEAIGLINRVEMDLARLPP
FT                   LALDEDLSSK"
FT   gene            complement(22500..23396)
FT                   /locus_tag="Caci_0021"
FT   CDS_pept        complement(22500..23396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0021"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: fal:FRAAL6347
FT                   putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68976"
FT                   /db_xref="GOA:C7QFN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68976.1"
FT                   /translation="MVHGRGHTVGMSPARSVLAEELGRRLRRHRLDLGLSGLEVAARAG
FT                   VTQPSVSKIERGMMLPSTEVLERVLGVLGLADEHRTDLRDLLTRAVDDAADRRRHGRGL
FT                   ALLDAIAERERNTTALRSFSTSMIPPLLQTADYARYAARLTPWMSERELGRASALHLER
FT                   QGVLFEQGRSFEFLLTESALRLCPGPPTLAATQADRLRVLSALPGVRIGIVPDSAAVSE
FT                   VFPLYGFTLHDDAAVAVETFTGELLLSRADEIAAHAAVLDGYAAGADYDLETATGLLTS
FT                   DRRPLASIPAPAGAGTG"
FT   gene            23568..24164
FT                   /locus_tag="Caci_0022"
FT   CDS_pept        23568..24164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0022"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sco:SCO2347 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68977"
FT                   /db_xref="GOA:C7QFN8"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN8"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ACU68977.1"
FT                   /translation="MSLTALLTAFGVVFLAELPDKTAIASLILGARYRPSWVFAGVAAA
FT                   FVVHVALAVAAGSLLTLVPRRPLEAIVAVLFLGGAVLMLRSHGREAGEEEAEEAPDLGD
FT                   DAGFGKVAGTAFGVIMVAEFGDLTQIVTANLAAKFADPLAVGLGATLGLWAVGGLAIVG
FT                   GRSLLKVLPLHLIVRLAALVMVVLAGVSLWQAVAG"
FT   gene            complement(24190..24807)
FT                   /locus_tag="Caci_0023"
FT   CDS_pept        complement(24190..24807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_2766
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68978"
FT                   /db_xref="GOA:C7QFN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU68978.1"
FT                   /translation="MSNRDDLLAGAKKCLLEKGYSRTTARDIAQASGVSLAAIGYHFGS
FT                   KDALMNEAMFQAIGEWGDHLEEAFAKAGPNLSVQERFARVFDDVSATFDENQALWMASF
FT                   ELIIEIDRIPGARDMFRKAIPEARTGLANLILGIPEEDVDKDMEMGAGAVLYSLMAGLL
FT                   IQRFADTGQTPTGADLARGLRQLADVLEADVLKSSDKAAAVS"
FT   gene            24904..26529
FT                   /locus_tag="Caci_0024"
FT   CDS_pept        24904..26529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0024"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO5516 integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68979"
FT                   /db_xref="GOA:C7QFP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU68979.1"
FT                   /translation="MTTTQNPGTAPAPRAGRKEWIGLAVLVLPCLLISMDMSVLLFGLP
FT                   FISASLKPSATQQLWIMDAYGFALAGLLITMGAVGDRIGRRRLLLIGATAFGAASVVAA
FT                   YSGSAEVLIGTRALLGVAGATLMPSTMALIRNMFHDPKQRQTAISLWTGGLIGGVTLGP
FT                   IVGGALLNHFWWGSVFLINLPAMALLLILGPLLLPEYKAPADGRRFDVLGSVLSMAAVF
FT                   PAVYGIKQLAVDGFSATAAGSLAFGIALAVAFVLRQHTAKNPLIDMELFRKPAFRAPML
FT                   VNLCGNFVLMGFSLFNTQYLQSVAGMRPFTAALWSMAAMPFVSVGMGVTGALTTKVRPG
FT                   RIIGVAFLVSSAGALVLTLAHPGNPIVVLLIGAGIAAGGVVAAQSIVGNMVMAAAPAER
FT                   AGSASALNETGAELGSSLGMALLGSVGAAIYHHKMQTVGASGAPDAAVRAGHETIGGAD
FT                   ALAAQFPGPATHALLTTARDAYASGLHTAAGVGAVVLFLTALFAFRALRNEPVLPAAPK
FT                   KEKGTKSKDAMPAEISPDYAAQAV"
FT   gene            complement(26620..27483)
FT                   /locus_tag="Caci_0025"
FT   CDS_pept        complement(26620..27483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0025"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; KEGG: kpn:KPN_04605 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68980"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU68980.1"
FT                   /translation="MTIAITAAGGHLGRLVVEDLLARGVPAGQIRAIVRTPEKVQDFAD
FT                   RGVQVVRGDYADVPGLTEALRGADKWVFISSSGSDEDRLSQHLTAIQAGKAAGVPHVVY
FT                   TSIPKAETNPISFASVHKETEAAIKESGLPHTFLRNNWYWENLTASLPNAIEHGAIIGA
FT                   VGEGLTAFAARADYAAAAAVVATTEGHEGKIYELTGDRAYSYAEIAAEISRQTGKEIAA
FT                   VNLDPEEYRKTLAGFGLPDFLSAGLAHADSKIAEGALADVTSDLSTLIGRPTTTVAEAI
FT                   TDALKA"
FT   gene            27626..28087
FT                   /locus_tag="Caci_0026"
FT   CDS_pept        27626..28087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0026"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: sma:SAV_2662
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68981"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP2"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU68981.1"
FT                   /translation="MSTRVVTPGVVTPEAEERALGMAYDVVYDVLQAPCPSRQALEHVT
FT                   GRWGALIMMALREGPVRFNELRRRVDGVSEKMLSQGLQALERDGFVAREVQSTMPPKVE
FT                   YQLTPLGTQTSDRLADLVEFLEGRMPEVEAAQARHDEAASAAASVSASA"
FT   gene            28115..28855
FT                   /locus_tag="Caci_0027"
FT   CDS_pept        28115..28855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0027"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: sma:SAV_994 conventional protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68982"
FT                   /db_xref="GOA:C7QFP3"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP3"
FT                   /inference="similar to AA sequence:KEGG:SAV_994"
FT                   /protein_id="ACU68982.1"
FT                   /translation="MTRHVEFQRLHNFRDLGGYPAGAGRATKWGVLYRSDNLRKLNESD
FT                   DVERFRALDVHTVVDLRYPWEIEQSGRVPDFPGLRYVNLSIEHQPYDQGALGDDFDPWR
FT                   FLADRYMEVAQDGGKEIRGVLDVIADPESGTTVFHCASGKDRTGIIAMLVLSLIGVSED
FT                   DVVADFALTELATERLIADWKAFYPDRELTWSAYARAPKEPMELFIADLKSRYGSVEGY
FT                   AEQELGVDEALVAALKAKLVDVEG"
FT   gene            complement(28835..29308)
FT                   /locus_tag="Caci_0028"
FT   CDS_pept        complement(28835..29308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0028"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:RL2084 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68983"
FT                   /db_xref="GOA:C7QFP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU68983.1"
FT                   /translation="MTDIEIRPATLDDLDGLSHDSAELFAEDGLARDRLRDPDWPRDNN
FT                   RAWCAGLIAAPDALVLVATEEGTVVGHLIGTFSPASSMWTAARAELVSTHVAPSYRGQG
FT                   IGGRMVEDFIAWGKDRGAARLHVSAYTANSAAIRFYQRFGFVPLSIELTLDVD"
FT   gene            complement(29325..29969)
FT                   /locus_tag="Caci_0029"
FT   CDS_pept        complement(29325..29969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0029"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mjl:Mjls_3025 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68984"
FT                   /db_xref="GOA:C7QFP5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACU68984.1"
FT                   /translation="MLATLLPFLIACTAVAAVPGQSTALIIRQSIRGGKRAGFATVLGN
FT                   ESGVFVWGCAAAFGFTALLAASEIAYDGMRVVGACVLVWFAVQSFRSARRMKQDEAAEE
FT                   TDELGGDARTKGPLWSYRAGLLTNLANPKAAIFAMSFLPQFVPAHAPKLPTMVLLAATW
FT                   AVYEVFYYSLYVWCVQRLRAFFSRREVRRRMEQISGTVMLGLAVRMVVENS"
FT   sig_peptide     complement(29895..29969)
FT                   /locus_tag="Caci_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.512 at
FT                   residue 25"
FT   gene            30098..30643
FT                   /locus_tag="Caci_0030"
FT   CDS_pept        30098..30643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0030"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68985"
FT                   /db_xref="GOA:C7QFP6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP6"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU68985.1"
FT                   /translation="MRPEDEDEFRRFTAARWPGLVRTAYLLTGDLGHAEDLAQTTLIKA
FT                   YRSWHRVCRVEDVDAYVRKILINANRSRFRSKRPLEYSVAAVPEYPAWPPDDGSGVEER
FT                   TVLFAALATLPPRQRAIVVLRYWEDLAEGEVAALVGCSVGTVKSQASRALAKLRKDARL
FT                   AGLSAFQEPAAAMKGAQT"
FT   gene            30640..31470
FT                   /locus_tag="Caci_0031"
FT   CDS_pept        30640..31470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0031"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: sgr:SGR_5473 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68986"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP7"
FT                   /inference="similar to AA sequence:KEGG:SGR_5473"
FT                   /protein_id="ACU68986.1"
FT                   /translation="MTDEAWENGLREVMTGAAGSTRVAPPPTDAILRGGRSSLRLRNGL
FT                   TGSGVLGMVAAAVIVGTSFGGGATVGSVQQAGTTSTSAQPPQAQDAAVTLGPASAKTKV
FT                   VVYEDYRCPPCRDVEAGTSAYLTEEADSGKIQVEYRAVNLIDRNGQTSGSGSTAAGNAV
FT                   QCAADRGDFSAYRSAVYAHQPQENLDAFTSSALLITIARTIPGLDTAAFEKCVDDQPYA
FT                   AAISSNYTRAFTTAHCTGVPCISVDGQQWTGSIPEGADVGKIINAWLAQKISAA"
FT   gene            31496..32140
FT                   /locus_tag="Caci_0032"
FT   CDS_pept        31496..32140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0032"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rpc:RPC_2940 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68987"
FT                   /db_xref="GOA:C7QFP8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU68987.1"
FT                   /translation="MTTDPKAIIESGYDAVAEEYLSTFGEGVPDDPRVRFIGALGEHLA
FT                   DGARVLELGCGAGIPATALLAQRFDVLGVDISAGQLALAAQRVPTAEFRKADMTSLDLP
FT                   AGSFDAVTAFYSFNHIPRAEQQPLLTAIARWLRPGGLLLASFGRGGSADDVELWLGGVP
FT                   MFFASHDPATNTRHLADAGFTPLVDELVSMETGRGSETWQWVLARSGERRR"
FT   gene            complement(32572..32655)
FT                   /locus_tag="Caci_R0002"
FT                   /note="tRNA-Leu7"
FT   tRNA            complement(32572..32655)
FT                   /locus_tag="Caci_R0002"
FT                   /product="tRNA-Leu"
FT   gene            33113..34141
FT                   /locus_tag="Caci_0033"
FT   CDS_pept        33113..34141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0033"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sco:SCO3843 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68988"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68988.1"
FT                   /translation="MGVLQRFERRIEGLVNGAFAKAFKSEVQPVEIASALQRECDDRAA
FT                   IVSQGRTMVPNDFTVELGGVDYERLATYAGPLGAELAELVREYGAEQRYMFVGPVEVKF
FT                   ARAADLDTGMFRIQSQALAGVVPVSSMQGEPQGYDPYGQPPPYQGGPQGGPQGPGGPQG
FT                   PGGPQGPGGLQPVPPPNPVPQPAPWGSPPPPQGQGGPQPGWGAPPPGQGGYDQGGYDPY
FT                   GQPPPQQPGWGPPGQQQQQQQYAPPPQSQTQCWVEINGARHMLTKPVTTMGRGTDVDLR
FT                   VDDPSVSRRHAEIRIGTPSYVSDLGSTNGIVVDNQHVTQAPLRDGSVIHLGTTTIIFRQ
FT                   QG"
FT   gene            34163..34690
FT                   /locus_tag="Caci_0034"
FT   CDS_pept        34163..34690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0034"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sgr:SGR_3729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68989"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68989.1"
FT                   /translation="MSQLTLTVIRLAFLVLLWLFVFSAVGVMRSDLYGSRTSKRQQAKA
FT                   AKAAAAATQQVPARGGARQQPYNPGARRSGPPAPTRLVVVGGSLAGTTVNITSGQQVTM
FT                   GRAHDSTIVLDDDYASSRHARLYPDASGQWIVEDLGSTNGTFLGQTKLNAPTVAQIGVP
FT                   IRIGKTVLELRA"
FT   sig_peptide     34163..34243
FT                   /locus_tag="Caci_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.741 at
FT                   residue 27"
FT   gene            34710..36773
FT                   /locus_tag="Caci_0035"
FT   CDS_pept        34710..36773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0035"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: sgr:SGR_3728 putative
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68990"
FT                   /db_xref="GOA:C7QFQ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU68990.1"
FT                   /translation="MALVLRYAIRSHVGLIREGNEDSGYAGPRLLAIADGMGGAAAGEL
FT                   ASAVVMTTVSRLDSPGGEDLLSGTGEMPVMAPGGAGPGQGQPAPGAPGGGPGGQGGPGG
FT                   VPENEQTLHISQHDMAARESGNAHSPADPAFGEPDLALLGGAVVAANERLRAIVAERPE
FT                   LEGMGTTLTAMLWSGGRFGMVHVGDSRAYRLRDGLLEQMTADHTWVQRLIDEGRITEEE
FT                   AGHHPQRSLLMRVLDGRTQVEADIGTFDAYPGDRYLLCSDGLSGFVSQETLAETLAAYA
FT                   DPQQAVDALIELALRAGGPDNITCIVADTLDDGTIPGASPNESTQMLGSLTPVVVGAAS
FT                   EGVEQLPRFSTQGSGGPGPGPQQDDFPQNHPAGRAARLRSRRNQNQNSQNQNAQNQQLA
FT                   AEQHPGGPVTTAQQQFDPSAQTTELDSVPGQRGLVPGAENQQPGSRRNADGGYGGAPDG
FT                   GPGGPGGPAPAKRGKKGLIITGAVVVVLAAAAGGAYVYSQGQYYVTPSTDSKQVLLYQG
FT                   LSQVSFASSQQTMSEGPLWIASVPQSKRADLFKTESFGSKGAALSYLEQYRSAAKSCAD
FT                   YRHNQLVVQSHPQQSAVTGKTAGTTVPGQNLAPSAPPTSSKAGAPLANGPANTVQNPTA
FT                   PTGDPAGTTAPTGGEQGSPEPQNPTSSPSAPASQPGDDPQMKAYCAGTTDGP"
FT   gene            36782..38761
FT                   /locus_tag="Caci_0036"
FT   CDS_pept        36782..38761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0036"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: sgr:SGR_3727
FT                   FtsW/RodA/SpoVE family cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68991"
FT                   /db_xref="GOA:C7QFQ2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU68991.1"
FT                   /translation="MSAAPPRPEEPLIPKRRNTELLLSLFAVAVAMFAYANVGLADNGK
FT                   LPAGMWGVGAGLVVVVLVANGLTRYAAPYADPLFLPLTIFLNGIGLVLIHRLDIYDTEH
FT                   FQALHKLNPVKYHTPPTGSTTNQLMYTALGIIVMAGFLLFIKDHKVLQRYAYISMVSGL
FT                   FLVALPAMLPASMSSRNGAKSWVFLPGGVSIQPAEFGKLLLVSFFAAFLMAKRDALRVA
FT                   SRRVLGLNIPRGRDMGPIAVCWVLAMLILVFETDLGVSLMFFGAFVVLLYIATERTSWL
FT                   VFGVTAFIGGAVFIATTVPHVQARVNNWLHPFTGEICARTAAPGTNCPSDQISQSIYGF
FT                   ATGGIFGKGLDQGRPWLVGFAKNADFILVTVGEELGMVGLFALMMVYTLFVMRGFKTAL
FT                   LIRDNYGKLLAAGLSVTFALQVFITAGGVMRVIPLTGLPMPFLAAGGSALVANWVVVAL
FT                   LIRLSDSARRPLPPAIPLTDDELRAMRLAAAQKMPSNAAPARHAQPAAQTPAGGPPRPH
FT                   PLAQPGLGQTGLAQSGLDQTGLDTPSGSEEPAPPGASDPTEPMPVRRVAAAGAGADDVT
FT                   QAVPSQPRGYGEQTMLRAAEATQAMQATSGPRAEPEQGATESYTPAFEDEDDDDVRTRP
FT                   TPAPGANPGEVPGRPGPTERRYGP"
FT   sig_peptide     36782..36892
FT                   /locus_tag="Caci_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.910 at
FT                   residue 37"
FT   gene            38758..40230
FT                   /locus_tag="Caci_0037"
FT   CDS_pept        38758..40230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0037"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sma:SAV_4339 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68992"
FT                   /db_xref="GOA:C7QFQ3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU68992.1"
FT                   /translation="MNQPIRRVAIFCFLLIASLLVSSNYLQVVNADSYKARAGNQRTEL
FT                   DYYAYPRGKILTADGTVIADSVPSGGLQYKYQRTYPLKADYANITGWKSIVYGSRDIEN
FT                   VLDKYLQGTDSSESVANFMDTLTGKSKKGGDVQLTLQNAVQQAAIKGLGKQNGSVVALD
FT                   PTTGAILAMYSSPSFDPNGIASNVSETSTAAGNALEADKGKPNLNHAIGENYPPGSVFK
FT                   IVTAAAALDSGKFTETGSTGADPNFYSNGSGYKLKNEDGTCSGTDLKTALAESCNSVYG
FT                   FVGATLGSQIMSTYASKFGFNDPSLKIPLQVAQSNFPSPATVGTNVLGLAQDSIGQGDT
FT                   QVTPLQAAMIAAAVANGGTIMQPYMVDKETAPNGHVTYKGSDHQHELSQAMSPATAATL
FT                   DDMMQNVVTHGTAQGRGIPGVQMGAKTGTAQRASGQNPLAWFVCYGTANGKKVAVAVMV
FT                   DTNDPSIRSDVSGVNFAGPTAQAVLKAALGVG"
FT   sig_peptide     38758..38844
FT                   /locus_tag="Caci_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.354 at
FT                   residue 29"
FT   gene            40430..42532
FT                   /locus_tag="Caci_0038"
FT   CDS_pept        40430..42532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0038"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: sgr:SGR_3725
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68993"
FT                   /db_xref="GOA:C7QFQ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU68993.1"
FT                   /translation="MSGTYPGAEQPRRLGGRYELGAVLGRGGMAEVFMARDTRLGRTVA
FT                   VKTLRADLSRDPTFQARFRREAQSAASLNHPAIVAIYDTGEDFENGVSVPYIVMEYADG
FT                   STLRDLLHSGRRLLPERALEITAGVLQALDYSHRNGIIHRDIKPANIMLTRSGTVKVMD
FT                   FGIARAMADNGMTMTQTAAVIGTAQYLSPEQAKGETVDARSDLYSTGCLMFELLTGRPP
FT                   FVGDSPVAVAYQHVREEPQPPSSYDPEVSPAIDAVVLKSLAKTADARYQSATEMRADIE
FT                   RVLDGRPTEAQTAVLGAANMPTQRLDPRQVGAAAAVGQTRAMPAVDTPTGYQSPAPRYE
FT                   EGLDGPGGRPPGPPRRAEPRRAPEPEKSGRTGYIILAIAGIAAVIAAILLAKSLLKSGG
FT                   NASSKAAPDFGIGVKTFPQAQQMLAQPDYTGFSLTGSGKDCPPGTDVHSGNAGTIIAQS
FT                   PAAGAYGKPGPITYCLSLGPQNGKVPPKATLNGMNQDQLKAYLGGAHFDLANPLITSQP
FT                   DPKVLAGNIIDVIDAGNNNAVLDGQQVPDVSKVQIGWIVSAGPSKIPLSTQGYIGQPYN
FT                   SVVSQIQGLGFTNVKPVVDNPGGNLPAGSVTRISPGDNSYTADTPIVVYYAPQPVAPTT
FT                   PTSSQSQGCDPNQDPTCQQNPTSTASGPGNGQTSSNPMLCVVDPNAPGCPNAPTTSKKG
FT                   GGGGGN"
FT   gene            complement(42621..43256)
FT                   /locus_tag="Caci_0039"
FT   CDS_pept        complement(42621..43256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0039"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   sgr:SGR_3722 putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68994"
FT                   /db_xref="GOA:C7QFQ5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU68994.1"
FT                   /translation="MAARILVVDNYDSFVYNLVQYLYQLGAECEVVRNDAIGVEAAHDY
FT                   DGVLLSPGPGTPEEAGVCVAMTGYAEQHRIPVFGVCLGLQSIAVAHGAVVGRAPELLHG
FT                   KTSKVTHDGAGVFQGLPDPFTATRYHSLAIEPETLPQDLLVTARTDSGVIMGIRHRELP
FT                   VEAVQFHPESVLTEGGHRMLANWLTVCGDAGAVERSAGLAPVVLSAAN"
FT   gene            complement(43286..43444)
FT                   /locus_tag="Caci_0040"
FT   CDS_pept        complement(43286..43444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68995"
FT                   /db_xref="GOA:C7QFQ6"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ6"
FT                   /inference="similar to AA sequence:KEGG:SCO3852"
FT                   /protein_id="ACU68995.1"
FT                   /translation="MYAFVWRHLPGPVSVKILIALAIAALIVVLLFGWVFPWIEPLMPF
FT                   SGNTVSQ"
FT   gene            complement(43506..44222)
FT                   /locus_tag="Caci_0041"
FT   CDS_pept        complement(43506..44222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0041"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: kra:Krad_0027 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68996"
FT                   /db_xref="GOA:C7QFQ7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ7"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU68996.1"
FT                   /translation="MWAESARTAIRSVGEILITLGLVLFLFCAYQLFYTNVVADEAMKS
FT                   EVSDLHKLWDAPVARAAAPRAANAFDTADSHGTAGAAFAILHIPRLGDKSIPVLQGTTL
FT                   DLLGRGVGHYKDSAMPGRTGNFAVAGHRKTHGEPFRYLDEMRDGDLIVVETADSWYTYR
FT                   EDRDPFIVDPTDLGVVAPVPDHPGATPSRKLITLTTCNPWWASTQRMIVTGELIAQQPR
FT                   SAGEPPAMTVNAPKFQ"
FT   gene            complement(44241..45053)
FT                   /locus_tag="Caci_0042"
FT   CDS_pept        complement(44241..45053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0042"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   sgr:SGR_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68997"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ8"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACU68997.1"
FT                   /translation="MASGRDQLDEPESADGPEPAGGPAPRPRSRVAWHTGVVLVFALAG
FT                   ALFLTARDTADGQGDIRPDRGAQLSDVIRAQNTHNQQLTEQVAGQRADQDALTRGQSAD
FT                   ARVKAVQDQVDALAAPVALTPVSGSALAVTLNDAPPNAQPAAGAPTAQPDWLIIHQQDV
FT                   QAVVNALWAGGATGIQLMDQRLAPTSAVRCVGNTLLLQGRVYSPPYVITAVGDTAKLRS
FT                   SLLAAPAVQTYLEYVSAYGLGWDVKARDRVTLPGYTGPLDVSFASVAP"
FT   gene            45132..45386
FT                   /locus_tag="Caci_0043"
FT   CDS_pept        45132..45386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0043"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sma:SAV_4331 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68998"
FT                   /db_xref="GOA:C7QFQ9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU68998.1"
FT                   /translation="MPESKVRKKAAYTPPPDKKQPIKLDTGNRVVLPLMVGCFVLGLLW
FT                   IVIYYLSNMTYPVSALHGWNMAVGFGLIITGFIASMRWK"
FT   gene            complement(45480..46550)
FT                   /locus_tag="Caci_0044"
FT   CDS_pept        complement(45480..46550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0044"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ace:Acel_0013
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68999"
FT                   /db_xref="GOA:C7QFR0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU68999.1"
FT                   /translation="MPPGSPGSPSVPATELPACYRHPGREAQIRCTRCDRRICPECMVP
FT                   ASVGFQCPECVRGGNQEVRKARSPFGAVLRPRVVPVVTYSLIALNFVMFGLQHIVGTSQ
FT                   VGAAGGGVFQVNTLDMRLELIAKGTWVDGQPIGVANGEWYRLVTSMFLHANLIHIASNM
FT                   ISLFFIGPMLEAMLGRLRFVLVYLIGGLAGAVTSYWFMTPLSPASLGASGAISAVFGCL
FT                   VVIGLRRKILDPGMIAVVLVINIVIPLQNTNIDWRDHVGGVVAGALIGAVYAFAPELIG
FT                   ALGKARAPREQQVRLLNWLGFGTMALVLALAIGGTAVHTAHLNDPANRTRTVDGAVYSP
FT                   GPTRVVTDVPTSYPQA"
FT   gene            complement(46660..47241)
FT                   /locus_tag="Caci_0045"
FT   CDS_pept        complement(46660..47241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0045"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: krh:KRH_00110 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69000"
FT                   /db_xref="GOA:C7QFR1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU69000.1"
FT                   /translation="MTETERQQTVAENLYATIKTNHGDIVVRLLPDYAPKTVANFVGLA
FT                   EGTREWTHPETNVTSTTPLYDGTIFHRIIPQFMIQGGDPLGQGFGGPGYVFDDEPHPDQ
FT                   TFNDRDYLLAMANAGIRNGKGTNGSQFFITVPTPRRPTHLNGKHTIFGEVVDADSRKVV
FT                   DEIAGVRTGAQDRPVNDVVIEKISIERREG"
FT   gene            47443..48078
FT                   /locus_tag="Caci_0046"
FT   CDS_pept        47443..48078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG31952"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69001"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69001.1"
FT                   /translation="MPFSHDEPASRVERVRCAVRDRTSGAAHTVSGAAGTAQSAAVTAA
FT                   GVAQGTAHQVADRATVVGQQVADRATVVAHQVADRTTVAAAAMADRARPVAAEAASRGG
FT                   AAWQVIRYGAPQPSPLARMATVIPLATVTTAARRSRAPLALMAIGAACAVGILWWRRSR
FT                   TGPDSVWILDSDSDVEPVGRWQERDNRADADDSGMDTSRRDSPANRWP"
FT   gene            complement(48321..49223)
FT                   /locus_tag="Caci_0047"
FT   CDS_pept        complement(48321..49223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3551 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69002"
FT                   /db_xref="GOA:C7QFR3"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69002.1"
FT                   /translation="MPPPNPARDRGSATIYAALLTGLLTTLTGAILALGTAILARHRAG
FT                   SAADLAALSAATHATPGQIPCDWARRVTTAHHTRLLHCTCNGPTCLVTTAINTPWGAAT
FT                   VTSRAGPADDPTGETTAGQNALRAEGTRLAEAAMGLRAAALSDPVGERIAGIERTRLGE
FT                   ATGGSLRTAAMTSRTHDPVGERTVEVERSSRAKPQATAPRAANLVGRTGLTHGLVGPSL
FT                   VGIERSTYAEAYPFGKRASGIAARLTTPAVASRPRPSPHRAPVVPAAPLVGVRLAVAES
FT                   EPLAGSSAASCCQLGAALP"
FT   gene            complement(49198..49590)
FT                   /locus_tag="Caci_0048"
FT   CDS_pept        complement(49198..49590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR4"
FT                   /inference="similar to AA sequence:KEGG:SGR_3310"
FT                   /protein_id="ACU69003.1"
FT                   /translation="MRRRRPRDAGYATVEAALAIPSLVLFTVALAGILTGLATQIRCVD
FT                   AARLGARAAARGEPAAQIQGAVTQAAPGSSIHITTENGLIHVSVAAPVAAMPLLRAFTV
FT                   HAEAYEADEATLEGGEEPHAAAEPRP"
FT   sig_peptide     complement(49495..49590)
FT                   /locus_tag="Caci_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.890 at
FT                   residue 32"
FT   gene            complement(49590..49766)
FT                   /locus_tag="Caci_0049"
FT   CDS_pept        complement(49590..49766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69004"
FT                   /db_xref="GOA:C7QFR5"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR5"
FT                   /inference="similar to AA sequence:KEGG:Acel_1979"
FT                   /protein_id="ACU69004.1"
FT                   /translation="MERARRRLRRDDGMSTVEYTLGTLAACAFAVILYKVITSPMVQEA
FT                   LSGVLRKALNTAF"
FT   gene            complement(49782..50486)
FT                   /locus_tag="Caci_0050"
FT   CDS_pept        complement(49782..50486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0050"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sgr:SGR_3318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69005"
FT                   /db_xref="GOA:C7QFR6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR6"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU69005.1"
FT                   /translation="MSVLGVAFTGVVAGVSAGLSVLCWPPRQQGHPARRLAFLATRNTT
FT                   ADHTRSRPWSAFLKRLRNNPWSTARHQRQHSEATARISPVAADLLAACLASGADPLRAA
FT                   EVVAYCLRPPGRLGTLGERAAAEMADRFQEVAHLLRLGGNPITTWRVVAAEPGLRPVAE
FT                   AIGRAGLSGAPPVASIRACATDLRKERHAASTAAARRAGVRGVAPLAGCFLPAFVLIGV
FT                   TPIVLGLAHHLL"
FT   gene            complement(50483..51295)
FT                   /locus_tag="Caci_0051"
FT   CDS_pept        complement(50483..51295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0051"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69006"
FT                   /db_xref="GOA:C7QFR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR7"
FT                   /inference="similar to AA sequence:KEGG:SCO3555"
FT                   /protein_id="ACU69006.1"
FT                   /translation="MNSALAGLLAASAVLAFPGPGARRRLETAVLGAPRGPKWRLRMAG
FT                   AWPTVLSAIALGVLSALLARSMVLAFLVPFGAWRAYRAWTAHTARLAVERRQTEIIELC
FT                   VTICSELHAGREAREALRDAAVGACPDLAVHLVGPLGTGDDVVTVLRTAAGTPGREALA
FT                   ALAACWQVAEGGAGMTAAIGELSDGLRAERAQRRELDAELAGIRTSARLLAMLPVVGLI
FT                   IGSGMGLSPIPMLLHTGVGETCLVLGIAFVLGGVMWMDRIARSAEALS"
FT   sig_peptide     complement(51245..51295)
FT                   /locus_tag="Caci_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.989 at
FT                   residue 17"
FT   gene            complement(51292..52770)
FT                   /locus_tag="Caci_0052"
FT   CDS_pept        complement(51292..52770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0052"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sco:SCO3556 secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69007"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU69007.1"
FT                   /translation="MNALSSSPMSMPSPMSSPSPMSSPSPLSPVPLPGAERLRLNAALV
FT                   DRVRTRLATPPVRVDMQAILAALRAEGCMLDGRDLRAAAYQVRSELTGAGVLDRYLADP
FT                   EVTDVLVNAPDSVWIERAGTLSRADVRFPDEAAVRRLAQRLAAHAGRRLDDAAPCVDGI
FT                   LPDGARLHAVLPPIAARGTLISLRVPPRRAFTVDQLTAGGLTTEHGARLLRAVASEKVS
FT                   YLVTGGTGSGKTTLLGALLGLVPGDERIVITEECTEVVVDHPHVARLQCRIANQENRGA
FT                   VNLRTLVRQALRMRPDRVVVGEVRGPEVLELLAAMNTGHDGCAATMHANGVEDVVARVE
FT                   ALAAPAGMERSALHAQLNSAVQVVVHLVRDKGKRRLASIGVIDRGFGETEVLPAVDFDD
FT                   TGKATYGPGSDRLSFLLGFEVRESTDEAPKAKPPPPRLPVDDLEKLAGWEEALAVADRL
FT                   LPVLKNAANGGDSHVDEPFVADYGPSPTRRGGHR"
FT   gene            complement(52767..54476)
FT                   /locus_tag="Caci_0053"
FT   CDS_pept        complement(52767..54476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0129 putative septum site determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69008"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69008.1"
FT                   /translation="MRDLTQHPVPGRPGRPRRPDPAPPPGRGPAPAAAPLAVTADPALA
FT                   DALLRVAAEAGVRIEIVPGPSAARHRWSAAPLVLIGVDQTGEVARAGLPHRPDVALIGR
FT                   DLDDASVWQRGSAVGAAHVLILPDCERWLAGMLAEADSPREEPGAVVAVLSGRGGAGGS
FT                   TLAAALALAGVRRGLRSTLVDLDPAGGGIDLLFGLETEPGPRWSELAQWRDGRLSGRSL
FT                   RDALPTYAAHSRHGLAAGLGLAEEGADRLPVLAWPRARPGEDDGPGWLGARPTVAEDPW
FT                   YDSGAPADPGKADPWLPQDSAPSGGDIAAGSANPLYGAGSPDIAEDLWSGGGSSRRQET
FT                   VGPRTGGGRFNADGSSAESLSRTRLIALENSDSEVSTEVDDGSRDRDRVADAARATARP
FT                   QHGLPILTYPHTRADLPLPAVAAEPVRAVLTALAQAGDLVVVDLPRSLDEAATEALALA
FT                   NVTLMLVPAEVRASAAASQLAAAVRLVSPDLRVVVRLPAPGGLEPLDITDVMGGLPLAG
FT                   VIGADRRLSAAAEHGEPPGSSARGTVSAFCRTFLDDLFGVASGRRSESRAAA"
FT   gene            55176..56021
FT                   /locus_tag="Caci_0054"
FT   CDS_pept        55176..56021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0054"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_4604 morphological
FT                   differentiation- associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69009"
FT                   /db_xref="GOA:C7QFS0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS0"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU69009.1"
FT                   /translation="MDEHADARADGAGRPAAFFDLDKTIIAKSSTLAFGRSFYNGGLIN
FT                   RRTVLRTAYAQFVYLAGGADHDQMERMRQFLSAMATGWDVEQVKEIVAETLHDLIDPLI
FT                   YSEAAALIAEHKAAGRDVVIVSTSGSEVVEPIAEMLGADLAIGTRMAVGEDGKYSGEIE
FT                   FYAYAENKAKAIVELAAERGYDLTRSFAYSDSATDVPMLESVGHPYAVNPDRTLRKEAT
FT                   AREWPILVFDKPVALRSRVGELAAKPAVSGTALGLALATAGTIWWLGTRGRRRRGSGLL
FT                   "
FT   gene            complement(56106..57116)
FT                   /locus_tag="Caci_0055"
FT   CDS_pept        complement(56106..57116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0055"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: sma:SAV_4367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69010"
FT                   /db_xref="GOA:C7QFS1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69010.1"
FT                   /translation="MLPRAVPGPLRAVLKRVLLALGILVLSAVIVYLGRDGYRDSSGKP
FT                   IGWLTSFYYATVTLSTTGYGDVVPVSDSARLISTLFVTPLRVLFLLVLVGTTLEVLTER
FT                   TRNEWRQERWRSKVRDHTVVVGYGTKGSSAVQTLLKHGTTPESIVVVDTDPARIAEANR
FT                   RGLVGIVGDGSRSEVLERAEISKARHVVISAERDDTAVLTTLTVRRLTRRATVVASVRE
FT                   AENAPLLRESGASSVVTSSDTAGQLLGMATISPKVSQVVHDLLSHGEGLELLERPADTG
FT                   DVDKDPRALKEPVLAVIRGSRTMRFDDVAIGTIQLTDRLVVVRSVHNRRTDPGRR"
FT   gene            complement(57158..58456)
FT                   /locus_tag="Caci_0056"
FT   CDS_pept        complement(57158..58456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0056"
FT                   /product="MoeA domain protein domain I and II"
FT                   /note="PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: sco:SCO3827 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69011"
FT                   /db_xref="GOA:C7QH72"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH72"
FT                   /inference="protein motif:PFAM:PF03453"
FT                   /protein_id="ACU69011.1"
FT                   /translation="MSTSWAEARKIAGAAAIPLPVTRVPLAQARGTVLAESLSALVDLP
FT                   PFATSAMDGWAVAGPGPWRVTGRVLAGQEATRLGDGEAVEIATGARMPSGAEAVLRRER
FT                   GYVDAHSRLHVGEKGDDQDGPNHGASAAATTAAAPQRFYAAVTSGTTATRTPRGAELGL
FT                   PIGADIRPQGQESRRGETLLSAGTRVTPAVLGLAAAAGYDDLPVHERPRVALVVIGDEL
FT                   AGSGLPDGARIRDALGPMFTAWLDALGVEVTVSRVADDPRELLAVVASSPADLVITTGG
FT                   TARGPVDHVHRVLAELGARLLIDGVSVRPGHPMLLAQYGGTRQHRRFVAGLPGNPLAAV
FT                   AGFVTVVRPLLRRLAGLADTSHFLPLGDAVPTHPTDTRLVPVSVTEASAVPLRFTGPAM
FT                   LRGLALADGLAVVPPGGGVVALGAGQRVEVLTV"
FT   gene            complement(58453..59514)
FT                   /locus_tag="Caci_0057"
FT   CDS_pept        complement(58453..59514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0057"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV_4365 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69012"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH73"
FT                   /inference="similar to AA sequence:KEGG:SAV_4365"
FT                   /protein_id="ACU69012.1"
FT                   /translation="MDRLSGPGEPFDVIVLAGGGARRLGGTDKPALEIGGVSLLDRVLA
FT                   ACEGAASVAVVGPPRPVARQVVFTREFPPGGGPVPALAAGMTVGSAELVAVFAADMPLL
FT                   DEEAVTVLRRSLTADAVFFTDERGKDQPLAAIYRRNTLAAALDALPELRGARLFSVVEG
FT                   LDATRIPDTRGVTADCDTWEAVHAARALIATRPAAKAKMGDMDDKKLLADWCAAAAAEL
FT                   GLTGHELAESDLDAILGLAGVAAHNVLRPAAPLTTFLAGYAVGLRSSAGGGRGALDGPI
FT                   AKLSALAQAWDPAADGPAGTGHGGAASGTVGGSVAASPTAVRDATTGAAASAKSSSGTS
FT                   GDRAADAAGSGGQ"
FT   gene            59678..60886
FT                   /locus_tag="Caci_0058"
FT   CDS_pept        59678..60886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0058"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sgr:SGR_6775 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69013"
FT                   /db_xref="GOA:C7QH74"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH74"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69013.1"
FT                   /translation="MQPPEHLAYTPAQRALRAELRTYFAALVTEEVHRDLRLPDTATDT
FT                   ARTLHRKLGADGWLGVGWPQEYGGRGLTPVEQFIFFDEAARAGCPMPLVALNTVGPTLM
FT                   RFGTQEQKDLLLPGILAGEIDVAAGYSEPGAGTDLASLTTRAVLTEDGSAYAVNGQKIF
FT                   TTHGDSAEYVWLACRTDPDAPKHKGISILLVDTKDPGFEATKIHTIASHYTTATYYRDV
FT                   RVPVTMRVGAENAGWKLITTQLNHERVALAAVAQGVIRSFAKVQSWAMETPAADGKRVI
FT                   DLPWVKTTMARAYIRISGLRLLNGQMVAALQKDQTGGHLSPADASAAKVHGTETHIEAL
FT                   AELIQVLGAGGILKTGSPGALLAGDLEYLYRWAVTNTFGGGANEIQREIIAMTGLAMPR
FT                   VRR"
FT   gene            60895..61416
FT                   /locus_tag="Caci_0059"
FT   CDS_pept        60895..61416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69014"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH75"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_5992"
FT                   /protein_id="ACU69014.1"
FT                   /translation="METDPLYETVSAHIADPPSEPVPAWDPVNQPMIRHWCDAMGDDLP
FT                   IYTDAAAARAAGHPDVVAPPASLQAWTMPGLRMRGFEDGTTRAQAMLVEAGYRAVVATD
FT                   CEQTYHRYLTIGDHLYATSRLDSVSPRKKTALGEGYFLTSVTEYRDQRGELLGEMLFRT
FT                   LWFKPKEPAA"
FT   gene            61413..61823
FT                   /locus_tag="Caci_0060"
FT   CDS_pept        61413..61823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0060"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mpa:MAP2587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69015"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH76"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACU69015.1"
FT                   /translation="MTRPLPVTGRDNAYYWEGVAKGDVLIQKCTACGSLRHPPSPMCPD
FT                   CQSLDWTTVKATGHAVLHSYTICHHPLPPWEEGPYAVVLIDLDMEDSDARPRIVCGTRG
FT                   IANEDLRIEMPLSLVFEDGLVFAGPAQEGGAP"
FT   gene            61829..62908
FT                   /locus_tag="Caci_0061"
FT   CDS_pept        61829..62908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0061"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: sgr:SGR_3736
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69016"
FT                   /db_xref="GOA:C7QH77"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH77"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69016.1"
FT                   /translation="MDQPVDDALEAIGELSSEVFKDLDIETTRSPAYSNEAVSDEHDRR
FT                   LWRILADTGLLAAVLPASVGGGGTGLPGMVRLLSDAGAALARLPLVETFVAVSVIDEKH
FT                   LPAVLSGELVITAALAEHPSTITAPLRLTGQRLNGITQLVPYPLSSDLVLVPALREDDT
FT                   EVLALVSLSTARVGDQVTTTGEPLGVLEFIDAEVMELCDAVGEARALAALFSSATLCGI
FT                   AARALAMTAEYVGGRVQFGHPLATFQGVALSAADRYIDSRAMQAALWDAVYAIAENGIS
FT                   SPRARYAIATARVWAADGARRVVGSAQHLHGGFGVDVTYPLHRYHAWARYWELYGGSAE
FT                   AWSGDLGELIAAHPIEEDQ"
FT   gene            62905..63306
FT                   /locus_tag="Caci_0062"
FT   CDS_pept        62905..63306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0062"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rha:RHA1_ro05828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69017"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH78"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACU69017.1"
FT                   /translation="MSALPKVGEALPELIIPITPTRIVSGAIASRDYQDVHHDVPAARE
FT                   KGSPDIFMNILTTNGLVGRYVTDWAGAEARILKIAIRLGVPNYPGDTMTLTGSVASVGE
FT                   DGAVEVAIRGANQLGNHVTGTVTLKGLGE"
FT   gene            63309..64481
FT                   /locus_tag="Caci_0063"
FT   CDS_pept        63309..64481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0063"
FT                   /product="lipid-transfer protein"
FT                   /note="KEGG: nfa:nfa4530 lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69018"
FT                   /db_xref="GOA:C7QH79"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH79"
FT                   /inference="similar to AA sequence:KEGG:nfa4530"
FT                   /protein_id="ACU69018.1"
FT                   /translation="MSLAGEAAIVGIGATEFSKESGRSELQLCLEACKAALDDAGIAPR
FT                   DVDGLVTFSMDSSPSIMVGRGLGVAELRHFSLVDYGGGAACATVAHAAAAITAGLADVV
FT                   VCYRAFNERSGRRFGSGDAAIQARGESPMAQHFGYYSPYGLITPAAWVAMAARRYMHKY
FT                   GATSEDFGRVAVAARTHAATNPAAWFYERPITLADHQSSKLIADPVRLLDCCQESDGGV
FT                   ALVVVSAERARDLPGKEVLIAGAAQGSAHDQQMMTSYYREDISGLPEMGTVARQLWNQS
FT                   GLGPDDIQTAVIYDHFTPFVLTQLEEFGFCGRGEARDFIRDGAIHIGGRLPLNTHGGQL
FT                   GEAYIHGMNGIAEAVRQARGTAVNQVPDVHNVLVTAGTGVPTSGLVLSAV"
FT   gene            64495..65247
FT                   /locus_tag="Caci_0064"
FT   CDS_pept        64495..65247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0064"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_7535 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69019"
FT                   /db_xref="GOA:C7QH80"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH80"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACU69019.1"
FT                   /translation="MSGDADPTGLSSTAATARNPVFRWASERSVNLGAMPRLALFDLDD
FT                   TLISSKGAFIAWTEELVAAHSSPADVRWFIDNEHIFWTGSPDDAFRGLVEHFGLAADPA
FT                   ELLADYQFRMVDLLKPFDGVLDGLEALRDAGWRIGIVTNGFGDFQNAKIDAVGLRAYVD
FT                   VVCISDVEGSWKPESKIFQLASERAGAPLEGGWMVGDSLSSDIAGGNGVGLHTAWIRHG
FT                   RTLGSMDPQPEQVVETTTEAFQLILSRP"
FT   gene            65385..66143
FT                   /locus_tag="Caci_0065"
FT   CDS_pept        65385..66143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0065"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; SMART: regulatory protein MerR;
FT                   KEGG: sgr:SGR_941 MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69020"
FT                   /db_xref="GOA:C7QH81"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH81"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACU69020.1"
FT                   /translation="MSWSIAQVARMSGVTARTLRHYDDIGLLKPDHVGANGYRYYEEAQ
FT                   LLRLQQILVLRELGLGLSEIAEAIDSEPDTIVALRRQYGRLLVERDRLSRVAETVRRTI
FT                   AELEGKPQMSVHINRPENLFEGFEESQYEDEARERWPEEFEQAQAKRATMTEEDLERWQ
FT                   REATAAMIRMAEFMAAGTPVDDPAVQDEVHQHYQGICIWWTPNRSAYKCVGQMYVDDER
FT                   FKANYLKIAEGLAEYQAAAMAAYADARLTD"
FT   gene            complement(66209..67510)
FT                   /locus_tag="Caci_0066"
FT   CDS_pept        complement(66209..67510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0066"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   sgr:SGR_3327 putative sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69021"
FT                   /db_xref="GOA:C7QH82"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH82"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU69021.1"
FT                   /translation="MTPPDRPASPSRVFARLKRIERRHVAAVLRTETVGGALLIAFALL
FT                   GLLWANSPWRASYDTVKNTVVGPHLWHLDLSLADWAADFLLAFFFLVAGIELKHELQAG
FT                   ELSNPRAAALPVVSALCGMIVPIGVYLAVSAGHTNAGEGWAVPTATDIAFALAVLAVVG
FT                   QNLPSALRAFLLTLAVVDDLGAIIIIAIAYTDSIDTGALVIAAVLLLAFYVVQRMRITS
FT                   LWLNVPLGLAIWIAVHASGVHATVAGVAIGLMLRGRRHGDSDEDHDDELQSPAEKVQWR
FT                   LQPFSAGFCVPVFAIMSAGVYVGGKTLGSLVSDQIPLAIAAGLFIGKAVGVFGGAYLTA
FT                   RFTRAELSDELQWRDIAAVSALTGVGFTVSLLIAELGFSDSPDVLNLAKGGVLLGSLAS
FT                   ALFAVVLLRRRDRFYDQLCTAEESEDSELVLGRE"
FT   gene            complement(67729..69684)
FT                   /locus_tag="Caci_0067"
FT   CDS_pept        complement(67729..69684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0067"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: sgr:SGR_3326 putative
FT                   acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69022"
FT                   /db_xref="GOA:C7QH83"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH83"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU69022.1"
FT                   /translation="MSNEALSNLLREDRRFAPSAAFAADANVKADAYAAAEADRLAFWD
FT                   TQASRLSWDTPWSETLDWSGMPVAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHFEGEP
FT                   GDSRAITYAELKDEVSKAANALTELGVRQGDRVAIYMPMIPETAVAMLACARIGAVHSV
FT                   VFAAFSPDALRARIEDAGAKLLITADGYHRRGGTVNLKANADEAVNGAETIENVLVVKR
FT                   TGADVAWGDKDVWWHDAVGGASTEHTPEAFDSENPLFILYTSGTTGKPKGILHTTGGYL
FT                   TQASYTHHAVFDLKPESDVYWCTADVGWVTGHSYIVYGPLSNGVTEVMYEGTPDTPHQG
FT                   RFWEIIQKYKVSLLYTAPTAIRMFAKWGDDIPAKFDLSSLRLLGSVGEPINPEAWIWYR
FT                   KNIGGDRTPVVDTWWQTETGAIMISPLPGVTEAKPGSAMRPLPGISANVVDKDGNIVGN
FT                   GHGGLLVLDKPWPSMARGIWGDQQRFIDTYWARFAEQGYYFAGDGAKKDEDGDLWLLGR
FT                   VDDIMLVSGHNISTTEVESALVSYPAVAEAAVVGAKDETTGQRIVAFVILRAGQEETEG
FT                   LDAALKAHVSKEIGPIAKPKQIQIVPELPKTRSGKIMRRLLKDVAEDRVVGDTTTLADS
FT                   TVMDLIKAKLPHANED"
FT   gene            complement(70063..70797)
FT                   /locus_tag="Caci_0068"
FT   CDS_pept        complement(70063..70797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0068"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   stp:Strop_4494 LytTr DNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69023"
FT                   /db_xref="GOA:C7QH84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH84"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69023.1"
FT                   /translation="MTIATPTGLRVLVVDDEPPAVAELAYLLSRDPRVSSVRTATDGED
FT                   ALRVLKNSPVDALFLDIRMPGLDGLEIAALLNQFATPPQIVFVTAHEEFALEAFDLHAS
FT                   DYILKPVRAERLAEALRRMTPASAPPRAPEAGPYDVIPVELAGVTRFIPRQEVSYAEAQ
FT                   GDYVRLYTASSSHLVRIPLAVLEEHWSGAGFARTHRRFLVRVDAVSEARWESGHLTVIV
FT                   GGVPIPVARRHTREVRERLSHR"
FT   gene            complement(70820..72022)
FT                   /locus_tag="Caci_0069"
FT   CDS_pept        complement(70820..72022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0069"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: nca:Noca_0358 histidine kinase
FT                   internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69024"
FT                   /db_xref="GOA:C7QH85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH85"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU69024.1"
FT                   /translation="MASNPATVGIVAALVAPAVAVSRAVQRHRLAGTSAERAAYAAMHA
FT                   VALAGPPLRGGLTPDATRRAARHLRPLLGTAALAFNDTERTLTWDGAGQHRHSQDSYEL
FT                   STTALKSGSVSVLGPEEVHCGSDSCMIRHAVVAPIIPPSSIGGIRADGGSTAIGTLSVY
FT                   SSSTSVALVRAVGEVAYWVATQIELAELDRSRTLLMETELRALRAQISPHFIYNSLTAI
FT                   ASFTRTDPQRARELLLEFADFTRYSFRAHGEFTTLAEELRCVDRYLLLERARFGERLQV
FT                   ALRIAPEVLPVEVPFLCVQPIVENAVRHGLEGKPGPGHVTITAEPTRHDYRITVADDGV
FT                   GITPDILRDALAPAEPGTRTSVGLSNVHERLRAVYGTAYGLAIESEPGAGTTVVIRVPK
FT                   K"
FT   sig_peptide     complement(71960..72022)
FT                   /locus_tag="Caci_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.882 at
FT                   residue 21"
FT   gene            72113..72721
FT                   /locus_tag="Caci_0070"
FT   CDS_pept        72113..72721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0070"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nca:Noca_1231
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69025"
FT                   /db_xref="GOA:C7QH86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH86"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69025.1"
FT                   /translation="MNGRAIFLRVSKGEETRRQVLEAAVEVAASTGLASLTIGSLAERA
FT                   GMSKSGLFAHFKSKETLQVQVLEFASEAFVEDVVRPALSAPRGEKRITTLFESWLAVSR
FT                   DGTAECLFVSAAWEYDDQPGPVRDRLVRMHLDFNDSVAQMFRTGIAEGFFAADADPEQF
FT                   AHDLHGIMLIFFQAHRLLGDARAEERARSAFSRLIESNR"
FT   gene            72736..73662
FT                   /locus_tag="Caci_0071"
FT   CDS_pept        72736..73662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_1230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69026"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH87"
FT                   /inference="similar to AA sequence:KEGG:Noca_1230"
FT                   /protein_id="ACU69026.1"
FT                   /translation="MAVSSSSGKKSTTVRAKKALGIGTVRTAFKVLEVVAPGPGARWAE
FT                   RLWLTVPKKPWRPRTPIAVSAGEPFTVTVRRSTVHGTVWGADGPLVYLMHGWGGVAAQL
FT                   DAFVEPLLAAGYRVVSFDAPGHGRSTESFAGPGLATLPEFSEALSSAVDRFGEAHAVIA
FT                   HSFGAAAAVLSVLDGLPVGRLVVVAPVSDPIGFSYEFAKMLGFRERIRTGFLRVLEKRV
FT                   GVSMDRFDIPQRMRDADLTTLPPLLIVHDLGDREVPVASGDRLAALWPGAELDTWTSLG
FT                   HFRILTDPDVVRKVTAFSSVPRTLPVP"
FT   gene            complement(73628..74605)
FT                   /locus_tag="Caci_0072"
FT   CDS_pept        complement(73628..74605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69027"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH88"
FT                   /inference="similar to AA sequence:KEGG:SGR_3324"
FT                   /protein_id="ACU69027.1"
FT                   /translation="MRIALVGKGGSGKTTVSALLIRHLAAGGRPVLAVDADINQHLGGA
FT                   LGLSEEQAAALSPMAAHLPAIKDYLRGENPLISGTEAMVKTTPPGRGSRLLRLEEENAV
FT                   HSLCATRLPGDMENVRLMVTGGFEEKDLGVSCYHSKIGAAELYLNHLVDGPDEYLVMDM
FT                   TAGADAFASGLFTRFDLTCLVVEPTRKSVSVYQQYREYAKEYDVTIRVVGNKVTGPDDV
FT                   AYLREHTGADLVACLSASHYVRAQEQGRDKGFDTLEPANRTALARLQLEVDAVPQDWAK
FT                   FTRQAVHFHLKNAHAWGDRATGVDLGAQVDPDFVMGPEAFAAQS"
FT   gene            74795..75577
FT                   /locus_tag="Caci_0073"
FT   CDS_pept        74795..75577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69028"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH89"
FT                   /inference="similar to AA sequence:KEGG:SAV_4603"
FT                   /protein_id="ACU69028.1"
FT                   /translation="MDTRSPIQRLAAAPNAAEAADTAREAVDRVRRHKVLRSQSARVTA
FT                   ESQLRGARASAALGSLSEAGTDWPLEEVRRRTDLGDEDGSGLLRGALRISGELGTLAPV
FT                   WKRSPIQALSRMHLLAAAGHLDQDRVGRPSGPEAAVTLTTLANELRDPAAAEVPAVVVA
FT                   AAVHAELLVNEPFGWGDGLLARAASRLILADRGLDPQSLAVVEAGHVDVGVEKYLDAAR
FT                   DYATGTEEGLATWLGLYAEAVELGARESLAVCEAIMRG"
FT   gene            complement(75654..76394)
FT                   /locus_tag="Caci_0074"
FT   CDS_pept        complement(75654..76394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0074"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ank:AnaeK_2958 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69029"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH90"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69029.1"
FT                   /translation="MSAQGKFTGKTVYVIGASHGIGEGIAAAFAGGGADVLITGRAKER
FT                   LDAAAERIGHPVRVVQSDATRQEDVDALFAAADTKIDHLVLAVSGGMAGLGPLAELTDE
FT                   ALREGFESKVFAQFRVLKAALPHLAPDASVTFIGAGSSRAAFPGTTALAAANGALDAAV
FT                   RPLAAELAPVRVNAVSPGVIDTAWWHPLGENRDGFMEQQAAATPVGRVGQPQDIAEAVL
FT                   FLAGNGFTTGVVLDVNGGTTLARG"
FT   gene            76491..77075
FT                   /locus_tag="Caci_0075"
FT   CDS_pept        76491..77075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0075"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3321
FT                   2,4-DAPG biosynthesis transcriptional repressor PhlF"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69030"
FT                   /db_xref="GOA:C7QH91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH91"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69030.1"
FT                   /translation="MERPHTGRRRNEAAREAIIDAAIGLLQEVGYEGFTIERLARDAGV
FT                   GKQTVYRWWPSKAAVIAEAVGTRAQHTIPLPDTGTLAADLREFFETTFRQSEDPKVISE
FT                   LKSMMVASIENPESARPFHDFLASRRATLRVLLERGSARAEVAADADLDFLTDLAYGLL
FT                   WYRGLVGHRPLDDDAARKLAGALVAAAAESQ"
FT   gene            77516..78517
FT                   /locus_tag="Caci_0076"
FT   CDS_pept        77516..78517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0076"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO3823 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69031"
FT                   /db_xref="GOA:C7QH92"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH92"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU69031.1"
FT                   /translation="MRAITIAEPGGPEQLVWTEVPDPVVAAGEVLIQVAATAVNRADIL
FT                   QRRGFYTPPPGASSYPGLECSGRVVEVGAGVSGFVPGDEVVALLTGGGYAELVAVPAGQ
FT                   VAPLPKGLSALAAGGLMETVCTVWSNVFMLAGLQAGQTLLVHGGSSGIGTTAIQLAHQL
FT                   GARVIVTAGTAAKLRACRDLGADVGVNYRDEDFVERVAEVTDGQGVDVILDNMGAVYLD
FT                   RNVQALAVDGRLVIIGLQGGVTGEVNLNTLLRKRAGISATTLRARPSEEKARIVAAARD
FT                   AVWPLIEQGRFRVVVDRVLPVDRAAEAHRVVEDSGHVGKVVLDVATVRGSSS"
FT   gene            78533..79129
FT                   /locus_tag="Caci_0077"
FT   CDS_pept        78533..79129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69032"
FT                   /db_xref="GOA:C7QH93"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH93"
FT                   /inference="similar to AA sequence:KEGG:SGR_3755"
FT                   /protein_id="ACU69032.1"
FT                   /translation="MTGLNGDIFGAMNMSLNNDPDADHDGDLAGRVIVVPADAAGARGD
FT                   DESGENPMNVAEMVEQPAKVMRIGSMIKQLLEEVRAAPLDEASRARLREIHRSSIAELE
FT                   KGLAPELVAELERLSLPFAEDEVPSESELRIAQAQLVGWLEGLFHGIQTALFAQQMAAR
FT                   AQLEQIRRALPPGSVPPGMADGEQPGRISGAGPYL"
FT   gene            complement(79104..80204)
FT                   /locus_tag="Caci_0078"
FT   CDS_pept        complement(79104..80204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0078"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sgr:SGR_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69033"
FT                   /db_xref="GOA:C7QH94"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH94"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU69033.1"
FT                   /translation="MPGTSGPLQALFLRFGLPAPTAFRPVDSGLLNRSYQITSADRRYF
FT                   LKHYLPWRGIGSGLPDAYGRRRSAAQTLRWQHEAVIRLQAAGLPAVAPLRDVHGRTVAY
FT                   VRGRPFAVFPWNDGVHRHGRHMHDIDARCLGTTLADVHTGLARVLPQVPQPLFVPTASE
FT                   RRAVAEAEQLLAVVDSGPGRDEMDLLSAHRLRERLALIPEVAHLRPAPDAVATVGYIHG
FT                   DFHAGNVMWSALEPGSRVTAIVDWEKTAVAPCGDEVVSTALVFFTGDYSGQLDLDLVRA
FT                   FIGGYAAARPQFSEQELADSVRRVWWERLTDFWILTWHYHHADHRADSLFPATAALVPW
FT                   WTENYAKVLDAFLEGAAAATGTVPRR"
FT   gene            80355..81437
FT                   /locus_tag="Caci_0079"
FT   CDS_pept        80355..81437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0079"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: ace:Acel_0767
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69034"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH95"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACU69034.1"
FT                   /translation="MAASARGHRRAPKRSRRSPLRAVALFVISTALVVGSGVAFGYATH
FT                   HLGKHQVTDDASVVAPPTGPLSDATDDPSATTNSAPGGKPSVPASPRPSLPKATGPGKV
FT                   TELKVASSDDDWPSRPVFVYRPAVPANVVLPVVYLLHGVPGEPDRIMDAVKAVLDKAFT
FT                   SGGEQPFIVAAPTGEGTAHNDTEWADAVDGKDMVETYMIKDVIPAVEGKTPRPAGMRAI
FT                   VGFSMGGYGAANLTLRHPDLFDQFASMAGYFRVDDPDGMFGSDSKIEAANTPDDMVQKA
FT                   AGKRVLLLEDQQDPDPLIQGEASEFAKRLDDCNCGVDLSWHLEPGGHTYDFVTDSFPKV
FT                   ITFLNQGFTAPAGTTPSAAG"
FT   sig_peptide     80355..80480
FT                   /locus_tag="Caci_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.941 at
FT                   residue 42"
FT   gene            complement(81501..82199)
FT                   /locus_tag="Caci_0080"
FT   CDS_pept        complement(81501..82199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69035"
FT                   /db_xref="GOA:C7QH96"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69035.1"
FT                   /translation="MRNLLGSLLAIIGAAATLVSPWQAWYNNRHGSSYKFYEVFGSGVT
FT                   LSGSGIMDSVFLVFLITAVLAVAGVVLRSRALVGAAGVIAFGFTILWMVRQGQAAGELT
FT                   VTGANNRGLGSGVAYAFGGGLLMIIGSLMMTGRTRRTVVAEPARTKTADQAMYGTAATT
FT                   SAPPAITTTAPADKNPVPPAAAPAATPAQTSASAAPTASERTGTERLSKEERQMLGLDE
FT                   DASAEPKKQN"
FT   sig_peptide     complement(82128..82199)
FT                   /locus_tag="Caci_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.500 at
FT                   residue 24"
FT   gene            82507..84381
FT                   /locus_tag="Caci_0081"
FT   CDS_pept        82507..84381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0081"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_3434 putative heat shock protein
FT                   HSP70; TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69036"
FT                   /db_xref="GOA:C7QH97"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH97"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACU69036.1"
FT                   /translation="MARPVGIDLGTTNSVVCVLEGGEPTVITNAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKIGIDEKNFTPQQISAFILQKLKRDAE
FT                   SYLSEKVTDAVITVPAYFSDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKGEGD
FT                   QTILVFDLGGGTFDVSLLEVGKDDDGFSTIEVKATNGDNHLGGDDWDNAVVEWLVTQFK
FT                   NAHGVDLSKDKMAMQRLREAGEKAKIELSSSTETSINLPYITASAEGPLHLDEKLTRSQ
FT                   FQQLTSDLLDRCKTPFHQVIKDAGVALSAIEHVVLVGGSTRMPAVADLVRELTGGKEPN
FT                   KGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIEKNTTIPTK
FT                   RSETFTTAEDNQPSVQIQVYQGEREIAAYNKRLGMFELTGLPPAPRGLPQIEVTFDIDA
FT                   NGIVNVSAKDLGTGKVQSMVITGGSALPKDEIDRMMREAEQYADEDHSRREAAEVRNQA
FT                   ESLVYSTEKFLKDNEDKVPADVKSEVDAAIGETREALKSEDSATIRSASEKLATTSQKL
FT                   GAALYQQAQASGEAAGAPGGESAGAPGGGADDDVVDAEIVDEGKGGQA"
FT   gene            84577..85245
FT                   /locus_tag="Caci_0082"
FT   CDS_pept        84577..85245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0082"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: sma:SAV_4485 heat shock
FT                   protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69037"
FT                   /db_xref="GOA:C7QH98"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH98"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACU69037.1"
FT                   /translation="MSDEYAAEREGEGERANLAVTELLAKLAERTNELQGVQAELSERT
FT                   NDLQRLQAEFSNYKKRVERDRQVVKETAVAGALSELLPVLDDIGRAREHGELEGGFRQV
FT                   GEAFEAVVAKLGLARFGAAGELFDPNLHEALLSTTSPDVDEVTVAVLFRPGYRIGERVV
FT                   RAAQVQVAEPGPALETEPAPEPAPKPKPAAPAAKRAPGGAGKTAAEPAAEVDDDDDSGL
FT                   "
FT   gene            85314..86438
FT                   /locus_tag="Caci_0083"
FT   CDS_pept        85314..86438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0083"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: sgr:SGR_3432 putative DnaJ protein; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; heat shock protein DnaJ domain protein; DnaJ
FT                   central domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69038"
FT                   /db_xref="GOA:C7QH99"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH99"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ACU69038.1"
FT                   /translation="MAVNKDYYKILGVPKDAPAADIKKAYRKLARQYHPDANKGDAASE
FT                   EKFKEISEAYDVLSDDKRRKEYDDSRSVFGNGGFRAPGGGAPGGFNFDLGDLLGGLFNR
FT                   TGGPTTGTSTTGRTTQARRGSDVESEVTLKFSDSIDGATVSLRLTSDTPCSACSGTGAK
FT                   AGTTPRVCPTCSGTGQVSRNQGGFAFSEPCRDCKGRGLLVDDPCPVCHGSGRAASSRTI
FT                   QARIPAGVRDGQRIRLKGKGASGERGGPAGDLYVVVHVSPHPVFGREDDNLTVTVPVTF
FT                   PEAVLGADIQVPTLGGMPVTVKLPANSQNGRVLRVRGRGVARKDGTKGDLLVRFEIAVP
FT                   AEIGDDARAALQKFQEATGNHHPRAELLDSAKGE"
FT   gene            86446..86916
FT                   /locus_tag="Caci_0084"
FT   CDS_pept        86446..86916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0084"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: sma:SAV_4487 HspR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69039"
FT                   /db_xref="GOA:C7QHA0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACU69039.1"
FT                   /translation="MASKNPFLPLTEETPVYVISVAAQLAGMHPQTLRQYDRLGIVCPE
FT                   RTGGGGRRYSARDIDTLREVQRLSQDEGVNLAGIKRIRELEEQVAALSRRVAELEAVTL
FT                   YPTAKGTVPVAAPIAPPVSPLPPAPPGYRGDLLPALPATFTTALAVWKPQGK"
FT   gene            87023..89641
FT                   /locus_tag="Caci_0085"
FT   CDS_pept        87023..89641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0085"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: tfu:Tfu_0200 ATPase; TIGRFAM: ATP-dependent
FT                   chaperone ClpB; PFAM: ATPase AAA-2 domain protein; AAA
FT                   ATPase central domain protein; ATPase associated with
FT                   various cellular activities AAA_5; Clp domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69040"
FT                   /db_xref="GOA:C7QHA1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA1"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACU69040.1"
FT                   /translation="MDSQKLTTKSQEALSVAIREATRAGNPQVESIQVLLALLGQVEGT
FT                   TRPLLEAVGVDRAALSQAVTAAAERLPSASGSTVSAPTLARNTLNALNAAGDEARKLDD
FT                   EYVSTEHLLLGLALGNDSTADLLKKAGATPQALREAFGKVRGSARVTSQDPEATYQALE
FT                   KYGVDLTAAARDGKLDPVIGRDAEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQ
FT                   RIIAGDVPESLRDKRLVSLDLGAMVAGAKYRGEFEERLKAVLADIKDSEGQIVTFIDEL
FT                   HTVVGAGATGDSSMDAGNMLKPMLARGELRMVGATTLDEYRERIEKDPALERRFQQVLV
FT                   DEPTVEDTIAILRGLKGRYEAHHKVAISDTALVAAATLSHRYITSRFLPDKAIDLIDEA
FT                   ASRLRMEIDSRPVEIDELQRTVDRMKMEELALAKEHDPASRDRLARLRLDLADRQEQLN
FT                   ALNARWEQEKSGLNRVGELKQRLDAMKSQVEQAQRSGDFETASRLLYAEIPAVEAELET
FT                   ASTTVDEAEDVAPMVKEEVGPDDIAEVVGAWTGIPAGRLLEGETEKLLTMEQRIGERLI
FT                   GQAEAVAAVSDAVRRARAGISDPDRPTGSFLFLGPTGVGKTELAKALADFLFDDEHAMV
FT                   RIDMSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVVLLDEVEKAHPEIFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNTILILTSNLGTSGFDLTVDEALDPVQARLDRRQRVDN
FT                   AVRAAFKPEFLNRLDAQVIFDPLGTTELGRIVDIQVRKLAARLADRRLGLEVTPGARDW
FT                   LAIAGYEPAFGARPLRRLVQSSIGDPLARRLLAGEIRDGDTVRVDVDIENDALIIGSQA
FT                   S"
FT   gene            89681..90544
FT                   /locus_tag="Caci_0086"
FT   CDS_pept        89681..90544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69041"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA2"
FT                   /inference="similar to AA sequence:KEGG:SGR_6214"
FT                   /protein_id="ACU69041.1"
FT                   /translation="MPAALPTVIATRYVTALREGGSLPGLVEAADLGTYVVKFRSAGQG
FT                   RKALVAEVIAGELARALALLVPALVGIELDPIIGAAEPDQEIQELLKGSKGLNLGMDYL
FT                   PGSLGYDPLAFPVEPELASRVVWFDALVRNVDRSWRNPNLLLWHRKLYLIDHGASLIFH
FT                   HNWPGAQKGALAPFDANDHVLASYAKDMPGADAALAPLVTEELLRSVVAVVPDEWLVDE
FT                   PGFDSADAVREAYVSYLLTRVVGPREWFPQVVDSSAQEAARAHEGSDLKARLKAKHPNW
FT                   MQGRVK"
FT   gene            90541..90918
FT                   /locus_tag="Caci_0087"
FT   CDS_pept        90541..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO1348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69042"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA3"
FT                   /inference="similar to AA sequence:KEGG:SCO1348"
FT                   /protein_id="ACU69042.1"
FT                   /translation="MSVQPYEYSVLRAVPRVERGEYVNVGVVLYCQQLDFLGCATQLDS
FT                   VRVRALDPTADVEGIEALLGAVSKVCCGGPDSGPAGQDAMGRRFRWLIAPRSTVVQPGP
FT                   VHTGLTADPAAALDRLAGSLL"
FT   gene            complement(90866..91813)
FT                   /locus_tag="Caci_0088"
FT   CDS_pept        complement(90866..91813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0088"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: tfu:Tfu_1700 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69043"
FT                   /db_xref="GOA:C7QHA4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69043.1"
FT                   /translation="MGTWGPQGVSGKVVVITGAARGIGADAARRLARRGAKVALIGLEP
FT                   EELRKTAESCGPDATAWDADVTSWEQLGAAIDGIVDHYGGIDVVVANAGVAPTGFIRSI
FT                   DPSAFERTIEINLLGVWRTVRTALPHIIKNKGYVLVVSSAAALIHPPALAAYTASKAGA
FT                   EAFGDSLRAEVKHLGVDVGVAYFSWIKTDLVTSADAHPVLGKFRTSAPGPASRVYPLEK
FT                   VGQAVADGIAKRSRVICVPSWVNQLRRFHGMLPAIVEKANARATARADREMIADIEKRG
FT                   VEASSRLTGPGGAAAQAAKEAIQPVGRELPQDQR"
FT   gene            complement(91864..93579)
FT                   /locus_tag="Caci_0089"
FT   CDS_pept        complement(91864..93579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0089"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   aminoglycoside phosphotransferase; SMART: serine/threonine
FT                   protein kinase; tyrosine protein kinase; KEGG:
FT                   fre:Franean1_5221 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69044"
FT                   /db_xref="GOA:C7QHA5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69044.1"
FT                   /translation="MTLDMNSDVHKGGSPATDRLGPYLLVTQLGSGAMGRVFLGTDSTG
FT                   RQAAVKVVRSDLADIPAFRKRFSRELNVAERVHSPRVAEIYDAQTEGKRPWLATEYVPG
FT                   PTLQDAVEQGGAFDNEHLRALAVAIAEALEVIHAAEVVHRDLKPANVLLGPDGPKVIDF
FT                   GVARALDASLLTNTGQTLGTPAYMSPEQADGRAVESASDVFALGSLLVFAATGRLAFGD
FT                   GAPLAILHRVVNNDPDLSGVAEDDEVLRGVIEGCLCKEPEDRPSPQQIKDTFGAIGWQP
FT                   LTGVAWQQPPLGVGLPLTAGDAADLPTVAIAPKRGTKRVAVISAATVAALILATIAVVE
FT                   ASGGGKGNTAADTARTGGPTSSSQQNGGAFPSTDTSSGSTSSSGQTTPTSSSPPPPSQA
FT                   SGAPVPPGGGAGSTAPPQGSSQLVTVSVPITQGNGGSSQKPAPTSSHPTTHPSSAHTTS
FT                   AAPPPPPTHNPPGPMVAGDISVLIPNWVGAATVNVSWKAHSDATSYAIHYTVKGTATNS
FT                   DQTVPVSGTSYSYQIPADGTTCLQVRTVNQYGSSAFYPSPMYCVNSFGQVSSGG"
FT   gene            complement(93643..94437)
FT                   /locus_tag="Caci_0090"
FT   CDS_pept        complement(93643..94437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0090"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: sma:SAV_4383 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69045"
FT                   /db_xref="GOA:C7QHA6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACU69045.1"
FT                   /translation="MRVSLMQLAVDDAEAPEDRWTRVVKLVEAERETGAELVVLPELWV
FT                   TGGFDYKSWTGHAEPIADSQPIAALEKVRTHDGSGPEMWLHFGSYVERTPEGILYNTAV
FT                   FRGPDGKQAQYRKIHRFGFSEGEVTLMGPGKDIVTVSSPWGTLGLATCYDLRFPELFRR
FT                   LLNQGMEHMVMCSAWPAKRIEHWRVLLKARAIENQVFVFATNCVGTNGGVALGGRSAVI
FT                   DPWGNVVAEAGTGEEVLRVDVDPALVAQTRSALPVLNDRRLR"
FT   gene            complement(94534..96027)
FT                   /locus_tag="Caci_0091"
FT   CDS_pept        complement(94534..96027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0091"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   sco:SCO3815 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69046"
FT                   /db_xref="GOA:C7QHA7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA7"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACU69046.1"
FT                   /translation="MGEIKRFNLPDVGEGLTEAEILAWSVKVGDLVKVNQVLVEIETAK
FT                   AAVELPSPWAGKIVELLVDEGQTVDVGTPIIGIDTDPSTPSTGGAGGDDMTAGVAATAE
FT                   AKAAPAAAKEPKEAKREPVLVGYGVKQGASSRRPRKTAAAPSAADVMGATVREEPVADE
FT                   VPAPAYYGQSAAREAAAPAVQTRTPDTTAAPAAPTGAKPLAKPPVRKLAKDLGVDLALV
FT                   VATGTNGTVTREDVHAAASGTSTAAAAPAAANGTAPAAAPFVNGERRVPIKGVRKATAT
FT                   AMVQSAFTAPHVTEFLTVDVTPTMKFVQRLKEMPDFKGVRVSPLLLVAKAFLVAMARNP
FT                   EINARWDEAAGEIVYFDHVTLGIAAATPRGLLVPNVKGADLLPLVELGRALNKLTDVAR
FT                   EGKTSLADMTGATATITNVGVFGVDTGTPILNPGEASILAFGAVREQPWMHKGKVKPRQ
FT                   VTTLALSFDHRLVDGELGSKVLRDIGAVLADPLTALAWS"
FT   gene            complement(96046..97041)
FT                   /locus_tag="Caci_0092"
FT   CDS_pept        complement(96046..97041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0092"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: sco:SCO3816 branched-chain alpha keto
FT                   acid dehydrogenase E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69047"
FT                   /db_xref="GOA:C7QHA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA8"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACU69047.1"
FT                   /translation="MAESTSKTQQISLGKGLNLGLRRALEDDPKVLLMGEDIGKLGGVF
FT                   RVTDGLQKDFGDSRVIDTPLAESGIVGTAVGLALSGYRPVVEIQFDGFVYPAFDQIVTQ
FT                   VAKMRARALGTVSMPIVIRIPFGGGIGAVEHHSESPEGYFAMTAGLRVVAASNPVDAYW
FT                   MIQQAIASDDPVVFFEPKRRYWDKAELDPAATPYPLYASRVVREGTDATLVAYGPMVKT
FT                   CLEAAAAAAEEGRSLEVIDLRTLSPLDLEPVYASVRKTGRLITVHEASVFMGMGAEVAA
FT                   KVTEKCFYSLEAPVLRVGAPHTPYPPSRVEEEFLPDLDRVLDAVDRAFAF"
FT   gene            complement(97043..98170)
FT                   /locus_tag="Caci_0093"
FT   CDS_pept        complement(97043..98170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0093"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: sgr:SGR_3765 putative branched-chain alpha
FT                   keto acid dehydrogenase E1 alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl- transferring) E1 component, alpha
FT                   subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69048"
FT                   /db_xref="GOA:C7QHA9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA9"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ACU69048.1"
FT                   /translation="MVTSRKGAGGKTAAKKKAGPADPDLVQLLTPDGDLVEHPEYSIDL
FT                   TPEEYRGLYRDMVLVRRIDAEGTALQRQGELGLWAPLLGQEAAQVGSGRAQTAEDYAFP
FT                   TYREHGVAWCRDVDPVNLLGMFRGVNNGGWDPNEKNFHLYTIVIGSQTLHATGYAMGMQ
FT                   RDGREAAVIAYFGDGASSQGDVNEAFVFASVNNAPVVFFCQNNQWAISEPNERQFRVPL
FT                   YQRAAGFGFPGVRVDGNDVLACLAVTRAALERARTGNGPMLVEAFTYRMGAHTTSDDPT
FT                   RYRSSDELEEWKAKDPILRMRAFLEKSKYADEAFFKEVDTEADTVAADIRERCVTMPDP
FT                   KPISIFDHVYAEPHPLMDEERAEYGAYWESFEGAH"
FT   gene            98378..99079
FT                   /locus_tag="Caci_0094"
FT   CDS_pept        98378..99079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0094"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   ace:Acel_0518 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69049"
FT                   /db_xref="GOA:C7QHB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69049.1"
FT                   /translation="MHSDAGKPGIPDSIRVFLLDDHELVRRGVAEMLSAEPDIDVTGQA
FT                   GSVAQTVAAAEAARPDVALLDVRLPDGSGIEVCRELKSRMPGLGCLMLTSFSDDDALFG
FT                   AIMAGAAGYVLKDIRGSALVDAVRTVARGGSLLDPTATEKLLSRLRVGIVPGEADREAA
FT                   ASKLATLTVSEKRILELIAEGLTNRQIGERLNLAEKTVKNYITGILAKLAMQRRTQAAA
FT                   FAVRHLPGRSQ"
FT   gene            complement(99127..99723)
FT                   /locus_tag="Caci_0095"
FT   CDS_pept        complement(99127..99723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0095"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO1339
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69050"
FT                   /db_xref="GOA:C7QHB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69050.1"
FT                   /translation="MTSRPDLIGDTAIALLAERGLRGLTHRAVDEAAGLPPGSTSNHAR
FT                   TRSALLETTFARLCRLEAEIFEDAANPGGLLALATLTPETAADLVAAQLHDTLTHRREQ
FT                   ALARFELALEATRRPELRAIYDTAGATFREPARGLMAALGATDPDRAGRSFIAFSEGIL
FT                   FDSVAGAGSRKVPTQEEIRDDLLELFRGMLMEPSP"
FT   gene            99812..100978
FT                   /locus_tag="Caci_0096"
FT   CDS_pept        99812..100978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0096"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sco:SCO1338
FT                   monooxygenase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69051"
FT                   /db_xref="GOA:C7QHB2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB2"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACU69051.1"
FT                   /translation="MEAIVVGAGFGGLTAAVGLFQRGWDVTVVERATELRPVGSGLAVA
FT                   PNGLRALDTLGVGDAVRKLAAFQGDATVTRPDGRVIARTASKAIVRRFGDAVIPATRSS
FT                   VMDVLTALVPADVFRLGVAAQGVEAGSASQRPCLLTDSGRLEADMIVAADGVNSVLRRA
FT                   LFPEHPGAVYSGITAWRLLVPTPAGDFLPGEVWGGGRVFGITPLADGRTYAYGADHAEP
FT                   GITYPDEKAELLRRFGDWHFPIPALISGADPETVLHNDIYEIAEALPAYHRGSVAILGD
FT                   AAHAMTPHLGQGANQAMEDGVTLAALVGPAKDSEEIASALARYTALRALRGADMVRRSH
FT                   RMGALTQSTSRSKTALRNLGMSLVGRLVPDLALRAMEPVVAWRPPEGP"
FT   gene            100989..101933
FT                   /locus_tag="Caci_0097"
FT   CDS_pept        100989..101933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0097"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ace:Acel_2105 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69052"
FT                   /db_xref="GOA:C7QHB3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB3"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU69052.1"
FT                   /translation="MTDTASPRVPTRYGFLGPAGTFTEAALLSVPGARDAERVPYESVP
FT                   AALDAVRRDEVAGAVVAFENSVEGAVPATLDDLSTEEPPLHIVREILLPVEFALMGRPD
FT                   TALADIKTVSSHPHAYPQCRRWLAENLPDARWVAASSNADAARLVSEGVHDAALAGSFA
FT                   APFYRLTLLAENIHDVSGAVTRFVMVVPPGPPPARTGADKTSLAVVLRDNHPGALLEIL
FT                   EEFAVRGVDLMRIESRPTRSKLGTYWFSIDCEGHLEDARVGEVLTGLRRVAAEVRYLGS
FT                   YPRADGRAAEIRKGTSDEDFHEAAEWLAGLRNR"
FT   gene            complement(101920..102750)
FT                   /locus_tag="Caci_0098"
FT   CDS_pept        complement(101920..102750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69053"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4347"
FT                   /protein_id="ACU69053.1"
FT                   /translation="METAQAMSEPLFQNLEDAVVVAETALLDTQVAVESLRAELDQFTR
FT                   LHQIQLGPLYGRLDELDALTAETEAAMTGDPEAIRRAVEARARVDGEDPMLFAAANAGL
FT                   LEDDGEGGSEHEQKPPRPREEAAPTPDPDVPVRPSKTAQRLYRELARRSHPDLVQDQAE
FT                   IARRSAFITRVNAAYEKDDLPALQKLSEEWSLTSSGPAVDSPQREMWLQHRLIWLRVKQ
FT                   AELALERQTLMENPMADVLAAYQYDSLTALRSISEQLYTAIAERETLLNALIGS"
FT   gene            102850..103614
FT                   /locus_tag="Caci_0099"
FT   CDS_pept        102850..103614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0099"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: fal:FRAAL4906
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69054"
FT                   /db_xref="GOA:C7QHB5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB5"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACU69054.1"
FT                   /translation="MIDLNADLGEGFGRWRLGDDDALLELVTSANVACGFHAGDPSTMR
FT                   RVCAAAVSRGVRVGAQVGYRDLAGFGRRDIEYDPHELADDVLFQIGALDAFARAAGDRV
FT                   RYVKPHGALYNRIVHDAVQAEAVVRAVVTFASVYDVQVPVLGLPGSVFLELATTAGLSV
FT                   IPEAFADRAYTPQGTLVSRSKPGAVLTTPEEVAGRAVEMAVSGTVRAIDGTLVNVSARS
FT                   LCVHGDSPSAVAMAAAVRDGLRSVGVEVGAFA"
FT   gene            103647..105341
FT                   /locus_tag="Caci_0100"
FT   CDS_pept        103647..105341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0100"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; Allophanate
FT                   hydrolase subunit 1; SMART: Allophanate hydrolase subunit
FT                   2; Allophanate hydrolase subunit 1; KEGG: aau:AAur_0053
FT                   UreA carboxylase/allophanate hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69055"
FT                   /db_xref="GOA:C7QHB6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB6"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ACU69055.1"
FT                   /translation="MLPAGPFGVLLEFDSLDKVQRCFAWVERWRTARPGVLVDVVPAEQ
FT                   TLMAIATFDDAGQRGLREFVAAVGAVDWADAGTDDDAAPAADAETVELPVTYDGPDLDD
FT                   VTRLTGLAANEIVSLHTEAEFTVAFTGFAPGFAYLTGLPDALRVPRRDAPRTRVPTGAV
FT                   ALGGPYSGVYPRESPGGWQLIGQLAPWAPTLWDETRESPALLRPGTRVRFVDAAGQSAP
FT                   DSSAPAKLTQATAAATEPGLRVVRAGPLTTVQDLGRPGFAHLGVPRSGAVDRTSLKLAN
FT                   RLVGNEEGAAALELTLGGGAVQLEVGRWVAVTGARCEITMTVPAPESALEPAAAREVGP
FT                   DRKSAPAAGPSHRPIVMRTVPGTAFYAPEGAVVEVGPAVAGVRAYLAMAGGVGGFEVLG
FT                   SRSVDLLSGVGGRALGGGARVGVGVPVGLPPDIPGLGMAPVRDVGDPVVVRLVLGPRSE
FT                   WFTDDAVRDLVAARWTVGVESNRTAVRLDGPSLARARDGEPASEPLVVGAVQVPRDGRP
FT                   LLFLADHPVTGGYPVIACAHPADVDAAGQARPGTGIRFRMVGGLASR"
FT   gene            complement(105382..106392)
FT                   /locus_tag="Caci_0101"
FT   CDS_pept        complement(105382..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69056"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69056.1"
FT                   /translation="MPTQTQPWLRAELIAAPETTPGAQLMIPADGVEFHDDQLVFHHQG
FT                   DIVYVAAQGQLRSITWFARQPNPETARRKAQWPNHGTRWTDEERADLRRHLSTGHSWKT
FT                   ISHAHGRSRSGCQQEAVKQGWLDPETLQPTPELLLEAAAPIPDTAAAPAAPAAPADHAA
FT                   PSTNDSHPLSVAASDSTSATASVAASNSVSDSTSGAASDSTPGAESPAIPMHSPAAPHA
FT                   PTPLIFTGSEAAPTPAHAAATPVSHSAVAQPDRPRIPPRVPRQRTGPTTEPHPGPDPGG
FT                   TSSQDSDPDTGDSPGATPSPGTRFLSRAQSSLARATLGAYMNPPRGQSDPASSPT"
FT   gene            complement(106496..106774)
FT                   /locus_tag="Caci_0102"
FT   CDS_pept        complement(106496..106774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa32830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69057"
FT                   /db_xref="GOA:C7QHB8"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69057.1"
FT                   /translation="MTTQAPQPPPASQPPRTAADKAQRSRMIGAIVIAVVAIWFILANT
FT                   RKASITFWIVTVTSPMWLTLAGTFLAGMLTSLLLTRTRTRKRQKQPQ"
FT   gene            complement(106844..107413)
FT                   /locus_tag="Caci_0103"
FT   CDS_pept        complement(106844..107413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0103"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; protein of
FT                   unknown function DUF1707; SMART: Forkhead-associated
FT                   protein; KEGG: sma:SAV_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69058"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU69058.1"
FT                   /translation="MGGPSFGNAGWQPPDFRPSDAERDNAIDALSAGAEAGRLSSDTFS
FT                   HRLDQALAVQSHSELTQLVSDLPIPADQPGFGQRVVNAVSAVAHFRFKVKAAWRGPSLP
FT                   RLSLPGGPQVTLRIGRMPECDLQLFDTTVSRYHAEFRRSQNGWFLVDLGSTNGTRVNGW
FT                   RITAPTAVQPGDEVSFGSVVFSLNGR"
FT   gene            complement(107482..108756)
FT                   /locus_tag="Caci_0104"
FT   CDS_pept        complement(107482..108756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0104"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; SMART:
FT                   proteinase inhibitor I4 serpin; KEGG: scl:sce4096 secreted
FT                   serine (or cysteine) proteinase inhibitor, clade B
FT                   (ovalbumin), member"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69059"
FT                   /db_xref="GOA:C7QHC0"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC0"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ACU69059.1"
FT                   /translation="MPRKQIAAITAASLAALTACSSSGSSSSAGGSLVRVNAARATVGQ
FT                   ADLSAASAGVNAFGVDVFHSVADGDEGNVMISPTSLATVLTMLLPGAKGQTEAQMAKAL
FT                   HTTMTADQFADALGALDSATVQRELADKAELQQYDTVWTQKGYDIQPSYLQTLASAFDA
FT                   GVRETDFTNSESARQTINKTVEDQTNGLIKDLFGPGSISPATRLALTDSLYLKAKWADA
FT                   FAKSATSDKPFHLTNGSTANVPTMGKEHSFAYAHGADWQYAELPYQQDHLAMGILLPAS
FT                   GSFDTFRKSLTGDSLATMTASATPSPVDLELPKFTFDTSRDLKSPLESLGMQTVFDPNS
FT                   ADLSGVPAKPESLFVGAVVQKTHVAVDEDGTTAAAASGVTVVAGAAPQQSPPAEMHVDR
FT                   PFLFLIRDTVTGQILFLGQVSDPRG"
FT   sig_peptide     complement(108670..108756)
FT                   /locus_tag="Caci_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.515 at
FT                   residue 29"
FT   gene            108837..109391
FT                   /locus_tag="Caci_0105"
FT   CDS_pept        108837..109391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69060.1"
FT                   /translation="MNAMTVPPMSSPAMPQNQEQEGPGEAVDIPQQQDAEPRQEEMPAV
FT                   TAAETEPGGGAGETGEPAADGDEGKEPAADAGETSGDRDEKEEKEDKDEKKTAAKPKRK
FT                   SAPRKTAGGSKTLVVLKGGRVQYADTDAVVVVDLDEAASPDTDVHDVLDRLTELRDATE
FT                   SPAKTDAVRALTDLIQEKALG"
FT   gene            complement(109615..110286)
FT                   /locus_tag="Caci_0106"
FT   CDS_pept        complement(109615..110286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0106"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: fre:Franean1_3917
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69061"
FT                   /db_xref="GOA:C7QHC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU69061.1"
FT                   /translation="MDIYEALYTTRAMRRVKPDPIPESVQARILDAAIRAPSGGNGQNW
FT                   RFLLLDDPEKKKLLGPLYRDALDQLYTTVYAPMLAAIAADPDSPESRQMAKVTKSSRWL
FT                   GENFEQVPLFLFAFVQRDRSGGSIFPAVWNAQLAARAQGVGSALTSILGGFHDQEVKEI
FT                   LGVPAEEKWTQSCCVSFGYPTGRWGVAPRRPAHEVAYRNGWGEPVGFTVDEPLWQPSPE
FT                   S"
FT   gene            complement(110334..110888)
FT                   /locus_tag="Caci_0107"
FT   CDS_pept        complement(110334..110888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69062"
FT                   /db_xref="GOA:C7QHC3"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC3"
FT                   /inference="similar to AA sequence:KEGG:SGR_4289"
FT                   /protein_id="ACU69062.1"
FT                   /translation="MPTATTARPKLAARLSGRRHTSRTRRLRVIGAAGFAGVSMALLTA
FT                   EHSVPPARRPPRFAAESLMSGLVAVPVRFADAGSTGYLRPGDRIDVLAAHDAGPDGPPG
FT                   PPEASSGPIPGLGADPPRGETAVAVDVSVLEIAHSADPGSLTRAAPDDGGLVFLAVDNA
FT                   TAARLARAAVADRLSYALRHG"
FT   sig_peptide     complement(110763..110888)
FT                   /locus_tag="Caci_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.318 at
FT                   residue 42"
FT   gene            complement(111026..111454)
FT                   /locus_tag="Caci_0108"
FT   CDS_pept        complement(111026..111454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0108"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   sco:SCO3187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69063"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC4"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACU69063.1"
FT                   /translation="MPTYQYQCKDCGEALEVVQKFTDDALTVCPNCQGDLRKVFSAVGI
FT                   VFKGSGFYRTDSRSSSSSSTPPGSSSNGSSGSGSGSSSDSGSGSGSGSSGSGSSSGSGG
FT                   SSGSGSSGGSSKGGSSSSSSSTSSSSSSSSGSSSSTKS"
FT   gene            complement(111609..113939)
FT                   /locus_tag="Caci_0109"
FT   CDS_pept        complement(111609..113939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0109"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: tfu:Tfu_0250 PAS containing protein
FT                   phosphatase 2C-like; TIGRFAM: PAS sensor protein; PFAM:
FT                   Stage II sporulation E family protein; PAS fold domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein;
FT                   SMART: protein phosphatase 2C domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69064"
FT                   /db_xref="GOA:C7QHC5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACU69064.1"
FT                   /translation="MRRQPGTGEQLPHARPQPSAELVPANSTQTSAISVLEALPDPVVV
FT                   LNHRGQITGWNPAAEELFGWYGEEVLGRPWTEFVVADGTNGNALSHLDSIGSTVQRGGT
FT                   WEGSFPITTRNGDSLLARVRAAPMMSGGMITGTVVTAIDLFGSDASRDDQQRAAARAAV
FT                   RAAVLSRAGMQLGTSLDTGRTLAALAEILVPAFADTCVVDLLDENGVAQRLVTVHSTDT
FT                   APCPPMRSGTEIHYPARHPCDRALRTGRPVLIQGAPRVKALDQDEECDRKSLLLDAKSL
FT                   IAVPLLAPSGVRGVLAIALTEDADPTPRYDTADLELVEELAARAGLALENAAMFDRQRT
FT                   LALALQKSLLPTDLPLPDGVSIRVGYAPGAASEVSGDLYDVVELSAGRIGVVIGDVQGR
FT                   GAHAAAVMGQLRAALRAYAVLDVQPGQLLSYLDELVRGLNEEILVTCVYAIYDPFTRRC
FT                   ALANAGHPPPLLASAHGTYPMEVPPDVPLGIGPLGPGGGKGAVQFEDHIFSIPPGDVLV
FT                   MYTDGVVERRDQSVDTGVRTLCLAIERVVREPRAICRAALRAAGSEAHDDQAVLAMATS
FT                   TVDLPLSRLALPARPEAAFAARHHTRAVLREWGLSEHAELAELLVSELITNAVRHASGP
FT                   RPTPWSFSDSDQYSDPEPPPMAEDMMELAAVREYADHLGALDEENELDLLAEPGLLDEL
FT                   GMLDGTLAAPGGSRRLDLVLRRGLRALWIEVHDPDVRLPRIRQAAETDEGGRGLYLVDA
FT                   LSARWGARPTDAGKFVWFEIPLF"
FT   gene            complement(114008..114655)
FT                   /locus_tag="Caci_0110"
FT   CDS_pept        complement(114008..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0110"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   sco:SCO3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69065"
FT                   /db_xref="GOA:C7QHC6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC6"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACU69065.1"
FT                   /translation="MTNQFNEPGLAKGTIRSRLLAARRAYAPELRAAWAATACEVLVGQ
FT                   MSGADVVAAYASFGTEPDTGPLLAELRGRGIRVLLPILENDMDLSWGRYSGPDSLVRRI
FT                   PPGGSAPGPIPEPAESLGLDAVLSASWIVVPALAVSPAGIRMGRGGGSYDRVLTRIEAS
FT                   PRGARPRVAALLYPGELGVDIPVEPHDRAVDMAVAGESVRHWDESPGGVLSR"
FT   gene            114697..115383
FT                   /locus_tag="Caci_0111"
FT   CDS_pept        114697..115383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0111"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ace:Acel_0165 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69066"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU69066.1"
FT                   /translation="MSLTAVVLVLLAAAAVALAGMNLALRRRLEHLEETTRTALAQAAS
FT                   EVTGLEQGREDLERLSALDPLTGVWNYRYLQGALGRELEAARATGIGGALLMIDVDDFR
FT                   RVNAGYGHQRGSAVLRELAQRLALEVRHADTFARYGGEEFVLILPGTNADTAAKVAERL
FT                   CYAVRKLTFDAGPDTDSEQGPFQLTISVGGVIFPDHGTHAATLLRVADEQLMAAKRDSH
FT                   GSWRIT"
FT   sig_peptide     114697..114756
FT                   /locus_tag="Caci_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 20"
FT   gene            115398..116318
FT                   /locus_tag="Caci_0112"
FT   CDS_pept        115398..116318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0112"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   sma:SAV_3673 UTP:glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69067"
FT                   /db_xref="GOA:C7QHC8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC8"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ACU69067.1"
FT                   /translation="MVEVRKAVIPSAGLGTRFLPATKATPKEMLPVIDKPTIQYVVEEA
FT                   VTAGLTDILMVTGRNKRPLEDHFDRAAELEEALEAKGDKVRLQQVRASAEMANVHYVRQ
FT                   GDPKGLGHAVLKAESYVHGEPFAVLLGDDFIDERDPLLPAMIAVRQRYGGSVVGLIEVP
FT                   EEQIHMYGCAAVKPAVDGPDLGHDHTSLIQITDLVEKPSVAQAPSNLAVIGRYVLDPAV
FT                   MGVLRETAPGRGGEIQLTDALRTLAGDPDIGGPVHGVVFTGRRYDTGNPIDYLKTVVQL
FT                   AVDRPDLGGEFRDWLSSYVRAGFHD"
FT   gene            116350..117591
FT                   /locus_tag="Caci_0113"
FT   CDS_pept        116350..117591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0113"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: ace:Acel_0167 molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69068"
FT                   /db_xref="GOA:C7QHC9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC9"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU69068.1"
FT                   /translation="MSDSENARMRSVDDHLKTVLDTVQLLAPMELPITDVNGLVLAEDV
FT                   VSAISLPPFDNSSVDGYAVRLADLEGAAEDSPAELRVLGDVAAGSVHEGILEPGTCLRI
FT                   MTGAMVPHGAEAVVPVEWTDGGTESVRITRVPERDEHIRVLGSDVAAGDVVLKAGTRLG
FT                   PRQIGLLAAIGQVHAPVHPHPRVVVLSTGSELVEPGTPLGPGQINDGNGPALTAAVNAM
FT                   GATGIRVGIIGDDPQGVLDAIEDQLIRADMVVTTGGVSVGAYDVVKEVLSTLGTVEFTK
FT                   VAMQPGMPQGFGTVGEDRIPIFTLPGNPVSAYVSFEIYIRPAIEKMMGIETGPRETVTA
FT                   TCFGAFTSPSGKRQFARGIYDPHGLSVRPVGGHGSHLVGDLALANALIVVPEYVTEVVD
FT                   GDDVEVIVMEGGPR"
FT   gene            117588..118124
FT                   /locus_tag="Caci_0114"
FT   CDS_pept        117588..118124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0114"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: sma:SAV_3671 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69069"
FT                   /db_xref="GOA:C7QHD0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD0"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU69069.1"
FT                   /translation="MSSETSGTVETSGVAEAPGGKSDRLTHIDSTGDARMVDVTAKPVS
FT                   ARQARATGFVEVSPKVVELLRGEGMPKGDALSVARIAGIMGAKKTPDLVPLCHPIAISG
FT                   VKVALEVEDSGVAIAATVKTADRTGVEMEALTAVAVAGLTVIDMVKAVDPAAVLTRVQV
FT                   EAKSGGVSGDWSREG"
FT   gene            118256..119920
FT                   /locus_tag="Caci_0115"
FT   CDS_pept        118256..119920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0115"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10371 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69070"
FT                   /db_xref="GOA:C7QHD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69070.1"
FT                   /translation="MTDTSTAAAPPPENDTGRLDGASRARIFSVIVVVVLFAEVAPLQY
FT                   TMVSPAAQLIGRSFPGVGSNIAWMTIIFGLVGGAATPILGKLSDLYGKRNMLLAVGISF
FT                   LIGSLICATTSNWTMFLIGRAFQAVAIAAATVAYGLIRDLIPRKYVPLAIGLVSTGLGV
FT                   SGVGGIMLSGVLTDTAGWSYKALFWFLVIYTLVTLPLLFLVCPETKFRARQKLDPFGAL
FT                   LLAGGVGFALLYVSNGANVGWSDPLYLGYLLLGVVLMAGFVLLERRVSQPIIDLRLLFS
FT                   PKVSVVLFIAFFAAIVVGIQAFSIPYMVSTPSHDGLIAMTQQGAAARFKGLVQPNQIPV
FT                   KVLGDIGYGLGFTLLGLAFHVQVWGSSVSMFSGAASGQLSGKIGARKPLLIGMLTFAAT
FT                   SGIYAAAHHGALTLALVGIVFGVGFGAYYATTPNLLVEASPPEQQGITAGMLGVSNSIG
FT                   TAVGTAIAAAFQAAHPVRLIVAGQTVLAGTPDPKTGVTERAGVFTDTAYTQIFIACAIA
FT                   GFIALAATFFMRSGRTASTGGLGYLTDPAPAKETAPA"
FT   gene            complement(119946..121391)
FT                   /locus_tag="Caci_0116"
FT   CDS_pept        complement(119946..121391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0116"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mxa:MXAN_3480 iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69071"
FT                   /db_xref="GOA:C7QHD2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD2"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69071.1"
FT                   /translation="MRGPLMSSTGHAGLRVETPDLRLLCDPWVSPGGAFLGSRFPFPDN
FT                   SHLRAVPRLLEAEWVAVSSAQADHMDVEFLSGLDESVRVVIPAYPSSVLHDRLSAAGVK
FT                   NIVEVEGWQRVPLTDRGDWLTVVPEQSPMAHRAAFLVVADGVSVLHCNDARLSLSQTRR
FT                   AMIEVGGPLDLLALDASEERFRAVKRLVRAVKPRLVMPYGGPGCFLDPELMEHNAVVAP
FT                   GELPAETLTLLPGDSVRITPTSYECVRDPHWEGFAYSDSVAVANHLETYAASRAQEIAD
FT                   VWEAYPDPDAGSGLEDRFAEHFVRLGRMSPYFLERIAMTVRFKVAGADGGVWDVHLGTT
FT                   DETAQYTFRVEARWLEAVLGGEIRWEDLLLSRRIHVEHAPEADGSYLFGLLMHADADAL
FT                   QAIEDYDKRDPDSTVTLTSGDRTFEVTRYCPHSGEDLAEGAVIDEAPEGLVLRCLAHNF
FT                   DFSLTTGLCLNARCEPIVVAAPV"
FT   gene            complement(121480..122364)
FT                   /locus_tag="Caci_0117"
FT   CDS_pept        complement(121480..122364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69072"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD3"
FT                   /inference="similar to AA sequence:KEGG:Tfu_0410"
FT                   /protein_id="ACU69072.1"
FT                   /translation="MHVPKLGLRKAAALAAAALCGLAVSAGPASASDGWKHQPYDYYLA
FT                   LGDSLGAGWQPNAVTGQGYISGHGYADDIAASLKLQGGKYVNLACPGETTGSMIHGGCP
FT                   YPEPYKNQLDAAASFLKAHKGDRVLVTLDIGANDVDGCASATGLDIQCGLTGIQQTSQD
FT                   LPVILRTLRAAAGHKTEFVGSTYYNPFLASWLTGSAGQSNAKLSAAFLNLFNAVFAIEY
FT                   PLNGVRVADVSAAFSSNDFVHQVTLQPGVTVPLNVARICQWTWMCAPAPVGPNIHANDA
FT                   GYTVMAKAFEAVI"
FT   sig_peptide     complement(122269..122364)
FT                   /locus_tag="Caci_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(122637..123221)
FT                   /locus_tag="Caci_0118"
FT   CDS_pept        complement(122637..123221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0118"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO3133 MarR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69073"
FT                   /db_xref="GOA:C7QHD4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69073.1"
FT                   /translation="METPHTQGLDAATPADNGAPAPAAPAASDPQACRDEVDRLVEAWR
FT                   HERPDLDVAPLEVLSRVSRLARHLDRARRTAFAEHDLEPWEFDVLSALRRAGAPYQLTP
FT                   SKLLTQTLVTSGTMTNRIDRLAAKDLVKRLPDPGDRRGVLVQLSDTGRERVDGAFEGLL
FT                   AQERELLGGLSAGDRTTLAALLRTLVLPFDN"
FT   gene            123390..124196
FT                   /locus_tag="Caci_0119"
FT   CDS_pept        123390..124196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0119"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO3132 trans-aconitate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69074"
FT                   /db_xref="GOA:C7QHD5"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD5"
FT                   /inference="protein motif:PRIAM:2.1.1.144"
FT                   /protein_id="ACU69074.1"
FT                   /translation="MADDIWNAQQYLRFENDRLRPFLDLVTQLDADGDVHTVVDLGCGP
FT                   GNGTALLVDWWPGARIVGVDSSPAMIEAAQEQAIPGQVEFELGDLRQWRADGKVDVLLA
FT                   NAVLQWVPDHLDLLPDLAAQLAPGGVLGFQVPGNFEAPSHLALAEMKRRWAGRVPDDLQ
FT                   KPASHDPAVYLEKLAESGLEPDVWETTYTYLVPADPDPSVPCGVTEFVRGSALRPAIKA
FT                   LSESDAADFVSEYDTLARAAYPVRELGGHSVQLLPYRRIFAIGRTV"
FT   gene            124248..124604
FT                   /locus_tag="Caci_0120"
FT   CDS_pept        124248..124604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0120"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_4178 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69075"
FT                   /db_xref="GOA:C7QHD6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69075.1"
FT                   /translation="MLAALHHAQVAVPKGAEDVSRAYYVGVLGMTELPKPPVLAARGGC
FT                   WFAAGGLEIHTGVEEPFIPARKAHPAILVTDIDELAAALTAAGHEVAWDQTIPDKRRLH
FT                   TFDPHGNRLEFIQQ"
FT   gene            complement(124668..125171)
FT                   /locus_tag="Caci_0121"
FT   CDS_pept        complement(124668..125171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0121"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   mab:MAB_1523c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69076"
FT                   /db_xref="GOA:C7QHD7"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD7"
FT                   /inference="protein motif:PFAM:PF06210"
FT                   /protein_id="ACU69076.1"
FT                   /translation="MAREYIPPRLDQPRGRRQVSLKPSFDPDAFGRVSETIARFFGTAR
FT                   YLFIQSLIVVIWIALNILVVTKAIRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQAER
FT                   DKVQIAEDKAREELSFATMEYLTREIASLRMAVGEVATRDYVRGELQSLLKELDERGRD
FT                   YSGE"
FT   gene            complement(125172..126536)
FT                   /locus_tag="Caci_0122"
FT   CDS_pept        complement(125172..126536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0122"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: ace:Acel_1818 MgtE intracellular
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69077"
FT                   /db_xref="GOA:C7QHD8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD8"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ACU69077.1"
FT                   /translation="MRALSRVYVSHLAGRSVFDADGEPVGRIRDIVVSMGAGDAAPRVL
FT                   GLVLEMQMHGRRRVFLPIGRVTSIESNQVVSTGLVNMRHFQQRPGETLVLTELLDRRVT
FT                   LKATGETATVRDVAFEPERAGKEMALTKLFVQKAAKTTGLRRRGESLTVDWDAVEGLEV
FT                   SGAQGAAELVAALDKLHAADLAHVMHELSPRRRGEVAAALDDERLADVMEELPEDDQVE
FT                   ILGELESERAADVLEAMDPDDAADLLGELSADEAERLLALMEPQDANPVRRLLSYREDT
FT                   AGGLMNSDPIILLPNATVAEALALVRDEERTPANASLVFVTRAPTETPTGRYLGAVHIQ
FT                   RLLREPPMALVSAAVDVELEPLAPDTMLNEVTAYMATYNLVAVPVVDADDRLLGAVTVD
FT                   DVLDHLLPDDWRLRPPGSHPHDELPPEAREVVELLEGQDAADGAPSPIRTGPGEG"
FT   gene            126813..127631
FT                   /locus_tag="Caci_0123"
FT   CDS_pept        126813..127631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_3109 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69078"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69078.1"
FT                   /translation="MAIAAVAALAGCGSTGTNGVAKKGAGSIVATAEGAVLNATSVHIQ
FT                   GQFTSGNQPVALDLRLEKDKGASGTVTIGTEVLELLRVGPDVYVKGDEAFYRSVLSRLG
FT                   TASAPAPSAPSAPSTSGSASGSSSKSPSAAGSSSAGTSTTGTPSAGQSSSDNSIAVTAM
FT                   QINYLHIGPTDAQYQTFASLTDPRQLLAQIMQGIGSLGKDGQKDIRGTKSIVLSGSKDT
FT                   RVYVAIDGQPFLERVLPPGGGTLDFMDYNTPVTLNPPPPGQVVDIAKIAK"
FT   sig_peptide     126813..126872
FT                   /locus_tag="Caci_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.544 at
FT                   residue 20"
FT   gene            complement(127663..128745)
FT                   /locus_tag="Caci_0124"
FT   CDS_pept        complement(127663..128745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69079"
FT                   /db_xref="GOA:C7QHE0"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69079.1"
FT                   /translation="MTDDELALQRDLDEELNRLQPRPVPTEAVYGRARELRRTRRMWAA
FT                   GVLATAAVVGTSLPILGSMGLRQNAAGGGQAVTVNTPHTDKKGRYVFSGSEEGKRWSTT
FT                   VAPGDCPSSGSFNLNVACNASSGSDPAELSYAAPAGLPTTYAIYFRSDIARIDMTLSDG
FT                   GQATLVPGIVRGNRVALVVIPPKIEITRVDVFAADGSPVGFSIPFQADGMAHLAMWYQP
FT                   GQTPTQPEASGTITGITQKGEHASVGVRIGPFGICYTVAQRSTPGAVPITNCRPFSAAA
FT                   SDDVPPNPPDWVALGGLVDDRVDHVDFALTTGTIRVQTVRIGAYSFAVGFADYSFTSLG
FT                   ETAYDASGHVIDREQTPSKS"
FT   gene            complement(128742..129254)
FT                   /locus_tag="Caci_0125"
FT   CDS_pept        complement(128742..129254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0125"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69080"
FT                   /db_xref="GOA:C7QHE1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69080.1"
FT                   /translation="MRADEDGHDAEFHAFMVGRWPSLVRFAYGLTGDHGHAEDLAQAAL
FT                   AKALVSWSRVRRADDPDAYVRRILINLNRRRFRRRRVEEHVGGEAPEPAAPDSTDQLDQ
FT                   RATLIPALMELPPGQRAVVILRYWDGLTETQTAAILGCSVGNVRSQASRALARLRTNPR
FT                   LHDGSAS"
FT   gene            complement(129322..130161)
FT                   /locus_tag="Caci_0126"
FT   CDS_pept        complement(129322..130161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0126"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: aau:AAur_0159 type I
FT                   phosphodiesterase / nucleotide pyrophosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69081"
FT                   /db_xref="GOA:C7QHE2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE2"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ACU69081.1"
FT                   /translation="MSTSRVLVIGIDGTRLDFLDAEPTPNIDRVAGEGFLATVWVEDGT
FT                   PTVSGPCWATAVTGTTIERHHIGSNDFAGHRLAEHPDFLTVLTRDFGLHTYLAVGAWPP
FT                   LATPADHGPMFAAPSRLTFATFGQSAQACDQGDETITRDAERILATENIHAAFVYLGAN
FT                   DATAHDQGCGDLYRTAIRRTDARTGRLLAAVASRPDRATENWTFILLTDHGHLPEGGHG
FT                   GTTTPERTAWIAACGPGIQAGADYGTLRHVDVAAHVYAALGVEPEIVLDGKAFQTMH"
FT   gene            complement(130199..131221)
FT                   /locus_tag="Caci_0127"
FT   CDS_pept        complement(130199..131221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0127"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: sma:SAV_2089 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69082"
FT                   /db_xref="GOA:C7QHE3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACU69082.1"
FT                   /translation="MAGRAAALLAMRPDVAQAAFPAALRTRLDAVVEIDHGLVVTDFAE
FT                   PRARWALAGAEVLLTGWGCPPLDAEALDAAPNLRAVIHAAGSVKHHLSPDFWTRGILAS
FT                   SAADANAYPVAQFTLSVILLAGKRMFTMARHYAEGTYKPPSTSQRFGNVGRTVGVVGAS
FT                   RIGRLVLPMLAREGFEVLLADPTLSAAEAAALMPAPWAVELVELDELLRRSDVVTLHAP
FT                   SLPETHHLLDDRRLGLMRDGSVLVNTARGALIDTEALVRCCAAGRIDAFLDVTDPDEPL
FT                   PPGHPLFLLPNVVVTPHLAGAMGSEIALLGAYAVADVERYAAGLPLLGGVHQDDLARIA
FT                   "
FT   gene            131505..132464
FT                   /locus_tag="Caci_0128"
FT   CDS_pept        131505..132464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0128"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1453 putative
FT                   transmembrane lipoprotein LplB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69083"
FT                   /db_xref="GOA:C7QHE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69083.1"
FT                   /translation="MAATAAAAAAPAAAKPRAGTRWARFRRDKVLLLMMLPGVLYFGVF
FT                   QYLAQLGNIIAFKDYVPFVGIKDSAWVGFQQFSTLFADPDFWHAVRNTFELALVQLMFF
FT                   FPVPLALAMFLFSLTRNWVRKLVVSFVYLPHFISWVVVVGLFVQVLGPSGMVNSFLTHD
FT                   SHHVVVNVFRDPAWFKPMMLIELVWKDCGWGTIIFLAALYQVDDSLYEAVSLDGAGWAR
FT                   RTWHVTLPSIRPVLVLLLILRVGDILSVGFDQVMQQRDTFTPAAAEVIDTYVYNHGVGS
FT                   GQFSVAAVAGLLKGVVAMVLVIGANKVAHKLGEQGVYQ"
FT   gene            132461..133360
FT                   /locus_tag="Caci_0129"
FT   CDS_pept        132461..133360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0129"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1454 putative
FT                   transmembrane lipoprotein LplC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69084"
FT                   /db_xref="GOA:C7QHE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69084.1"
FT                   /translation="MSAESPNLRPAWMGRPKPAVSALKAAAVVVILALIAVPFWLVLAT
FT                   SVSSDAEVNANGGWSLWPDKLDFSAYTNVFQGGTIGHALWVSVLVTALGTAASLASTTF
FT                   LAYALSRPNVVAGKPILLAVLFTFLFPAGMIPSFLVVTDLHLFDHLAALFVPVMINVFN
FT                   LVVMRGFFQGIPEELYEAARLDGAGDLRTLFRIVLPLSKAIIAVVGLYYAVGYWNDYFR
FT                   AMLYTNGGSLNPLSTVLRGFVIAGNNPNAEAGVDITGIAPMKAISALVVIAIVPIAAAF
FT                   PFLQRYFTKGVMTGAVKS"
FT   gene            133375..135060
FT                   /locus_tag="Caci_0130"
FT   CDS_pept        133375..135060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0130"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: aau:AAur_1455 putative lipoprotein precursor LplA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69085"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69085.1"
FT                   /translation="MPFTSTAQQISRRTVLRTTGAAAVAAVAVPALAACGGSKTSSGAA
FT                   QSNVDKKLMAWPTYTPAAGLHPDMPGTAAGVQDTFLRYPSNLIQSVPAKPGDGSKVRAL
FT                   IVTYGTQPKGPDQNQLWKAVNDAVGVDLELTMVTDADWQTKLGAMMAASDLPDIIMLGL
FT                   YQLPNEAQFLQAKCEPLGQYLAGDAGAKAYPNLAAIPPYSWDSVGRVGGDFYGIPIHRP
FT                   RLGNSFFADSDLFQQAGIWNPKPGGLSKAELTAGLMKLNTQGHFALGTNKVASFGYLTH
FT                   SGVHGTPNLWSLANGQFTTAYGTDSMKQSLATMADWYGKGLYDPAALTVSSTQCKTDFQ
FT                   NGTYVTTTDGFGGFGGYATAVNEKWKVDFVRPFDAGTGAKPTPWLTPGYFGYTVLKKTT
FT                   PERAKMLLGVLNFLAAPFGSKEWELINYGLEGVHFNRGADGGPSAPTALGKIENSVNVP
FT                   VKYVMAAPLVNYLAGEPEAAKRCYQAQVDIVPIGVTDPSLGVQSATRNKQWPTLLQQIQ
FT                   DGMNQIITGKAQLSSWDDVIKKWKSSGGDQIAAELGAEYAKTHG"
FT   sig_peptide     133375..133476
FT                   /locus_tag="Caci_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.733 at
FT                   residue 34"
FT   gene            135108..136808
FT                   /locus_tag="Caci_0131"
FT   CDS_pept        135108..136808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_5337 heparinase II/III family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69086"
FT                   /db_xref="GOA:C7QHE7"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69086.1"
FT                   /translation="MSYLAALEDEVRDVVARAAGSAAPELTYTLYRQFGDTGHRFSYEH
FT                   PYFERRGRLVAAGAAAIFDLRTDSAVSPEVLAVLADELWRICDEHTWALPAHEQYARDG
FT                   DMRRNVDLFAAETAHTVADLIERFGKQLPEDVIMRCREELLDRVFIPFADDQRPMAFEK
FT                   MTNNWLAVVAGGVGMAALAFFPDDAKRLAMILKRAQKSLRRFIEYYPADGGCSEGMDYW
FT                   VYGFGYFAYFAEAWRERGGPDLLLDTKIREIAAFPARVGFGDGRFPSFSDGSETATIPT
FT                   GLMARLVERLGVPVPRIETVPTFASDFCHRWPHLSKNIEWTTERVLNRAASPGVSYLPD
FT                   LAWVVDCGGEAEFAAKGGHNDEFHNHLDVGQFILRAHSETFLADLGAGEYTADYFGTKR
FT                   YQHVHTAAEGHSLPVIDGRGQLPGAQHAAKVERFAETGQGAILTLDMTSAYEVPGLLAL
FT                   GRRFTWQRHGSLVVVDRVETDRPMPFEELYISRIRPVLEADRVVWEGEAARCVLTWQET
FT                   LAMTPELETIETTGHRGELESVFRVRLRCMIEAGASRLESVFTVERKER"
FT   gene            136808..138706
FT                   /locus_tag="Caci_0132"
FT   CDS_pept        136808..138706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69087"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE8"
FT                   /inference="similar to AA sequence:KEGG:SAV_2106"
FT                   /protein_id="ACU69087.1"
FT                   /translation="MAGALDVPEDRRASPYTGWTREHWLAQADHLLDSVKPFASPSSAR
FT                   FELPGRPSVSGFDSDALEGFARTFLLAAWRIVADQGRGPVAEDLIARYSSGLAAGADAA
FT                   HPEAWPRIPQGRPGQPMVEAASIALGLHYTREWLWDKLDTRAQGLVADWLGEFVGNPTW
FT                   PNNWMLFQTVTEEFLSSIGAEYEESEILRGLDATEEWYVGDGWYTDGAGRNFDYYIGWA
FT                   MHLYPLVWTQMAEGGARNDRALAAREVYRDRLRQFLERYFDFFGADGAPIHQGRSLTYR
FT                   FAAAAPIWVGEMFDCSPYGAGLSRRAASGVMKHFAEHGAPDERGLLTLGWHEPFLPMVQ
FT                   NYSGPASPYWASKGFIGLMLPADHRVWTAPESPLPVEVADFETAIGPVGWSLSGTKRDG
FT                   VVRLLNHGSDKARHHTTPLAEYTDAFYSPLAFSTVTAPDTEAEAWAKRVGNHVALIAPD
FT                   GRVTSRAVIEPIGAAAEWGASRHVPGFEEEPGGTVRGVEGAEIETQTFVKEGAEIRVHR
FT                   VTAPAGWTVREGGYPVAGPEQVLRGENEKLPGAFAINDLGVMSRIESLGGWTSAGVESE
FT                   LGANALGAFSGTPYLMAEHPGGTVFYRSKVMVYRLPDEGVDEGADESVDEGGEVAE"
FT   gene            138703..139476
FT                   /locus_tag="Caci_0133"
FT   CDS_pept        138703..139476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0133"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sma:SAV_5310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69088"
FT                   /db_xref="GOA:C7QHE9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE9"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69088.1"
FT                   /translation="MSWPLAFSTLGCSGLPLADVVELARSTGWLGLELRAADDEPVHVG
FT                   LSPEERVAARALLESGGVTVLAVASYVKVARGEIGDDECVADALAHADLARDLGAPFVR
FT                   VFPGAEEPGADADARAVRRLNAIAERLPEGVAVLLETHDSHPQGVDIARVLSQVSGDVG
FT                   TIWDVMHPWRTGEPISVTKDVLAPYLRHVQVKDVLSPTERTPLPLGDGTIPLAEFYAAL
FT                   RELGYQGWMSLEWESKWHPEAVPLADALKVKPDFA"
FT   sig_peptide     138703..138759
FT                   /locus_tag="Caci_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.890 at
FT                   residue 19"
FT   gene            complement(139484..140566)
FT                   /locus_tag="Caci_0134"
FT   CDS_pept        complement(139484..140566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0134"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: rsa:RSal33209_0109 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69089"
FT                   /db_xref="GOA:C7QHF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69089.1"
FT                   /translation="MPRRPEADRDSTTPRAATIRDVASRAGVSVATVSRVLTGNYPVAS
FT                   ATRTKVLRAVRELDYVVNAHARALAGNRSKMIAVLLSNLTSPFYNRVASGVEQQAMAED
FT                   RLCMVSTTGGDPEREVKLVETLREQNVDAVVLVGGVVDSPEYRDHMARLARLLDSAGSR
FT                   LVICGRPSPGENLPVTVVEYDNAGGAFAATSHLLSQGHRRILFIGGDEANTTTRDRLDG
FT                   YRRAIQAYGIEADPALVIVGNQLPPFAYAELKKRLAAGPPDFTAVFAWDDHIAARTLVA
FT                   LRESGVSVPDQVSVIGYNDEQEAQDLYPALTTVSIPHMELGREAVRLALHRDEAAAPNQ
FT                   HVVLGTHIVMRDSVRPLINR"
FT   gene            complement(140607..143765)
FT                   /locus_tag="Caci_0135"
FT   CDS_pept        complement(140607..143765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0135"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: sco:SCO6193 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69090"
FT                   /db_xref="GOA:C7QHF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU69090.1"
FT                   /translation="MIGHGELVADLTARAADAVPTVLTAPPGRGKSALLDAVAEPWIAR
FT                   EDHVVWLTAAPTDRDVPFAALTDLLTEAPDLPEPWLAALKQALRRIPGTPDRVAIRLAA
FT                   RACLDAAIPPDKGVLLLADDLQWWDADSLDVLAHLARHGIPVVAATRPGGPVDLLGRDA
FT                   QEVPVPALTAEQTATLLQERGIGFRIAARVHTAAGGNARLTVEIARGFDATSGALDAVT
FT                   TPAAARRCIRGWIDELPTPDNVWRTLLIAAIAADPAIPTLRRTAGPATLEALACAEQAG
FT                   LITVDVHGTVTFPATAVRDTVLADASQETLRTAHLLLAETTTDPTARLWHRATAARDRP
FT                   DLEVASELAIAARAVRRRGDPGRAAELWLLAAEMMPARETMAETTDASNGSLAPLPAPV
FT                   SGTADRTQHADQQPVARDASAARQHATHAQPSSGPTATTGSLSAPDASTTRHQAATAQP
FT                   ADTPPQTADFPTRATRQPAATSQPISDPTPATSFFTALDASDTRQPAASSAPAGRPSTT
FT                   AASTDQPPRPPASRTTPRPTAVAALLLAAATDAAAAGRPHLARTAVARLDRTESDHAAR
FT                   ARARLAVVDAAGQAVGGLDGILGRALADAEAAADPALLSAVHLRVAWHAHLALGDNRRA
FT                   HDAARAAVRAAELSQDAESRAAALVMLARIEQLLGESSYPRVLRRALALSPEPPGALLN
FT                   SPRWLSVRFALFADQLDEARHHLSQLTSHAERSGSHADRALLLRGAVEIDARAGHGAAA
FT                   IRSARRLEELPGADRASPGPVWFTAALAQTAGGTLEEALRLADRGTAASAQEQDQIFLT
FT                   RCLALSGGIRLLLRDTAAAADDLNRVRTLVAEQGIADPAAVRFHADLAEVLVSLGQPDE
FT                   AAVIVTETRRAAEELRRRGVLASLDRADAVIKASQGDHARAEALLHRADHTFHTLGLPL
FT                   ERGRVLLTRAIIDKRRRRAASARRFHDQATAIFQRAQAPLWEPAEVVTETPGPAHGPGQ
FT                   GPAPDLTAAEQRIVALVTEGLPNREIAANLFLSVKTVESVLTGVYRKLGVRSRTQLAVL
FT                   LRDD"
FT   gene            144022..145890
FT                   /locus_tag="Caci_0136"
FT   CDS_pept        144022..145890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0136"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: sma:SAV_5630 neutral
FT                   zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69091"
FT                   /db_xref="GOA:C7QHF2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF2"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69091.1"
FT                   /translation="MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCK
FT                   HAPHSHKHGVQPTETQTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFY
FT                   GSQWGTQTAGSNGVSSFSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGA
FT                   TSCPSNAAFVPYQSGGVLAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRN
FT                   AYYVILSPTGTNPDDYENPSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAG
FT                   QTCGTNFVNSGSAGTLDGYTMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAW
FT                   LKPGTTGGAANVTLGSDTFAEQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTV
FT                   GSAVSLQIQASDSTSGQTLSYTATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTT
FT                   GASGSATFGWTVNSTTGGGTVITNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGN
FT                   LNPSSTSTIAQTFTAGAGNSRLAFWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTC
FT                   TNPTSGWKQVTAAVTAGDSYTLTLSNHDDNYAGDPTYTLYDDVAVS"
FT   sig_peptide     144022..144132
FT                   /locus_tag="Caci_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.596 at
FT                   residue 37"
FT   gene            complement(145960..146790)
FT                   /locus_tag="Caci_0137"
FT   CDS_pept        complement(145960..146790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0137"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: tfu:Tfu_1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69092"
FT                   /db_xref="GOA:C7QHF3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF3"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69092.1"
FT                   /translation="MKLSLNQATVKRLTLAEAAEGCVRAGIPAIGLWRDRVQEIGIEAA
FT                   AKIVRASGLEVTSLCRGGFMTAASAADRAAALADNKQAVLEAAGVGTDVLILVVGGLPS
FT                   GSKDLPAARGAVAEGVADLVPFAAEHGVKLAIEPLHPMFCADRAVVSTLGQALDIAEAF
FT                   PAEQVGVVVDTYHVWWDPQLEASIARAGKGNRILSYQECDWVVPLPADMLLGRGHVGDG
FT                   HIDFARMRSLVTAAGWTGYAEVEIFNQEIWDADGDRTIATVRSRHEAVSAASGL"
FT   gene            complement(146787..146894)
FT                   /locus_tag="Caci_0138"
FT   CDS_pept        complement(146787..146894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69093"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69093.1"
FT                   /translation="MNSLELFRLRPSASGSGIGARVRSLPVTGLAAVPA"
FT   gene            complement(147112..148188)
FT                   /locus_tag="Caci_0139"
FT   CDS_pept        complement(147112..148188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69094"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF5"
FT                   /inference="similar to AA sequence:KEGG:SCO2751"
FT                   /protein_id="ACU69094.1"
FT                   /translation="MAGFTSRVVYAAAHVVADPEADNRAGKPAVLDWDATLRFREHLWS
FT                   LGFGIADAMDTAQRGMGLDWSATQELIRRSGAAAKAVDAGNVPTLLACGAGTDQLSAGA
FT                   HSLPDIRAAYEEQLDVVEAAGARVILMASRALAASARSAEDYLTTYRALLDQAANPVIL
FT                   HWLGDMFDPALAGYWGSADIPTAMATVLELINANPQKVDGIKISLLNADHELELRRRLP
FT                   AGVRLYTGDDFNYPQLIKGDTTGHSDALLGIFDGIARPAAQALQALDRGDLQTYDRLMN
FT                   PTVALSRHIFEKPTFHYKTGLVFLAYLNGHQAHFRMVGALETARDTTHLTKLLHLAEAA
FT                   GVIDDPELAAQRFAAVVA"
FT   gene            complement(148197..149357)
FT                   /locus_tag="Caci_0140"
FT   CDS_pept        complement(148197..149357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0140"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: sgr:SGR_4813 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69095"
FT                   /db_xref="GOA:C7QHF6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU69095.1"
FT                   /translation="MTRETVGIAMNGVTGRMGYRQHLLRSILAIRDQGGLALPDGRTVW
FT                   PEPILVGRNAEKIEALATRHGLDKWTTSLDEALADPSVTVYFDAQVTQARVPAITRAIE
FT                   AGKHIYTEKPTAETLDDAISLARIADAAGIKHGVVQDKLFLPGLLKLKRLVDSSFFGRI
FT                   LSVRGEFGYWVFEGDWQPAQRPSWNYRAEDGGGIILDMFPHWRYVLDHIIAPVRSVYAE
FT                   ARTDIPTRWDEQGREYKATADDAAYALFELEGGIVASLNSSWTTRVNREELVEFQIDGT
FT                   HGSAVAGLRNCKAQHRAATPKPVWNPDIPATEDFLAQWQEVPDNAVMDNGFKVQWEMFL
FT                   AHLVADAPYSHDLWAGARGVQLAELGAQSWREGRKVAVPELDRTGK"
FT   gene            149451..150509
FT                   /locus_tag="Caci_0141"
FT   CDS_pept        149451..150509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0141"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: tfu:Tfu_1710 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69096"
FT                   /db_xref="GOA:C7QHF7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU69096.1"
FT                   /translation="MSTQRSTPSPAPRRGGATLQQVADAAGVSLATASRVLNGSTRTVN
FT                   PELSEHVREVATRLRYVSHGPAQALARATTSLVGLLVHDVNDPYFSAVAAGAMRVARER
FT                   DLLVMVANTYRDPELELDYITRLGAQRARAILVAGSPPVDPALAKPLRERLLDYQQGGG
FT                   RVVSIGDQGPDIDAVLPANVEGARAAALHLTALGHREIGMVAGPRGLVTIADRSEGFRS
FT                   GLMDSDGDPVGHEIEGAFTRDGGYDATQRLLAAHPDVTAVFVMADVMAIGALAALRDAG
FT                   RRVPDDVSLVGFDDLPICADLMPALTTVRVDTEGMGEQAMRMVVSEVQDEGRAVVHSAT
FT                   ELIVRGSTGPAA"
FT   gene            150596..151456
FT                   /locus_tag="Caci_0142"
FT   CDS_pept        150596..151456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0142"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sgr:SGR_4335 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69097"
FT                   /db_xref="GOA:C7QHF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACU69097.1"
FT                   /translation="MPVVLSAAFLHASWNAILKFVSDKLTASLLMTVSSGVLAAIGVFL
FT                   LPAPDRASWVLLLVSAALHVGYFLMLIKTFEIGDFNQVYPLARGLSPVVVAFFATALGD
FT                   PMSRHQTVGIAVVCGGLTTLVFSAGRPKRAQGKALFWAAMTGLSIATYTVTDGVAVRHS
FT                   KTAAGYTAWMMLAESTLMTAACVAIMTRRGRVSTAAGLLPTLRKLSRGDVLRGVIAGAL
FT                   SLFAYGLVLWAQTRGALAAVSALRETSVIFGAALGSVFLREPFGRYRIFAAVAIAGGIL
FT                   ILEAA"
FT   sig_peptide     150596..150715
FT                   /locus_tag="Caci_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.860 at
FT                   residue 40"
FT   gene            complement(151637..152257)
FT                   /locus_tag="Caci_0143"
FT   CDS_pept        complement(151637..152257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: sco:SCO5749 two-component
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69098"
FT                   /db_xref="GOA:C7QHF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69098.1"
FT                   /translation="MNDAHRASAPSDGDIKILLVDDRPENLLALESILGSLGHELVTAA
FT                   SGEQALRAVLREEFAVILLDVRMPGMDGFEVAAHIRLRERSRDTPIIFLTAAGDGPHQT
FT                   LRGYAAGAADYLTKPFDPWVLRAKVGVFAELHRKNRQLKEQAEMLRETAGVTPRMLDEL
FT                   SNRLGAIEGTLALLIDQSGREGPVGRLERRVVRMRAALDAVRV"
FT   gene            complement(152254..155613)
FT                   /locus_tag="Caci_0144"
FT   CDS_pept        complement(152254..155613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0144"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: sgr:SGR_1773 putative two-component system
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; GAF domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; response regulator receiver; histidine
FT                   kinase A domain protein; GAF domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69099"
FT                   /db_xref="GOA:C7QHG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG0"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACU69099.1"
FT                   /translation="MTLQSDARTDPELDRQLGAILEVAQAVARGDLSRKIALSGDIVDG
FT                   PVAELARTIDAMVGQLSGFASEVIRVARELGTEGRLGGQATVEHAEGIWRDITDSVNSA
FT                   ARNLTAQVRDIAGVTTAVAQGDLTQKITVEVAGEMLELKDTINTMVDQLSGFADEVTRV
FT                   SLEVGTEGRLGGQARVPGVAGTWKDLTDSVNSMADNLTTQVRNIAQVATAVASGDLTQS
FT                   ITVDARGEILELKTTLNKMVDRLGTFADEVTRVAREVGTEGKLGGQATVRGVAGTWKDL
FT                   TDNVNAMANNLTSQVRNIAQVTTAVANGDLSKRIDVEARGEILELKTTLNTMVDRLSAF
FT                   ASEVTRVAREVGTEGKLGGQATVEDVSGTWQRLTESVNELASNLTTQVRAIAEVATAVT
FT                   AGDLTRLITVEAKGEVADLKNNINQMIGNLRETTRRNDQQDWLNTNLARMSGLMQGQRD
FT                   LDAISALIMSELTPLVNAQYGAFYLARKESGTKVLNLIASYGVDRESPDVTSRFRLGQG
FT                   MVGQAAVERKPIMIQHAPVDYIRISSGLGSAPPSSVAVLPVLFENEVMAVIELASFHSF
FT                   DEVHRALMESLMEMVGVTVNTITANTRTEELLGESRRLADELKARTDELQMQQKELRRS
FT                   NAELEEKAELLARQNQDIEVKNSEIEQARQELEERANQLTMSSRYKSEFLANMSHELRT
FT                   PLNSLLILARLMSDNAEGNLTERQVEYAETIHGAGSDLLQLINDILDLSKIEAGRMDVQ
FT                   PARIAVSQLVDYVEATFRPQTEQKGLELRVRVAPSVPAHLFTDEQRLQQVLRNLLSNSV
FT                   KFTETGHVELVVDTVGDVVLGGPEDSNEVTLEPAVSFAVSDTGIGIVDDKIQTVFEAFQ
FT                   QEDGTTSRRYGGTGLGLSISREIAKLLGGGIRAESQRGRGSTFTLFLPHAVGPDGAAVF
FT                   GSTGSLGYGTSPGPTGAIAEPAPTLPMIPEQAPHPDLYLPSTDLHAAGSDITFDGEKIL
FT                   IVDDDIRNVFALTSVLEQHGCAVLNAENGRAGLEALERADDVALVLMDVMMPEMDGYAT
FT                   MAAIREIDRYKNLPIIALTAKAMRGDREKSIEAGASDYVTKPVDTPHLLTVMRGWLDAE
FT                   TGAQPAPGGPAQ"
FT   gene            155821..157098
FT                   /locus_tag="Caci_0145"
FT   CDS_pept        155821..157098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0145"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: sgr:SGR_1774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69100"
FT                   /db_xref="GOA:C7QHG1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG1"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACU69100.1"
FT                   /translation="MAPRTPRTPLPRDRPEEAVRLTLLSQAGELLAGTLDRRRLAALAS
FT                   QLIVPRLADWVALYPPAADHSIVSSSWSPEHLWHREERKLDALAAALADWHPPTGEDGH
FT                   VPGSGSGRWPVQVASPYGQALPIPLAARGVSLGTLVLGGPGKGGFAGATLPLLMELAGR
FT                   ISGALDNARQYAEQVEIVRGLQRSLLPPSLPTVDGLDIGVVYEAASNSDGVHVGGDFYD
FT                   VFPISRKVWGFAVGDVCGTGPEAAALTGLARHSLRLLAREGRSPVTVVERLNQAVLEEG
FT                   ELAGDAGRFITLLYGEVEPRPDGSAQLVLVCAGHPLPLVLRQDGSVRAAANPQPLLGVL
FT                   PDPTLYAEDVELGAGEVLLVYTDGASERRNGRQMLGDEGVAAALAGCSGMTAPGVVARV
FT                   RQAVADFGSSGTRDDLALLALRAYKG"
FT   gene            complement(157217..158200)
FT                   /locus_tag="Caci_0146"
FT   CDS_pept        complement(157217..158200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69101"
FT                   /db_xref="GOA:C7QHG2"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69101.1"
FT                   /translation="MTELDTREDDWARGVFDRARTGRHEPHWAPDAAGAARLSKRRQTR
FT                   YRATGALAVMAVAGLSATAFTALGGNVFHARDTVSPGSSGPILWPGLDLTKYLDVHESY
FT                   MVAAGHQYEANRMPAVSLATTSTVLQRLDPGLKHVRTVSGHQDLDITPTPPGVTTMAVQ
FT                   ADGIWSPNGDLSTFPPASSNFSPVTTPFGYVSIATMGPHVAQDANMENKPCGLGTLVTS
FT                   TRIPAPTAWSPCVRSHQSDGSDILVTHAVNLPAGAVTVAARVFPDTSTVQVTASSVFGL
FT                   QEGPAAGSSTPATPAKFDAGPPLNPVPWTDDSLAQVLTGPDVKGLP"
FT   gene            complement(158225..158737)
FT                   /locus_tag="Caci_0147"
FT   CDS_pept        complement(158225..158737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0147"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_7161 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69102"
FT                   /db_xref="GOA:C7QHG3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG3"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69102.1"
FT                   /translation="MDKSYEAEFAELVAAKGAALRRTAYLMCADWHLAEDLVQTVFVKV
FT                   HLHWRRIKRQETFDAYLRTTLFRAYLDTRRAKWRRETPAEYLPELEAPGTEPGDDRDVL
FT                   VAALRRIPPRQRAVLVLRYWEDLSVEETARLLGCAAGTVKSQAARGLAALRPLLAGTPF
FT                   ESVTAEH"
FT   gene            complement(158807..160081)
FT                   /locus_tag="Caci_0148"
FT   CDS_pept        complement(158807..160081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0148"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   nca:Noca_4538 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69103"
FT                   /db_xref="GOA:C7QHG4"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG4"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACU69103.1"
FT                   /translation="MTHPAPTPLIDTDRWPDLARVPDRPVRARIARRLFTHALKDVPVT
FT                   VVAPNGLALAGAGVPGGGGPVLRVRRPKEFLNRLGSDGLIGFGEAYQTGAWDTETGDEL
FT                   VALLTELASRLEDLVPKPLQRMRSLAAHHMPRDQDGDRHGARHNAHAHYDLSNDMFEAF
FT                   LDPSMTYSAALFDPVADADGPGDLHAAQLRKIDAMLDAAGVRKGTRLLEIGSGWGGLAI
FT                   KAAGERGATVLTVTLSEEQQELARRRIAAAGLAGRIEVRLADYREVAEEQPFDAVVSVE
FT                   MIEAVGRRYLPDYFQAIERNLARGGRVAVQAITMAHHRMLATQDSYSWIHKYVFPGGLI
FT                   PSIPELDFAAETAGLRLAARRDFGLDYARTLRAWRHRFEENWPKVAGHGFDEVFRRTWR
FT                   FYLAYCEAGFASGYLGVSQLTYTRP"
FT   gene            complement(160146..160928)
FT                   /locus_tag="Caci_0149"
FT   CDS_pept        complement(160146..160928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69104"
FT                   /db_xref="GOA:C7QHG5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG5"
FT                   /inference="similar to AA sequence:KEGG:SGR_2642"
FT                   /protein_id="ACU69104.1"
FT                   /translation="MSREEIHPASEPRLDPPVHPVRGGVVGVVLLAHGGKETSHEAPHR
FT                   RGGPVTRMRMIARAVAPRLAGRGVAVHTMCFRYQGWNGAERAPVPDVWWAAARLTERYG
FT                   EVPLVLAGHSLGGRAVVNAADAPGVVGVLGLAPWLPAQEPTGQLAGRRLLLAHGTRDRV
FT                   TSPRSSYEYAARARAEGHDVARIVLPGSGHTMLSRARDWNRLVLAFSHTCLLEQHVVAA
FT                   DANRTRPPRYADVIAEAFQAAAPEGLQRVLTPAGRVRS"
FT   gene            complement(160949..161347)
FT                   /locus_tag="Caci_0150"
FT   CDS_pept        complement(160949..161347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0150"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   blj:BLD_1980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69105"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG6"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACU69105.1"
FT                   /translation="MTGPATPETYRAIAELDGEWWVVTVPDLRGVYTQGRTYEQARAMA
FT                   RDAIATMLDTAPDRVAVAMEVRLPGHAEDTISEVARARAARDEAAAAEQRKLRESARRL
FT                   KAAGVKVVDAAVLLGVSKQRVYQLLTDH"
FT   gene            complement(161344..161532)
FT                   /locus_tag="Caci_0151"
FT   CDS_pept        complement(161344..161532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0151"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: mar:MAE_55720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69106"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG7"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACU69106.1"
FT                   /translation="MKRRDLLKALSDIAAEASVDFELVRHGGSHDIYRVGALHLTIPRH
FT                   TEISELLAKKILKEASQ"
FT   gene            complement(161660..162997)
FT                   /locus_tag="Caci_0152"
FT   CDS_pept        complement(161660..162997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0152"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: fal:FRAAL6227 putative NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69107"
FT                   /db_xref="GOA:C7QHG8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG8"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACU69107.1"
FT                   /translation="MGKASGNGKAIPRILIVGGGYVGMYTAHRILKKLGKDEALVTVVD
FT                   PRSYMTYQPFLPEAAAGSLSPRHVVVPLRSVLKRAEVLTARVTDIDQNRKVATIEPIAG
FT                   EPYELEFDQLVIAVGSIARTLPIPGLAENGIGFKQIEEAIALRNHVLGQMDIAATTKDE
FT                   KIRRRALTFVFIGGGFAGIEAIAELEDMARDACKIYPNIRPEDMRWVMVEGSGRILPEV
FT                   RPALGEYTVHELEKRGIQVKLNTFLESCVNRRVQLSDGTKMVASTIVWTAGVKPNPVVQ
FT                   RFGVPLGERGHVKAGATLQVEGFADVWSAGDGAQVPDLANPGKWCSPSAQHAVRQAKQL
FT                   ADNVVAAVRGFEPREYKHKHVGSVASLGLHKGVADVYNIRLRGWPAWFMHRTYHMSRVP
FT                   TFNRKIRVIADWTLALFFRREAVGLGSIERPRDEFAEAAGEQRKAA"
FT   gene            complement(163334..164290)
FT                   /locus_tag="Caci_0153"
FT   CDS_pept        complement(163334..164290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0153"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sma:SAV_3530
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69108"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG9"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACU69108.1"
FT                   /translation="MTKRVAAIDCGTNSIRLLIADVHPRTGRTEDVVREMRIVRLGEGV
FT                   DATGRLAPAALERTFAACLEYQDLIERHSGGTPIPLRFVATSATRDAENRREFVEGVKG
FT                   ILGVEPYVATGDEEARFSFTGATSELPHDRHQAPYLVIDIGGGSTEFVLGDAERGVIAA
FT                   RSVDMGCVRMYERHLKTAGVATEAQVKAARADIEKLIDRAAEAVPLDEARTLVGLAGTV
FT                   TTLGAVALDLDEYDSERIHLSHIPLGRVRDITTRLLGLTPDERKAIPVIHPGRADVIGA
FT                   GALVLLAIMERVAPSLAAPEVVVSERDILDGIAASIA"
FT   gene            complement(164306..164869)
FT                   /locus_tag="Caci_0154"
FT   CDS_pept        complement(164306..164869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0154"
FT                   /product="protein of unknown function DUF501"
FT                   /note="PFAM: protein of unknown function DUF501; KEGG:
FT                   sco:SCO3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69109"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH0"
FT                   /inference="protein motif:PFAM:PF04417"
FT                   /protein_id="ACU69109.1"
FT                   /translation="MTNDAPTPDTSRPAPAAAPEADAVSQADLAAVEAQLSRTPRGVRR
FT                   VAHRCPCGNPDVVETAPRLPDGTPFPTLFYLTCPKAASAIGTLEASGLMKEMTERLKTD
FT                   PELAAAYRAADEEYRARRDAIEVLDGFPTAGGMPDRVKCLHVLVGHTLAAGPGVNPLGD
FT                   EALALLPEWWKSGPCVTPSEEPGA"
FT   gene            165051..165470
FT                   /locus_tag="Caci_0155"
FT   CDS_pept        165051..165470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69110"
FT                   /db_xref="GOA:C7QHH1"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH1"
FT                   /inference="similar to AA sequence:KEGG:SACE_1821"
FT                   /protein_id="ACU69110.1"
FT                   /translation="MLPALRVVAVLHALSFIVQPVLAGLFLSGQDTAVDMHATNGMIVV
FT                   TLCLVMTILALPVWRRGLLPRAAFTTSAALLVVEVIQMMVGFTHIMWLHIPLGVLMMGG
FT                   VAQLMPLVMRPYRPSAERTAAAGAVVAFPAVEAGE"
FT   gene            165467..167053
FT                   /locus_tag="Caci_0156"
FT   CDS_pept        165467..167053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0156"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; multicopper oxidase type 1; KEGG:
FT                   sen:SACE_1822 spore coat protein (outer)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69111"
FT                   /db_xref="GOA:C7QHH2"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH2"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ACU69111.1"
FT                   /translation="MSGPRLSRRGALRLFGGAGAVAVLSPTLAGCAKPGNDGINPGTLS
FT                   SKAKLPKPFSIPLPILKPLAPDSTDAQGVHYSMTLKQAEVEILPGYRTKIFGYNGTFPG
FT                   PYLDVHAGTPMVVHQTNQLPVPIVTHLHGGLTPPSDDGFPTDLVFPQALADMADPGMAA
FT                   SMAGMDGMPSMKDPLAHLTAVQRDYVFPLNQRASTLWYHDHRMDFSGVQVWRGLFGLCV
FT                   LRDAEDDKLPLPKGEREIPLMIADRAFDADGQLIYPEKDPTLLGKPSMDKSIAAGAQGD
FT                   VILVNGAPWPYLEVAAVKYRLRLLNASNARRYELKLDGPGGGEFVQVGSDGGLLAAPLT
FT                   HSTLHMSPAERFDVVVDFSKYPVGSTVTLKNSAASGGPGQVMQFKVTSHAADDSSVPAT
FT                   LSTIEKLTVNGAKRRLVFALDGDQWHVNGKAFDPAHPLVKPEFGKTEQWTVTSVERHPV
FT                   HLHGAHFQVTGRGSGGLGEYDHGWKDTVELSPGSEITLAVRFDSYRGRYVAHCHNLEHE
FT                   DMGMMATIQVV"
FT   sig_peptide     165467..165565
FT                   /locus_tag="Caci_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.640 at
FT                   residue 33"
FT   gene            complement(167197..168402)
FT                   /locus_tag="Caci_0157"
FT   CDS_pept        complement(167197..168402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0157"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; SMART: GAF domain
FT                   protein; KEGG: sma:SAV_4257 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69112"
FT                   /db_xref="GOA:C7QHH3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH3"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69112.1"
FT                   /translation="MSESRESPEIADLREALAASRRRESWLSAAADVITLMLIAVDPHE
FT                   VLTLVAERAREASGADHCSLLLQHVDGSWRIDVATGLAADQVRGAFVEPHRRSVQVAVT
FT                   GRALALEAGDVDPEELAPPFRRFGAIVYAALAQRDDRPIGTLVLANAPGGRTFDEEDAR
FT                   LATAFAHQAGLALALTEARAAEDRLAVYADRERIARDLHDLTIQRIFAAGLSLQTLSRR
FT                   LNSPGPDLPAAAGRLDGVIDELDAAIAEIRTTIFDLQLTADQEATSTRARVLREASRAA
FT                   RVLGFEPSVRFTGPLDSLVGGDTGAHLVAAVRETLANAAKHAGATRVEVVVTVETGPAT
FT                   TLTLDVLDDGGAPMPRWRPNPRTARQGLSNLAARARELGGSFHAGPADGDRGTRVSWRV
FT                   PL"
FT   gene            complement(168565..169635)
FT                   /locus_tag="Caci_0158"
FT   CDS_pept        complement(168565..169635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0158"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: sma:SAV_4261
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69113"
FT                   /db_xref="GOA:C7QHH4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH4"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU69113.1"
FT                   /translation="MADDVQTPKLREALRGIPAYKAGKNPDASAFKLSSNENPYPPLPG
FT                   VLEAVQKSAENFNRYPDMGCSALSSEIAERFGVPVEHVATGTGSVGVAQQLLQATSGPG
FT                   DEVIYAWRSFEAYPIITQISGATSVRVPLTPEEHHDLDAMAAAVTDRTRLIFVCNPNNP
FT                   TGVAISEDALVRFLDRVPSDVLVVIDEAYREFVRDDSIPDGVDLYRDRPNVAVLRTFSK
FT                   AYGLAGLRVGFAIAHEPVAAALRQTAVPFGVNSLAQVAAIESLRAEKLLLERCEALVQE
FT                   RTRVTEALREQGWTVPESQANFIWLRLGERTAEFAAKAEAAGIVVRPFAGEGARITVGE
FT                   VEANDILLRVTAEFQE"
FT   gene            169720..170865
FT                   /locus_tag="Caci_0159"
FT   CDS_pept        169720..170865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69114"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH5"
FT                   /inference="similar to AA sequence:KEGG:SACE_5011"
FT                   /protein_id="ACU69114.1"
FT                   /translation="MTLNGFAYGELSFGADGQPADPTQRGAAPAVALGADVTDLLVLSH
FT                   GWLDDPPRAQILYAGLTEAIVQAGGAPPGLAVLGILWPSKRFDAEPEVQVAATVAATDP
FT                   SGRAAESFVTRVRHRVGAQLELLPVTAEYANPGDHQATFFGLEPRALLEKFGSIEDGID
FT                   AVLNLSTYYEMKGRAGAVGKGLVPVLAAVREARPEVRLHLAGHSFGARVMASALANCEA
FT                   FPVSSVTLIQGAFSQFGFAKQWDGVHDGLFRPGLFGGRLKGPVVVTHSRHDHMVGLAYE
FT                   LASRMAGDQPDTTGMAGHVHVHDEYGAIGSHGALSTPESVWGTMLPVQGAGYAFPAGAI
FT                   SNLDGNAYIPNHYHVMTPEMGKVLVAAMTACEAEYGVAEAS"
FT   gene            170983..171954
FT                   /locus_tag="Caci_0160"
FT   CDS_pept        170983..171954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0160"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: bmj:BMULJ_02621 AraC subfamily transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69115"
FT                   /db_xref="GOA:C7QHH6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH6"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69115.1"
FT                   /translation="MSRRVVFLVFPRFQLLDLTGPLEVFSQADMLFSPGRQRYVTEVVA
FT                   LGAEPVTASDGLAVVPHRTLADAAELPIDTLVVVGGRGVRTAMTDPVYVEWVRAAAGRA
FT                   RRVTSVCSGTFLLAAAGLLDGRRAVTHWDSCEELAERFPEIRVEADPIFVRDDPLWTSA
FT                   GVTAGVDLALALVEDDLGAEVARRIAKQLVVFVQRPGGQAQFSTQLAAQRPGRDALRET
FT                   QTWIADHLDDNLSLAALARRAALSERHFSRVFRAETGMTVAAYVEAARIEAAQRLLEST
FT                   RDGLDRIARTCGFGTVETMHRTFNRTIRVTPGEYRRHFSSPR"
FT   gene            171991..172635
FT                   /locus_tag="Caci_0161"
FT   CDS_pept        171991..172635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0161"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sco:SCO6747
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69116"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH7"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACU69116.1"
FT                   /translation="MPRIAIPLFPGFMPLDVVGPYDVLRFLPDHEVVFVASDPGVINGA
FT                   DGGFGLQAQATPADIDTCDILLVPGGRGTRDHAARKDLTDWIARIHQTTTWTTSVCTGS
FT                   LLLGAAGILTDTDATTHWNAIPALESFGAHYTPERVVRRGKVVTAAGVSSGIDMALTLA
FT                   GLIEGDEFAQAVQLWIEYDPQPPHDTGSVAKAGADLTARTPGLIGGGGRRG"
FT   gene            172943..173746
FT                   /locus_tag="Caci_0162"
FT   CDS_pept        172943..173746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0162"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sen:SACE_3371 3-oxoacyl-[acyl-carrier- protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69117"
FT                   /db_xref="GOA:C7QHH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69117.1"
FT                   /translation="MDLGLRGRVAVVTGGSKGIGLAVVRTLLEEGAFVVAVSRAGSAGL
FT                   GEVGGPNLLHVAGDLMDAGFAAEVVEQTVAAFGGLDILVNNAGGPPPGVVLPRGPFLGG
FT                   GDVDWQAVFDFNLFAVVRLTRVALPHLIERGGTIVNVSSTLARQPATNNYEYSAAKAAL
FT                   SHVSKGLAEEFGPQGVRVNTVLPGVTRTNWWTDEGGVADMFAGAMGIDRDTLLDKALPE
FT                   SLRLSMGRIVEPQEVADAVVLLASPRSRSTNGSEFVVDGGLLKEL"
FT   gene            173877..175469
FT                   /locus_tag="Caci_0163"
FT   CDS_pept        173877..175469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0163"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: mjl:Mjls_4686
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69118"
FT                   /db_xref="GOA:C7QHH9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH9"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACU69118.1"
FT                   /translation="MPVLRSQLDPTSEAARADREAVLGALERIRELQQKVLAGGGEKYA
FT                   ERHRSRGKLLARERLDLLLDEDSPFLELAALAGTHDPAETVGGVSGIGTVSGVECMIGA
FT                   NDPTVKGGAVGPSGVAKQLRMLEIAERNRLPLISLTESAGADLPRQADIFVPGGASFKG
FT                   ISRLSAAGIPTLSIVFGSSTAGGAYVPGMSEFTVMVKNQAAVYLGGPPLVKMAINEDTD
FT                   DETLGGADMHARVSGLADYLARDERDAIRIGRQIIADLRWRKRGPGPTESADEPLYAAE
FT                   DLLSLAPMDLRRPVEVREILARVLDGSRFSEFKPLYGTTLVCGWGSIHGYPVGILANNG
FT                   ILFSEEANKGAHFVQLANAREVPLLFVQNITGFMVGSRYERGGIIKDGSKLINAVSNSA
FT                   VPHVTLMVGASYGAGNYGMSGRAYDPRFVFTWPNHRIAVMGGRELAGVMSIVQRQKAEK
FT                   AGQPYDEAADAQTREFVEAMVDGQSDAVYASGRLWDDGVIDPRQSRTVLGLALSAIDSG
FT                   PVVGTRAFAPFRM"
FT   gene            175557..177545
FT                   /locus_tag="Caci_0164"
FT   CDS_pept        175557..177545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0164"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; biotin/lipoyl
FT                   attachment domain-containing protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: mgi:Mflv_4614
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69119"
FT                   /db_xref="GOA:C7QHI0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI0"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACU69119.1"
FT                   /translation="MPTYPTFSTVLVANRGEIARRVFRTAKAMGLRTVAVYSDPDADAP
FT                   HVREADVAVALGGSTSAESYLDAAKILDAARKTGADAVHPGYGFLSENAGFAEACAQAG
FT                   IVFVGPSPDAIRKMGIKHEAKAIAKAAGVPVLPDALLTTDEPDDWRRSSEGVGFPLLVK
FT                   ASAGGGGKGMRLVSSVEELENAVSGARREAAAAFGDGTVFLERYLAASRHIEIQVFGDT
FT                   HGNAVFYGERECSVQRRHQKVVEEAPSSAVGAAVRAKMGEVACALVRELGYVGAGTVEF
FT                   LFDDTDDSYYFLEMNTRLQVEHPVTEEVWGQDLVRRQFEVAAGAVLTAPDPEALHGHAI
FT                   EVRLYAEDPARKYIPSPGTLALYEHADVPGIRYEDGVRSGSVVSHYYDPMLSKVVATGL
FT                   TRGEAALKLASALAGMRIQGLKTNRDQLVAILRDPDFLAGTTRTDFLDLHPALAAPEDR
FT                   TDVTAHLAAALAVSVHRRRSAGGATAFAPAGWRLLPYDGANAAWTRQDVRRAPETPITY
FT                   RFDSSTLYLIHGGAEYEVSLRDLGPDSVRVAVDGVDRLCRVRVAEDTVVWVDDSDGGHS
FT                   AWKPTPRFPEDADAFAADDGAAEVPGTVVAISVAAGDRVKAGQVLVSMEAMKMEHQVKA
FT                   GRDGVVGSVDCAVGQFVDAHQVLVTLT"
FT   gene            177622..178383
FT                   /locus_tag="Caci_0165"
FT   CDS_pept        177622..178383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0165"
FT                   /product="acyl-CoA synthase"
FT                   /note="KEGG: mav:MAV_3523 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69120"
FT                   /db_xref="GOA:C7QHI1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI1"
FT                   /inference="similar to AA sequence:KEGG:MAV_3523"
FT                   /protein_id="ACU69120.1"
FT                   /translation="MPATQSTETRDPVEFHWLGDIVRVNLDGNTHGSVLAYGAQEWDWT
FT                   EFDSRIRKCVTGIRSDRLQRGQRVAVLARNHPVHFETLFAASNMGLVCTWLDWRLDRAH
FT                   VVHALNESEARILFVGEEFLDLVEDSMMEISSVVSTITVGGPEDEYEEWLETHETHEAL
FT                   LRAAREVAASSGRGDEPVLRLYSSTGKKGPTRGEYTHRALLTSAVEILRRKSLTRGDVE
FT                   AVDAPVTVHEAAVRVLANMSAGAATVLVQEE"
FT   gene            complement(178394..179059)
FT                   /locus_tag="Caci_0166"
FT   CDS_pept        complement(178394..179059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0166"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_4377
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69121"
FT                   /db_xref="GOA:C7QHI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69121.1"
FT                   /translation="MSGKERREQLIEIGRTLFAERGFDATSVEEIATKAGVSKPVVYEH
FT                   FGGKEGLYAVVVDREMAKLLSMVTSGLTGEHARELLEQAAFALLDYIESSTDGFRILVR
FT                   DSPVTTSTGNFASLISDIASQVEDLLGVHFMHRGYDPKLAPMYAQMLVGMVALTGQWWL
FT                   DVRKPPKAEVAAHLVNLAWNGLSHLEGQPRLIVQEQAEAKVRRAARKTERAARADAKR"
FT   gene            complement(179179..180144)
FT                   /locus_tag="Caci_0167"
FT   CDS_pept        complement(179179..180144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0167"
FT                   /product="Stearoyl-CoA 9-desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="PFAM: fatty acid desaturase; KEGG: sgr:SGR_4378
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69122"
FT                   /db_xref="GOA:C7QHI3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI3"
FT                   /inference="protein motif:PRIAM:1.14.19.1"
FT                   /protein_id="ACU69122.1"
FT                   /translation="MTQTSVPQQQPTAPATVRGTRGGETQSFKERIALSFVIGVPFAAL
FT                   VIAVPVVWGWGMTWTDLIIAVVMYAISGHGVTVGFHRLFTHSSFKAKKALRVGLAIAGS
FT                   LAVQGPVIRWVADHRKHHRYSDHDGDPHSPWRYGETLPALMKGLWHAHIGWLYNAEQTN
FT                   QQQYAPDLLKDRAIVRVSRAFPYLVLVSLLLPAAVGGLVTWSWQGILTAFFWGSLVRIA
FT                   LLHHTTWSINSICHAVGERPFRSRDRSGNVWWLAVLSMGESWHNLHHSDPTAARHGVLR
FT                   GQIDSSARIIWLFEKFGWVRDVRWPSRERVALKLRGEAAP"
FT   gene            180370..180441
FT                   /locus_tag="Caci_R0003"
FT                   /note="tRNA-Gln1"
FT   tRNA            180370..180441
FT                   /locus_tag="Caci_R0003"
FT                   /product="tRNA-Gln"
FT   gene            180559..182085
FT                   /locus_tag="Caci_0168"
FT   CDS_pept        180559..182085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0168"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; KEGG: sco:SCO3122
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69123"
FT                   /db_xref="GOA:C7QHI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI4"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACU69123.1"
FT                   /translation="MTDQHAPTVIILAAGEGKRMKSATPKVLHELCGRTMLGHVVAAAQ
FT                   DLAPSRLAVVVGKGRDLVAPHVAAIAPEARIVVQEPQNGTGQAARLALEALVAEGGPAE
FT                   GTVLVLLGDGAMVTGGTLRHLIAVHESSGNAVTDLTAVVPDPRGLGRILREPDGTAEGR
FT                   VLGIVEEKDCTPAQATIPEINSGIFAFDGKLLRDALSRLTTDNAQGEELLTDVLAIAVG
FT                   DGLPVGAVVAADYHEVLAANDRAQLADLRRLMNQRITRQWMLEGVTIVDPATTWIDVHA
FT                   TLEPDATIRPNTQLEGATRIAAGADVGPNCTLRDTVVGERARVTNATTDGAEIGPEASV
FT                   GPYTYLRPGTKLGRKSKAGGFVEMKKSTIGEGTKVPHLAYIGDATIGAGTNIGAGVITA
FT                   NYDGYNKFPTRIGDHAFVGTNTTLIAPAEVADGAYIAAGSAVNMPVGPGELAVARGRQR
FT                   NIAGYVARKRPDSVAAQAAARAAERAAAGGQPAVETNPTGGGPGAQADAV"
FT   gene            182148..183128
FT                   /locus_tag="Caci_0169"
FT   CDS_pept        182148..183128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0169"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: sgr:SGR_4383 putative ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69124"
FT                   /db_xref="GOA:C7QHI5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACU69124.1"
FT                   /translation="MTGLKTTGEKKLMLFTGRAYPELAQEVAEELGVEIAPMKAHDFAN
FT                   GEIYTRFEESVRGSDAFVIQCHSAPINHSIMEQLIMVDALKRASSKRITVITPFYGYAR
FT                   QDKKHKGREPISARLMADFFATAGADRLMAVDLHTDQIQGYFDGPVDHLFALPVLVDYI
FT                   KGKYDTSKLTVVSPDAGRVRTADRWTDRLNTPLAIVHKRRDPNIPNTVSVHEIVGEVKG
FT                   RTCVLVDDMVDTAGTICAAAEALFENGAAEVIIAATHAVLSDPATDRLKNSRISEVIFT
FT                   NTLPIPDEKRFDKMTVLSIAPMLARAIREVFEDGSVTSMFDDHKH"
FT   gene            183392..184015
FT                   /locus_tag="Caci_0170"
FT   CDS_pept        183392..184015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0170"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   tfu:Tfu_0416 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69125"
FT                   /db_xref="GOA:C7QHI6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI6"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACU69125.1"
FT                   /translation="MSQIRISAEDRTEFGKGFARRARAVNKVPAVVYGHGEPVRHILLP
FT                   GHDLMIALRTPNVLLNLEFGDGKAQLVLPKDVQKDPVKRTLEHVDLVLVRSGEKVTVDI
FT                   PITVTGEVVGGAVLDHSLNNLTVTAEATHIPTGIEVDVDRKEEGFQLFVRDLELPAGSE
FT                   LVTDGDQLVLQVVVTRAEVSEEAAEGEGDAEGEAAEGASEESAE"
FT   gene            184044..184640
FT                   /locus_tag="Caci_0171"
FT   CDS_pept        184044..184640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0171"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: sco:SCO3125 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69126"
FT                   /db_xref="GOA:C7QHI7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI7"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACU69126.1"
FT                   /translation="MTTTEARDQLWLIAGLGNPGPGYAGNRHNAGFMVVDLLAARVGGK
FT                   FKSHKARADVVEGRLGVGGPRVVLAKPKTFMNLSGGPVKALRDFYKIEPAQIIAVHDEL
FT                   DVDYGVLRLKLGGGDNGHNGLRSITSSLGTKEYHRVRFGVGRPPGRQDPADFVLKDFSS
FT                   TEKKDLDYNVDRAADAVEDLIRRGLVEAQNIYHAA"
FT   gene            184839..185807
FT                   /locus_tag="Caci_0172"
FT   CDS_pept        184839..185807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0172"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5452 ABC transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69127"
FT                   /db_xref="GOA:C7QHI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69127.1"
FT                   /translation="MPAIEVRGLRKAYGDVTAVEDVSFEVAEGEIFGILGPNGAGKTTT
FT                   VECVSGLRTPDAGEVRVLGLDPRRDREDVRQVLGVQLQESQLPGKIHVREALELYASFY
FT                   RDPADVDRLLAQWELTEKAGARFGKLSGGQKQRLAVALAMVGKPRVVVLDELTTGLDPH
FT                   ARRTAWEMVQAVRDSGVTVLLVTHFMEEAERLCDRVAIIDAGRVVALDTPAAMAARGPA
FT                   AGQRMRFRPSAPVEDADLLALPEVRSVERHGAHLEVSGTSEVIGAVTAYLARRQIIAAE
FT                   LRVEQSSLDDAFIALTTHATTTTHAAQTMQTAQTAQTAKES"
FT   gene            185807..186595
FT                   /locus_tag="Caci_0173"
FT   CDS_pept        185807..186595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0173"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sgr:SGR_876
FT                   putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69128"
FT                   /db_xref="GOA:C7QHI9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHI9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69128.1"
FT                   /translation="MSTATFSSRSSRLLPEFRMTGNGFRTLVRTQARLLWREPAVVLSG
FT                   IALPVLLIIVFGCIPSFGKPAASLGGRTTMDVYVPTFAMLSSVLTALTALPVTFADLRE
FT                   RGVLRRLAVSPVPAAGLLAAQVTVIATTAAVTAASVVLIGVAGFGASLPAHLALVLASY
FT                   ILGTTALLAIGLLIAALAPSAGVATGFGVPTMILNFFFAGVYVPLQQLPSVLRTASGFV
FT                   PYGAIVDTWSGTGAAWQHLTVLAVYTVVGALAAARVFKWE"
FT   gene            186609..187907
FT                   /locus_tag="Caci_0174"
FT   CDS_pept        186609..187907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0174"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sco:SCO5454 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69129"
FT                   /db_xref="GOA:C7QHJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69129.1"
FT                   /translation="MVESATVQRWIPYAGLAVSLTLALIIGPRTGVYYTVVLGGSAAAA
FT                   LWVRRGRALLDAPNPPVLRATVYYAVLLALLATLILTSPLFGFFGFTGYLHAMVLPGRT
FT                   KLFGIAGTAGAMATTQMGGIVNIHGAGVYLYLVLVAVNLLIAGTLTVTGAAEEEHRREL
FT                   AEANERLHEMLEENAGLHAQLVAQAREAGVLDERQRLAGEIHDTIAQGLTGIVRQLEVV
FT                   ERFDDDVERRKHHLTLARELARESLAEARRSVQALRPGPLAVAQLPEALAELAASWSRT
FT                   AGIEARVEVSGEAVALSPEVEVALFRAAQEALANAGKYSGAGRVGVTVSYTSDVVVLDV
FT                   VDDGAGFDPEEVRRRGADSASENGTGYGLSAMRSRLRQVGGTLTIESEPGDGTAISAAV
FT                   PLVTLAAETASAGASARASTGAVAEAVTEAVTG"
FT   gene            187936..188604
FT                   /locus_tag="Caci_0175"
FT   CDS_pept        187936..188604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0175"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: sco:SCO5455 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69130"
FT                   /db_xref="GOA:C7QHJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69130.1"
FT                   /translation="MIDRVSGDSSPLRLLIVDDHPIVRDGLRGVFDGEDGFEVVGEASD
FT                   GAQALVRAAESGPDVVLMDLRMPTMGGVEAIRRLRVEQPAVRVLVLTTYDTESDVLPAI
FT                   EAGATGYLLKDAPREDLIRAVRAAAAGQPVLAPTVAQRLMTRVQTPLAEPAPPGDALTE
FT                   RELEVLRLVASGTTNRETARKLFISEATVKTHLLHAYAKFGVRDRAAAVAEAYKRGLLK
FT                   "
FT   gene            complement(188628..188966)
FT                   /locus_tag="Caci_0176"
FT   CDS_pept        complement(188628..188966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0176"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   mlo:mll3541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69131"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ2"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ACU69131.1"
FT                   /translation="MTAYALAHVRSVELCADIVEYLERIQGTMDPFGGRFAFHGGEKEV
FT                   VEGAWTGDLILIEFPTLDAVHSWWTSPEYRAIKNLRTDHMAADIVVFDTLPADYNVGAT
FT                   AAKLAKLL"
FT   gene            189108..189254
FT                   /locus_tag="Caci_0177"
FT   CDS_pept        189108..189254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69132"
FT                   /db_xref="GOA:C7QHJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69132.1"
FT                   /translation="MSSMGMVLNAFIAAAVGGICLSGLFKRGRERRVARISGTADRYEA
FT                   PVR"
FT   gene            complement(189512..192334)
FT                   /locus_tag="Caci_0178"
FT   CDS_pept        complement(189512..192334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0178"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   sco:SCO3127 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69133"
FT                   /db_xref="GOA:C7QHJ4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ4"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACU69133.1"
FT                   /translation="MSAVPSPKNDDAAVETPTDSPTARANDTANDNPPRTADDAELRAA
FT                   IRRLGDLLGQTLVRQHGPELLEQVEAIRALGKQGADVSELLAAVDPEQAIKLVRAFTAY
FT                   FNLANTAEQVHRGRELAATRAAEGSWLGQAVDRIQAAGLAGTAAEAVSHLSVRPVFTAH
FT                   PTEAARRTVLAKLRKVAELLEAPQTAYNERRLAETVEQLWQTDEIRITRPEPVDEARNA
FT                   VYYLDELAAHAAPEVLEELAVELRRLGVELPLSARPLSFGSWIGGDRDGNPNVTPQMTL
FT                   DVLELQHEHAIRTALASMDALREILSTSERIAAPTEALRASLDADLEALPEIPNRYRRL
FT                   NAEEPYRLKATTIRQKLLNTRTRIAEGRQHDPRRDYLGTSELLRDLSLMRDSLYADRGE
FT                   LIATGELETAIRTIAAFGLHHAVLDVREHADAHHHVLAQLFDRLGDQPWRYSDLPRDYR
FT                   TRLLAKELASSRPLSALGQVPADTLLDAAGVKSFGVFTAIRTAFEKYGPDVIESYIVSM
FT                   TRGVDDLFAAVVLAREAGLVDVHAHTAAIGFVPLLETPDELKIAGSILDEMLSDPSYAA
FT                   IVAARGGVQEVMLGYSDSNKMGGISTSQWEIHRAQRELRDTALRHGIRIRLFHGRGGSV
FT                   GRGGGPSHDAILAQPWGTLDGEIKVTEQGEVISDKYAIPALARENLELTLAATLEATVL
FT                   HRAPRQSAEDLATWSATMEGVSSAGQDRYRELVEHPDLPAYFFASTPVDLLGDLHLGSR
FT                   PSRRPDTSAGIDGLRAIPWVFGWTQSRQIVPGWFGVGTGLAAARQNPAFAGTDWQDMYE
FT                   RWHFFRNFLGNVSMTLAKTDLRIARHYVETLVPRELHHFFDTITEEYERTVAEVLRITG
FT                   ESELLGRNETLARTLRVRDMYLDPISYMQVSLLKRQREATKAGLPVDPDLARALLLSVN
FT                   GIAAGLKNTG"
FT   gene            192506..193534
FT                   /locus_tag="Caci_0179"
FT   CDS_pept        192506..193534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0179"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: sgr:SGR_6861 putative signal
FT                   peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69134"
FT                   /db_xref="GOA:C7QHJ5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ5"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ACU69134.1"
FT                   /translation="MAATDPGAPVGSQPAEPPFGDGYGTTGNGYGQQHGFGTENGYGTE
FT                   NGYGAENGYGSAPGFASENGYSQDQGYASEHAFGTQNGYDPVAGDGSAATDPATDPDAA
FT                   DEELAAVPSRGGGRRAARTKAKRRRIPAWLEIVGYVVISLTLTSLIKTFLVQMYYIPSP
FT                   SMEPTTYKGDRVFVDKLSSWVGGAPARGQVIVFHDPHNWLMSSAGSTGGAINLPDVLAA
FT                   VGILPDQHDDLLIKRIIGTGGDTIECKTQDGPVYRNGVALDESSYIMNGKQGMPCYNGV
FT                   YKVTVPQGDLWVLGDNREHSGDSSWNYLKKGGDAGFVPTKNVVGHVVGVVSWLRDDHPA
FT                   GS"
FT   gene            193634..195694
FT                   /locus_tag="Caci_0180"
FT   CDS_pept        193634..195694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0180"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: sma:SAV_1715 non-hemolytic phospholipase C;
FT                   TIGRFAM: phospholipase C, phosphocholine-specific; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69135"
FT                   /db_xref="GOA:C7QHJ6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ6"
FT                   /inference="protein motif:TFAM:TIGR03396"
FT                   /protein_id="ACU69135.1"
FT                   /translation="MTAVNRRRFLQITGGTAAATSMPMLTASIARAAAVRPARRTGTIK
FT                   DIEHVVILMQENRSFDHYFGTLRGVRGFGDPRPARLPNGKAVWHQADAAGNEILPWRPT
FT                   GVPDLGLKFLDGLDHSWNGGHHAWNQGNYDQWVPAKGPGTMAHFERQDIPFHFALADAF
FT                   TVCDAYHCSLMTSTDPNRYYLWTGFTGNDGKAGGPVLDNAEAGYDWTTYPERLQAAGVS
FT                   WKIYQDIGTGLDAKGSWGWTDDAYIGNYGDTSVLYFHQYQNAKPGDPLYDNARTGTNAA
FT                   AGQGYFDLLAQDVKNGKLPQVSWITAPEAFSEHPNWPVNYGAWYVSQVLDILSSDEDLW
FT                   SKTALFIMYDENDGFFDHVVPPFVPGGAVGGASTVDTSTEYYSAGAGFDAGSYGLGLRV
FT                   PMFVVSPWSKGGWVDSETFDHTSVIRFLEKRFGVHEPNISPWRRAVCGDLTSAFDFGLR
FT                   ETEVPALPSTASYVPPDHARHSSYPVTLPASASLPKQEAGRRPARALPYDLAADGRIAG
FT                   GALRIGFASRGSAGASFVVTSILDKTGPWSYTVGAGHTLDGSWKLSGAYDYDVRGANGF
FT                   LREFKGDAAKAGLEVVAEHVGNSQNLKLTLTNTGSADVTATVVDSYGCDGKAVLRVRAG
FT                   KHATHVVPAGASDGWYDATVTSDHDAAYVRRFAGHTENGRPSVSDPAIITG"
FT   sig_peptide     193634..193732
FT                   /locus_tag="Caci_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 33"
FT   gene            195809..196141
FT                   /locus_tag="Caci_0181"
FT   CDS_pept        195809..196141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3881 pectate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69136"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69136.1"
FT                   /translation="MKSRIASALAVLACVGALAACSGKGSAGSGGTAPAGAGVAASTSS
FT                   SASSPSSASTSSAPASGGSSASQSTGSHGVTEDPDGDLTSLDQELSDINGALSSAEPTQ
FT                   TAGDNG"
FT   sig_peptide     195809..195892
FT                   /locus_tag="Caci_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.519 at
FT                   residue 28"
FT   gene            196190..196912
FT                   /locus_tag="Caci_0182"
FT   CDS_pept        196190..196912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GJ22283 gene product from transcript GJ22283-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69137"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69137.1"
FT                   /translation="MTLRTRLSAAAVGALIAVGAVALPAQAATASDPAAGLAKAKAAVT
FT                   EGITDRLTTLGHLQTALTGYKEVTDAARGTLTQVLSSDVSGLTALKTKVAAETTEAAVR
FT                   TDGKTMVDDYRVYVLVAPKVHLTHALDVEGAALAKLVKVHDALADRLAKDPTANTAANK
FT                   ALLADMTSQIQSATTAIAGKDAALLALQPTPDGKALTASVKAISAPAKDARDDIKKAVD
FT                   DAKKVRDALKGTKTTTKS"
FT   sig_peptide     196190..196273
FT                   /locus_tag="Caci_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            complement(197393..197938)
FT                   /locus_tag="Caci_0183"
FT   CDS_pept        complement(197393..197938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_2083 putative outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69138"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69138.1"
FT                   /translation="MAFLKNATVIAALASAGVVGMAGIASAAADDAWNGGAEHHKTGDN
FT                   NVGQGGLIPVNALNNVNVSPNLGCLAHNTVPDLNVQSLVGLVPIGVGLNHLLEHTHLNV
FT                   LSNGNIDTDVNDNSCTSNQGSSQAGNNSRGSVGAGDSSSSHSTGDGAGSQNNGAGAGAG
FT                   GLIGSSGLLGKGGLNLGG"
FT   sig_peptide     complement(197855..197938)
FT                   /locus_tag="Caci_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.637 at
FT                   residue 28"
FT   gene            complement(198345..198791)
FT                   /locus_tag="Caci_0184"
FT   CDS_pept        complement(198345..198791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69139"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69139.1"
FT                   /translation="MRTRAIFTAAAATAATLGGVLASAGTAAATTTKTTTPSRPTAPQA
FT                   SPTPGVLAVENALELADDWCVAPLHFAGPLAADPLPTASHACGHGRAGGGVRVLSDLCI
FT                   APITTDDPSGSWAAPSTPCKNAGSAGSGFGILRDVSVAGVQATF"
FT   sig_peptide     complement(198705..198791)
FT                   /locus_tag="Caci_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.412 at
FT                   residue 29"
FT   gene            complement(198853..199518)
FT                   /locus_tag="Caci_0185"
FT   CDS_pept        complement(198853..199518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmo:HM1_1325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69140"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69140.1"
FT                   /translation="MRKYLSLAVVALSSGGALFAAAGAASAATSTDSLRAAPWQATSPL
FT                   AMHAAPFGDHDVMGLCGMQRDNVRTGQIDADLVQKLCAGEGDMMTPPVPGPPPVMTPPP
FT                   PPMGSPSPCTEVCKPVHHHHPKPPTPPTHPTPPPPPPVTQPCPPPPCPPVTPPPPPPCP
FT                   PVMPPPPVPCPPPTPNPCPPGHEHGWSAEPDAATQAAPAAGNAVAGLPILGSVAGGLL"
FT   sig_peptide     complement(199435..199518)
FT                   /locus_tag="Caci_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            complement(199793..200272)
FT                   /locus_tag="Caci_0186"
FT   CDS_pept        complement(199793..200272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0186"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sma:SAV_788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69141"
FT                   /db_xref="GOA:C7QIZ9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ9"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACU69141.1"
FT                   /translation="MEARLNTFATPTGAKFGKYLIAAGRVLREAGVPVATLHLVEIRAS
FT                   QINGCGFCLDMHTKDATAAGETAERLNMVAAWREAACYTEAERAALELTEAGTRLADGT
FT                   GVADEVWDAAAKHFDEDQLATLVAQIALINAFNRGNVMVKQPAGDYVPGQFDDAE"
FT   gene            complement(200393..201403)
FT                   /locus_tag="Caci_0187"
FT   CDS_pept        complement(200393..201403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69142"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ00"
FT                   /inference="similar to AA sequence:KEGG:SAV_3557"
FT                   /protein_id="ACU69142.1"
FT                   /translation="MAQASAQRHGIPNGQFAGRIIEFSDPELDRKFPHGIYLTMHGYPE
FT                   FAVYARHTVQIADPPSGLSVDEIRVTDVIAANLLAADAGDPLWQTRPNTATPQGWTWAH
FT                   AAESRMLHCVPIELHGAFRHHGGMATLKADRGRSGLFTEGMLEPVAFERSGSVPEDAMA
FT                   QLEQHLGFALPPSYRRFLAGTDGGRPISPAVNLAGGFVADQWMFGLRREDPHQDLVYAN
FT                   QALYDRFTEEYLGIGYVQGGMLALKIRGAEAGSVWLFDDDDPRDSESRDAGSVCAELLK
FT                   KIGSDFDDFARHLVALPQQIVDIARSAVDSGHAKSITDIEHLGAALPEGLKAPRR"
FT   gene            201624..205172
FT                   /locus_tag="Caci_0188"
FT   CDS_pept        201624..205172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0188"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: sma:SAV_3549 transcriptional-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69143"
FT                   /db_xref="GOA:C7QJ01"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ01"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACU69143.1"
FT                   /translation="MSLSGLLDAVSADPGVAALLEAAATAGRTSFDLAAPRSVRPFALA
FT                   ALARAQGPAGRPVLAVTATGREAEDLVAALRGLLDPETVVDFPSWETLPHERLSPRSDT
FT                   VGRRLAVLRRLVHPDAATEGAGALKVVVAPIRSVLQPQVKGLADLVPVAARTGAEIDLD
FT                   DLVNRLAAAAYTRTDLVDKRGEFAVRGGIVDVFPPTEEHPLRLEFWGDQIEEIRYFKVA
FT                   DQRSLEVAEHGLWAPPCRELLLTDEVRKRAAALMEDHPELADILGKVSEGIGVEGMESL
FT                   APVLVDDMELLIDLLPAGSPIVLCDPERVRTRAADLAATSAEFLDASWAATAGGGQTPI
FT                   DLGAASLKDLASVREHAITLGLPWWSLTPFAPDLELLPEEDATEISEIHDTEQYGGDTG
FT                   RALADVRARISEGWRVVLVTQGHGSADRLVEVLKGADIGARYVPELDTVPEPALATVAT
FT                   ASIEHGFIAADLKLWVITEQDVSGQRTATKDMSRMPSRRRNVIDPLQLKAGDPVVHEQH
FT                   GVGRYVEMAQRTVAGATREYLVIEYAAAKRGQPGDRLFVPTDQLDQVTKYVGGEAPSLH
FT                   RLGGADWQKAKSRARKAVKQIAGDLVKLYSARMAAPGHAFAADTPWQRELEDAFPYVET
FT                   PDQLACIDEVKSDMEKPVPMDRLICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPTTLL
FT                   VQQHFSTFAERYAQFPVTLKGLSRFQTDKEAAEVLRGVADGSVDVVIGTHRLLANSVKF
FT                   KRLGLVIVDEEQRFGVEHKEQLKQARANVDVLTMSATPIPRTLEMAVTGIREMSTIQTP
FT                   PEERHPVLTFVGPYEERQISAAIRRELLREGQAFYIHNRVESIDRAASRLRALVPEARI
FT                   ATAHGQMNEHVLEKLIVDFWNKEYDVLVCTTIVESGIDITNANTLIVERADNFGLSQLH
FT                   QLRGRVGRGRERAYSYFTYPPEKPLTETAHERLATIAQHTDLGAGMYVAMKDLEIRGAG
FT                   NLLGGEQSGHIEGVGFDLYIRMVGEAVEEYRAQAEGREVEEQVEIRVDLPVDAHLPHDY
FT                   IPGERLRLEAYKRIAGATTHEELAEVRQEFTDRYGRFPQPVENLLAVAAFRIDARAAGL
FT                   TEVAVQGNFVKFGPVKLRESQEMRLLRLFPKTLVKAATDTMLVPKPMTARIGGQPLRDQ
FT                   ELLGWARDLIDAVLKM"
FT   gene            205284..206531
FT                   /locus_tag="Caci_0189"
FT   CDS_pept        205284..206531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0189"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4255 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69144"
FT                   /db_xref="GOA:C7QJ02"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ02"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69144.1"
FT                   /translation="MDATDRLPSQVKALIVARAVNQLGGFSLAFLTVLLTRSFGTSLTT
FT                   AGIVSAAFGLATIPSRLAGGRLADHWGRRRTIVAGLVALAVAQLGLAAAPDLITATICA
FT                   VAMGLAFELFEPPSQATIADAVPPARRASAFELLTTAVAAGSLAAGVIADIVGRWSLRW
FT                   LFVVDAGTGLACAAIVALALAPDAVRKPEHGAESDQPATSAISPWRDPALLIATVSGTV
FT                   FALVSMLMLSALPLALGAVGLNPASAGLIMAASTGTLVLARPVLRRRWLAELPHSATFV
FT                   LGYLLMAAGLCGYAVAHTLPALLVPTALYSLGNLLVLGRSFAVVSELAPASASARYLAV
FT                   YGLSWGVATLLAPLVGTWLIGVSGAGLLWGVSAGVCGVMAVAQPWVVRRVRDSQRDLGV
FT                   IHSTKAAVDRYDAVSI"
FT   gene            206576..207328
FT                   /locus_tag="Caci_0190"
FT   CDS_pept        206576..207328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0190"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sma:SAV_3538 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69145"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ03"
FT                   /inference="similar to AA sequence:KEGG:SAV_3538"
FT                   /protein_id="ACU69145.1"
FT                   /translation="MIQARSVRLAAVIVLGGAVALATSACGGPMQAGAAAVVQGQRTTD
FT                   ATVQDQVASIVSLVQHNNLQQGDVTDEERSALAKAQINLLVQQAVWQKVADDNGVKVTA
FT                   ADDAKEHSALVEQARGSLQGTKFTGSDNEAVALADAESQQNSSGLAPSSVPVYSHIQAL
FT                   VTAVIDDQATKLRVDPNDQNSLPALQGAILPMLSKASTQIDVKISPRYGSFDASTRQVV
FT                   AAQTSWIRPTKAQVAAAAAAQAQQQQSQ"
FT   sig_peptide     206576..206680
FT                   /locus_tag="Caci_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.743 at
FT                   residue 35"
FT   gene            complement(207411..208415)
FT                   /locus_tag="Caci_0191"
FT   CDS_pept        complement(207411..208415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69146"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ04"
FT                   /inference="similar to AA sequence:KEGG:SCO7720"
FT                   /protein_id="ACU69146.1"
FT                   /translation="MRGKGVNYDTGFFPGGQDSRPDFDPETARRELRVIAEDLHCTAVR
FT                   ISGALPDRLEAAAQAAADAGLEVWFAPFPCEASREDLLELLADCAQRAERLRAAGAEVV
FT                   FVAGCETSLFCPGYFDGDDSYARIETLGNGGMALWSRLGEIMASFNGYLVEAAATVREH
FT                   FQGKVTYAAGPWEFIDWAPFDFVSVDAYRSAENRDKFADQIRAHFKHGKPVVATEFGCT
FT                   PYVGSGDRGGMAWAILDDSVEPPVVNGDYLRSEDEQSAYFTELYDVFEEAGVDSAFWFT
FT                   FATFRALHDPSDPRKDLDLAAYGTVKMTGPDTPELNWEPKKVFHTIAERYAAS"
FT   gene            complement(208489..209226)
FT                   /locus_tag="Caci_0192"
FT   CDS_pept        complement(208489..209226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69147"
FT                   /db_xref="GOA:C7QJ05"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ05"
FT                   /inference="similar to AA sequence:KEGG:SAV_4727"
FT                   /protein_id="ACU69147.1"
FT                   /translation="MTAMTAHTHRTADVTADGAGVADVADGETPHPLKQALLPLAVDIA
FT                   IPLGSYYALHAGLGMSNAAALGLSSVVPAIRTIVAAVGKRQANALAALMLTVNIVAIAL
FT                   TFVSGDARLMLAKDSGVSSVIALGILWSVRGGKPMMSAGLKPFVTKGDAKQTAAWDALR
FT                   IESSTFRAKENLYSVIWGAWLLTECLARLAGAFLLPVSTMAWLGTVILIVAIAGACVTG
FT                   GAAVEPLEKLVAAHVEAASDAEH"
FT   gene            209307..209954
FT                   /locus_tag="Caci_0193"
FT   CDS_pept        209307..209954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0193"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO4450
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69148"
FT                   /db_xref="GOA:C7QJ06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ06"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69148.1"
FT                   /translation="METQGLRERKKRQTREEIANVATALFAELGFEKVTIAEVAAAAGV
FT                   AKMTVTNHFPLKEDLVFDRAEHIVHGLPDAVAARPDGEPVLAAARRYHAQQLAAGDPTL
FT                   GHRGVDFSRMVESSPALAARERQIHDQREQALAEVLVAQTRPAEELTARVAAAQIAGVY
FT                   RVLYFTARRFLLDGLQGPEMAETLGACAQRAFTLLEVDLSGFDPRPRLRSTA"
FT   gene            209951..211027
FT                   /locus_tag="Caci_0194"
FT   CDS_pept        209951..211027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0194"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: sgr:SGR_4434 MazG family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69149"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ07"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACU69149.1"
FT                   /translation="MTEAPPPDPENPQGPENSGRIVFLATSPRVALGLLSWPAWETLRA
FT                   ADVVFAGDADHPHIPYVEQATGAVVALPDHSPSMAAERLLEAATPARTVVWLAEDEEYD
FT                   EELAVALGNRLVLLASADLPELEVLPGSYDLPGAHLLDLVDVMNRLRSPGGCPWDAEQT
FT                   HASLVKYLLEEAYETVETIEDGDPLTPGPGRDALREELGDVLLQVMFHSRIAEEHEADP
FT                   FSVDDVADGIVAKLIRRHPHVFADVEAPTAEHVAANWEQIKAAEKQRESVTEGVPMTQP
FT                   ALALVAKLAGRVRKSGLVVPAGPAPDLPDTADELGEQLLATAIKAVGAGWDPEEALRTA
FT                   ARRYRDRVITAEEELARG"
FT   gene            211121..211381
FT                   /locus_tag="Caci_0195"
FT   CDS_pept        211121..211381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0195"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: mle:ML1331 twin argininte translocase
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69150"
FT                   /db_xref="GOA:C7QJ08"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ08"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACU69150.1"
FT                   /translation="MGDLQPWHIIVILVVVFLLFGAKKMPDMARSVGQSLRIFKSEMRQ
FT                   SQKETEEVAKQANDSVRVTPAVENSGSVPASDAAEKHTSAT"
FT   gene            complement(211522..212493)
FT                   /locus_tag="Caci_0196"
FT   CDS_pept        complement(211522..212493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69151"
FT                   /db_xref="GOA:C7QJ09"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69151.1"
FT                   /translation="MPPQDWAPPMPPQQDRVPPMPQPDRGPYPQFTQQPPPPQFTPPQM
FT                   PGMPYPDEEPPPRKNTGRIIAGVVAGVVLLGGAGGIYLLTKGDSKKDTKPQPVAAATSA
FT                   TTPATTPAAPGTPASSGATSFPNNSYTGSAAAPPASASSTGGGATLDNAATDKTPFTAQ
FT                   ALVAQSFTDDKNVAYALKSAQPQPCAKVGDAAVQTIVKSAKCTDFMAASWIDPANSRIV
FT                   VSAMVIPYQDAATATAIYKKLSTTHTGDYAQWCPPAGQPGADTCAKLAKAGAVTREGKF
FT                   GSFHRYVLITTAVYADLRNDDSQKDWLTSAAHGAFQNTLPGQ"
FT   gene            212732..214468
FT                   /locus_tag="Caci_0197"
FT   CDS_pept        212732..214468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0197"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   ace:Acel_1952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69152"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ10"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACU69152.1"
FT                   /translation="MADTPDARFEALAADILDGLWRRHPDWAGTVGLHEYDAELPDRSA
FT                   GGLAAEAAWLAGRAEDLADLDPAALSVPNRVDAAILANQLAALRFQIEDLREDEWNPAE
FT                   ANPGVALYTLLARDYAPAAQRLSAFAGRLEQVPSALLDNRSLLAGKPLSRIHVELAIGQ
FT                   FEGTVDLIGAELDAAVAAASEAASKAGSEADSEAVSQARKAIDAVRPDASAALQEHIVW
FT                   LKERLAAGDAGEEEFRDPRIGAELFTRKLSLSLDAESDAAAILARAEADLDRVSAEIAE
FT                   AAADYEGVAVPSDEAERSALVRRVLDRLAESAPDNETILEYSRQALLAQFAFVRDHDLV
FT                   TVYPDPYEVVEMPEVHRGVSVAYCDPPGPMEPAEVQTILAISPTPEGWTQERVDSFFRE
FT                   YNRHMLHNLMVHEAMPGHLLQLQHSRRQQAPTSVRAALWSGSFVEGWAVYAEALMARHG
FT                   YPGDGDPRAVRMQQLKMQIRMIINTVLDSRIHCHGMTEDEAMALMTGRGYQEDGEAAGK
FT                   WRRALLSSTQLSTYYVGYKEVSDLVRDLRADHPEWSERQVHDAVLGHGSPPARYLRDLI
FT                   AA"
FT   gene            complement(214500..215156)
FT                   /locus_tag="Caci_0198"
FT   CDS_pept        complement(214500..215156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0198"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: sma:SAV_4878 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69153"
FT                   /db_xref="GOA:C7QJ11"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ11"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69153.1"
FT                   /translation="MPEPIRVLIAEDAVLLREGLARLLADSGFDVVAKVDDGKGMVEAA
FT                   DALKPDVIVADVRMPPSFTDEGLRAAVQVRAKYPDMAILVFSQAVEAAYAQELFSTSAN
FT                   GLGYLLKERVAEVEEFVDALKRVAAGGTALDPEVVAQLLGRRKRNDPLETLTPREREVL
FT                   AMMAEGRSNSAIAAGLFVTEKAVEKHTSSIFTKLNLTPAAEDHRRVMAVLRYLNV"
FT   gene            complement(215132..216490)
FT                   /locus_tag="Caci_0199"
FT   CDS_pept        complement(215132..216490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0199"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sma:SAV_4879 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69154"
FT                   /db_xref="GOA:C7QJ12"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ12"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU69154.1"
FT                   /translation="MITTVGAKAAARREGDTAPTLGPGELLKGPFTGRALRQQGYLLVS
FT                   FVAAFVQVLVLTVTLALGGALVVLVVGLPLLLAGLVSLRWNSRRERLRILRLTGERVPE
FT                   PYREPGPSGNPLQRLLGHLSDPATWRDLVHLVVASGLGLGWFLVAVGSWVLPLGAVTLP
FT                   FWYTALPEHRIPLMHVNGSEYYISTLPSILAFSAVTLAFVWLVNPTLLELGTRTQTGLG
FT                   RALLGLSRLELDRRETALRTTRSQAVSAAEAERRRIERDLHDGAQQRLVALAMDLGRAK
FT                   SKLKTGDEADSEAAAQLVAEAHEGVKLALSELRDLARGIHPAVLTDRGLDAALSALAGR
FT                   SPIPVEVDADLPWRPSPEVESAAYFVASEALANMAKHAHATRAWIELEIREDHLRMIVG
FT                   DNGVGGAQTDPGGGLDGLSDRIAPLDGILSVSSPLGGPTQIIMEMPCPNPSAS"
FT   gene            216643..217491
FT                   /locus_tag="Caci_0200"
FT   CDS_pept        216643..217491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0200"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: rha:RHA1_ro00243
FT                   ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69155"
FT                   /db_xref="GOA:C7QJ13"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ13"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ACU69155.1"
FT                   /translation="MEELPTLPVLIARIESSHPFSDPLARLADAVETGASISALADHLV
FT                   GHFVDEARAAGASWAQIGVALGVSKQAVQQRFVPREPATVADFDIEVQRFSRFTPRCLN
FT                   CVLGAEKIAVATGAAAVTPTHILIGLFVEPQSLAIHALADNGADPAQVRAAAVETLPPA
FT                   PEGATVLATATATAPSQEPAIPGNSLPFTPEARKTFDLAVRAALSAGHNYVGTEHLLLA
FT                   LAGDPKSETALLLTSFGLTRDGLEASVQRLLMEFMANSGRRGSGVSPLDPAEQGAPPAE
FT                   G"
FT   gene            217533..218819
FT                   /locus_tag="Caci_0201"
FT   CDS_pept        217533..218819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0201"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: sgr:SGR_4439 putative enolase; TIGRFAM:
FT                   enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69156"
FT                   /db_xref="GOA:C7QJ14"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ14"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACU69156.1"
FT                   /translation="MASIEAINAREILDSRGNPTVEVEVLLEDGSFARAAVPSGASTGA
FT                   FEAVELRDGDAARYGGKGVERAVQGVLDEIYPAVVGEDASDQRLIDQAMIDLDATPNKA
FT                   RLGANALLGVSLAVAKAAAESAELPLFRYLGGPNAHTLPVPMMNILNGGAHADSNVDIQ
FT                   EFMIAPIGAGSFREALRWGAEVYHALKSVLKERGLNTGLGDEGGFAPSLPSNRDALDLI
FT                   LVAIEKAGYTPGRDIALALDVAASEFYKDGAYQFEGKSRTASEMTDYYAELVDAYPLVS
FT                   IEDPLFEDDWDGWKILTDRLGTQVQIVGDDLFVTNPERLARGIAGGQANALLVKVNQIG
FT                   TLTETFDAVQLAHRNGYRCMMSHRSGETEDTTIADLAVAVDCGQIKTGAPARSDRVAKY
FT                   NQLLRIEEELDDAARYAGRSAFPRFTHEG"
FT   gene            218877..219518
FT                   /locus_tag="Caci_0202"
FT   CDS_pept        218877..219518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0202"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: sma:SAV_3532
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69157"
FT                   /db_xref="GOA:C7QJ15"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ15"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACU69157.1"
FT                   /translation="MKSAGSGSTPGRLSAVPTQRQDAASGTSRSSGDGGSGSGASAKRR
FT                   TRYTARAAILMLVVCALVLALAYPLQQYFSQSSQINQLKQQNAHKRTQVQQLGRQLTQW
FT                   QDPDYVKIQARLRLHYVFPGETGLRLLGAGDAATGGPDGTTGPSQGSSAWYAQLWNSVT
FT                   AASGAPTSSGAPTTPATSGASGSAGASGPSGTPTPSGGPARSATSPAPGH"
FT   gene            complement(219557..220213)
FT                   /locus_tag="Caci_0203"
FT   CDS_pept        complement(219557..220213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0203"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: sma:SAV_4878 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69158"
FT                   /db_xref="GOA:C7QJ16"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ16"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69158.1"
FT                   /translation="MKESSAVRIMIAEDSAILRDGLVQILTKRGHEILAAVPNADELLA
FT                   AIAVGAPDAVVLDIRMPPTHTDEGLRAALELRRSHPKVGVLLFSQYVETRYARDLFSGQ
FT                   VSGVGYLLKERVADVSEFVEALAKIAAGGTVLDPEVVVQLLGSRPTDALTAREREVLGL
FT                   MAEGRSNAAIGKKLVLADSSVEKHISNIFTKLGLPPADEDHRRVLAVLKYLGVAP"
FT   gene            complement(220680..222020)
FT                   /locus_tag="Caci_0204"
FT   CDS_pept        complement(220680..222020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0204"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   fal:FRAAL5519 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69159"
FT                   /db_xref="GOA:C7QJ17"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ17"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69159.1"
FT                   /translation="MGGGPKIGEAFPMKRFLLSPVSGRTARQYLFALVSAPLGLAGFVY
FT                   AVVTLAVGGALSFTFVGLPLIALAIHLARQYAKLQRRMARGLLGVDIEAPPPNLRRQNA
FT                   HGLLAKLGAALGDLPAWRSQLYLLVRFPLGIAYFVTLGVGVVEGLVMLTYPIWWAVFRP
FT                   TNTDSHGVKHQSALQFGDGFYFDNWLRALLLTVAGVVWIYAAVWILKFLLWLDSLLMKA
FT                   LLGPTNSERRVEELTVSRAHAVDDSAARLRRIERDLHDGAQAQLVALAMQLGEAKENLD
FT                   AGGNGAELDLTETRTLIDTAHRNAKQAINELRDLARGIHPAALDTGLRDALGTLAARSA
FT                   MPVTVNVALAERPDRAIETIAYFCAAELLTNAAKHAAPTRAALSVVQEEGQLHLTVEDD
FT                   GRGGAQVGYGGGLAGLLDRVRTVEGSLAVDSPQGGPTRVFVKLPMHV"
FT   gene            complement(222165..222395)
FT                   /locus_tag="Caci_0205"
FT   CDS_pept        complement(222165..222395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69160"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69160.1"
FT                   /translation="MNVSATVKVRVTVDADKWAAASGVESVQASASLAAALSEALERFS
FT                   DLVPEVDQAGGETRVEKLTWTASTTDPALPS"
FT   gene            222455..224104
FT                   /locus_tag="Caci_0206"
FT   CDS_pept        222455..224104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0206"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sgr:SGR_4708 putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69161"
FT                   /db_xref="GOA:C7QJ19"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030310"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ19"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69161.1"
FT                   /translation="MPTVAELIGVQSQHTGPGLLGPNGLRYQHPEIAAHAASRAALFGE
FT                   RHRPGMRPHIGVLLGNTDEFVFWLSAAALAGAALVGVNPTRRGAELARDIRHAECELLV
FT                   TDREHLPLLADLGLDALPLLIVDDPAYREALQPFAGVSATDVKPIAPITEDTRLLLYFT
FT                   SGSTGAPKAVTCVQGRVAASGAVMAERFGLIASDVCYIPMPMFHGNAILANWGPALVAG
FT                   ATVALRDRFSASGFLSDVREYQATYFTYVGRAISYILATPEHPEDAANPLRAGFGTEAG
FT                   PRDRERFEQRFGCHLSEGYGASEGGINIVAPRTFPPSVLARGAVVGKTNPTLSILNLET
FT                   GAPCPPAEFDAAGRLLNGAEAIGELVGTGPGGFTGYWNNPAADAERFADGRYRSGDLFY
FT                   ADTDGWLYFAARKADRMRVDGENISVALLEAILARWEPVEAVAAYAVPDEVTGDAVMCA
FT                   LVLRQGSDFDPGAFADFLAAQADLGTKMAPRFVRVTAALATTATEKVSRYAMREQGWWD
FT                   VGEDAVWARTGRQGAYQPRDTGSVNRNSAPPP"
FT   gene            complement(224053..225753)
FT                   /locus_tag="Caci_0207"
FT   CDS_pept        complement(224053..225753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0207"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sen:SACE_5293 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69162"
FT                   /db_xref="GOA:C7QJ20"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ20"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69162.1"
FT                   /translation="MIRGRFGRRTRLVAADQGFSAGAGTDAGAGASAGVAADASAGPNA
FT                   PFSTAPAFSAAPPTTQGSETYPARPNGQTAQSAPSALSRLGSPLSFWRRTPLRARLALA
FT                   ATVAVAAGIGGGVGFAYVAVRHSLTQQVDSGLQRQGAKVQDLLLTHHLPRYDETRSQQF
FT                   GDTLTNSQFIDSTGTPLQPKLLPATLRTPYSVVVLAPASTRVIPISSADAQVAAGSMNS
FT                   YMHSGEMNGQHVRILTLSIGQKDRALQIDAPLTAMDQQLSTLGWELFGAGAAGIVLAAG
FT                   LGWLVTRTALRPVAELTSTAERIAATHDLAHRIPIDGAPGEPRDELGRLAATFNTMLDA
FT                   VQEATDRQRQLVADASHELRTPLTSLRTNVEVLAHAQRLEPEDRQALVSGIMSGLDDMT
FT                   MLVSDTVELARGEEQAALFEELRFDLLVRRCVDRAAMHWPKAVFKEDLEDCLVVGVTDR
FT                   LAKAVRNLLDNAAKFSPDGGLVEVRTAPGADGTVTLTVRDHGPGIPEADLPHVFDRFYR
FT                   AASARDLPGSGLGLAIVAQVAVGHGGGVTVAGAQGGGAEFRLTLPVSRG"
FT   gene            complement(225750..226466)
FT                   /locus_tag="Caci_0208"
FT   CDS_pept        complement(225750..226466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0208"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: fre:Franean1_5311 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69163"
FT                   /db_xref="GOA:C7QJ21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ21"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69163.1"
FT                   /translation="MDTRGSLDREPRSLLVVDDDTEIRDAIARAFRLQGYRVRTASGGL
FT                   AALEQVAADPPDAIVLDVMMPELDGVEVCRRLRGVGDHTPVLLLTARDAVGDRVAGLDA
FT                   GADDYLVKPFALAELHARMRALLRRSEYDPVPESERLVFEDLELDPESRLAYRGGRTIE
FT                   LTRTEFALLELLMRNAGRVLPREVISDRIWGYELGPESNSLEVFVSCIRRKTEGGGEPR
FT                   LVQTVRGFGYTLRVPA"
FT   gene            complement(226478..227143)
FT                   /locus_tag="Caci_0209"
FT   CDS_pept        complement(226478..227143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ22"
FT                   /inference="similar to AA sequence:KEGG:Acel_1453"
FT                   /protein_id="ACU69164.1"
FT                   /translation="MSDKPGGPAANDNNAEFELLSQAPSAPDISGQLKPARSGGAGIPK
FT                   VTLGLVGAVLLAGGFVGGIAVGKSNSSSSSKPSNTAAGANRARGGYGGGFGTGGATGGA
FT                   AGGTAGGATGGAAGGARGGAVTGTVTAVSGSTITVTDSTGKAVTVNTSPQTTVTIGKSG
FT                   AVSDLTTGSEVTILGTPDSSGTITARSVVSGITQFGFGGRGGNRTPGAASSSPGGSNG"
FT   gene            complement(227177..228406)
FT                   /locus_tag="Caci_0210"
FT   CDS_pept        complement(227177..228406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0210"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   saq:Sare_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69165"
FT                   /db_xref="GOA:C7QJ23"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ23"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACU69165.1"
FT                   /translation="MRFREVFRFAFAGLKANKLRSGLTTLGILIGVGAVILLVAVGKGS
FT                   GAQVQANIDKLGTNLLEVSRQAGGFGARASRNTGTQSSVSALTLADAQSLVDPVNAPDV
FT                   LTEAPVVTASPTATYSGATHQISQLVGTYPAYLQATNWQIAEGSSITDDDVTQARKVIV
FT                   IGQTVATDLFGTADPVGQQVMINNVPYSVEGVLQSKGSSGLQDADDFAIAPLTTVQDSL
FT                   SGFGSLSQIVVQAKSAGATTAAQNEITSILTSRHHLSATASPDFRVLNQQSLLATSSST
FT                   THTFTVLLGAVAAISLLVGGIGITNIMLVTVTERTREIGIRKALGAPRAAILGQFLIEA
FT                   VMLSLIGGALGVAAGLIGTRFTVAGVKPVIVPASIALAFAVSALIGLFFGSFPANRAAK
FT                   LHPIQALRHE"
FT   gene            complement(228406..229176)
FT                   /locus_tag="Caci_0211"
FT   CDS_pept        complement(228406..229176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0211"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: saq:Sare_0222 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69166"
FT                   /db_xref="GOA:C7QJ24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69166.1"
FT                   /translation="MTGVSGPGGSEGRKPVIELADIRKTYGMDGTAVHALRGVTLTVPA
FT                   GDYVAIMGASGSGKSTMMNIIGCLDVPTSGRYLLDGIEVEHLSDRQLALVRNRKIGFVF
FT                   QSFNLLPRTTALDNVELPLIYAGVGTAERRKRARAALELVGLGDRMNHKPQELSGGQQQ
FT                   RVAVARALVTAPSLILADEPTGNLDSASSEDVMALFDRLHQAGRTIVLITHEHDIAEHA
FT                   DRAIRLMDGQIVSDERNGARGWLSAQHSAKHGSA"
FT   gene            complement(229173..230783)
FT                   /locus_tag="Caci_0212"
FT   CDS_pept        complement(229173..230783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0212"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ace:Acel_1450 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69167"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ25"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACU69167.1"
FT                   /translation="MTDSPRLPKGVWINTSLAVVVAAGGAGAWALLGSSSSDKTAANGR
FT                   TIAVQRGNVTAQVSASGNVTLPTEQDLAFTASGTVTEVDVKPGDVVKAGQVLAKIDTTE
FT                   ANQQLTSAQAQLTTAQAQLTKLQQGQTPQQAALSRQQLTNAADSLSSAKTSYSDARNSI
FT                   SLDESNLAAAVTTAKNNLAADEAAAKPDAAKIAQDTNAVTQAENAQKNGSLKDTQSLHQ
FT                   AQNSLTSAQNSYAIAVDQQAVSAAPATPDQIASANQSVLNAQNAVTTAQKGVAGTVITA
FT                   PQAGTVLSVGGLVGDSVSAGSASSTSAASSSSGGSTGGSSGGSASGSSGSSSSSTSSTA
FT                   AKSGSSFVVLGNMSSLTVRAEFAETDAAKLKPGESAQVTINAIPGSALTATVQSVDPTS
FT                   TVVSNVVEYGVTLQFTAGQQDLASLKPGQTASVSVTTDSVTNVLYVPSSSVTTLAGQSF
FT                   VTIVSGKTQTQTPVQIGVVGDTSTEITSGVSEGDEVLLSSRTTTGTGTTTRGGGAGGFG
FT                   GGAGGFGGGAAGGRGGFGG"
FT   sig_peptide     complement(230691..230783)
FT                   /locus_tag="Caci_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.536 at
FT                   residue 31"
FT   gene            230930..231601
FT                   /locus_tag="Caci_0213"
FT   CDS_pept        230930..231601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_0266 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69168"
FT                   /db_xref="GOA:C7QJ26"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69168.1"
FT                   /translation="MPKIDWTPGQGKRGRPLRRVLGMGQQQGLLVMYGLAAIAVVLALA
FT                   AACGAFDGSGPQPSAQTAGESTNPDDPAGAPSIPKDSTKSTQILLGSVQHYADLLASGQ
FT                   KIVGTTHYPDMAAYAQAFADASSPAARFSKFRTSPNPESDTTYLNAERQAAAAYGGDHG
FT                   SRLDAWLRDMAKVKSDLGDWVATAAQYQQGAANQAVLDAAASTVNQDLATARDAANSLS
FT                   H"
FT   gene            complement(231644..232222)
FT                   /locus_tag="Caci_0214"
FT   CDS_pept        complement(231644..232222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0214"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mab:MAB_2246 thiol-specific antioxidant related
FT                   protein/peroxidoxin BcpB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69169"
FT                   /db_xref="GOA:C7QJ27"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ27"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU69169.1"
FT                   /translation="MHDIYTLPADLPIPQDDGAADHLPGARVPELTLTSTAGEAIALAA
FT                   LGEGRTVLYIYPLSGRPGEEAPEGWSAIPGARGCTTEACDFRDHHKELLEAGAARVFGL
FT                   SSQDSAYQQELVERLRLPFAMLSDTGLRLAAELDLPTFEAGGRLLYKRITLVIRDGVIE
FT                   HAFYPIFPPDRHAGEVLGWLTKNPVRRIP"
FT   gene            complement(232341..233099)
FT                   /locus_tag="Caci_0215"
FT   CDS_pept        complement(232341..233099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO7301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69170"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ28"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU69170.1"
FT                   /translation="MVKAFRPDDVVRVDGDVHAVLGSDVTWVVVKDGDAATLIDTGYPQ
FT                   DYDNLLASLALLGVAPESLSAILITHAHNDHIGGAERLRSTYGIPVLTHAEEVPHARRD
FT                   FLDQVSIGKVAANAWRPGVVPWALRALRSGGTADVPVAEPQAFPADGPLDLPGAPIPLH
FT                   TPGHTEGHCAYLLPAAGILVCGDALGTGHPTSRISGPQMLPTMFQKDRARALASLSVFE
FT                   GIDADVLVPGHGPVHRGAMRDVVQRVRERG"
FT   gene            complement(233220..235211)
FT                   /locus_tag="Caci_0216"
FT   CDS_pept        complement(233220..235211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0216"
FT                   /product="cell wall binding repeat 2-containing protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69171"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ29"
FT                   /inference="similar to AA sequence:KEGG:Acel_1461"
FT                   /protein_id="ACU69171.1"
FT                   /translation="MSSPRIRSTAGSLAAAALLTLGATAYAPQASATGLPHHAARNGPI
FT                   TWAMNGPGVTGVDPVTGASIPGALVPALSSLNGTLSDLAWSPDGTKIAAVLTHGSNQQR
FT                   ALIAYSLIDQTVTTVEDGIPMLADPSWTADGSTILFAAAGGAQRNGLEVLWAISPVAGA
FT                   VEHRLLPNEPNCQEIEPSAGPGGAVVFTRTPYLTCDGGNGIGYSVNGHTTVIGQAQDFH
FT                   PALSPDGRTIVYCHQDVATGYYQLYRSAIVNGVPQPGTPLPGSPTMVTGDLVFSPDGSA
FT                   VAFHVFTGTGPQLATMPVAGGNPVYLSWPGASTGRLSWQPLFDKDVVRLYGDSRLATAV
FT                   SASRYTWADNGTADPARKQAKAAVISRSDNYADALGGAVLAARAGGPLLLTPTGTLDPA
FT                   VRAELDRILPAGAPVYVLGGGAAVSQTVENQLAGRYTVRREAGADRFATAVAVARASLA
FT                   LTPPSAGRVHVLAATGLNYPDALSAGAAAGALGTGVVVLTSDGQLPEVTRRFLADPTGT
FT                   GAAVDVDTIGGQAGSAIPDTSDVRLPAGSIVSAYSGTDRYETSYRVASVLLGDRQPTTA
FT                   GIVTAANWPDALAGGALLGVLRGPLLLYPSVPTSPTSLTDKWLRSNAATLRSVLILGGP
FT                   SALAPSTQRLIQGDIAAPGRSVYTENPY"
FT   sig_peptide     complement(235113..235211)
FT                   /locus_tag="Caci_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.655 at
FT                   residue 33"
FT   gene            complement(235340..237394)
FT                   /locus_tag="Caci_0217"
FT   CDS_pept        complement(235340..237394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0217"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69172"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ30"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69172.1"
FT                   /translation="MSCPVLCLVVSLKDVSVPKPRAIRLATLAITGAALLVAGAAPALA
FT                   AGPGGRFGVSASASSAPAMSLSFGFYAGTSHAAAVLYAFNVDPAKEATTTYRIDWGDGS
FT                   TPWVQTGGTVPNGLVISHDYPHAGVWKATATVDDGTSTVGQNTTYTAHYPTTPTTPGSA
FT                   FTPVGGNAPLAGDLSIDGGTVDAAATKSYIVNWGDGSPSQTVAAADSGPTVVHHVFTAP
FT                   RSYGVSVVTTDGIDSSAPPLYPTAVSAWGLAFSSTVNTTAFATVTVTSSAGKSLPTYSD
FT                   YYMFSVNWGDGTTSPATQSEDMTHQYKTGGPYAVTVTMAPTMDADKSPAYTWTAGTTLV
FT                   VPTPPPPAPPAVGTRLVQRLGGLDRIGTGITVSRSGWSSWQNRFPYGGQLPAGAVVLAR
FT                   SDGFSDALAGVPLAAHVNGPLLLTGGSALDLTVEHEITRVLQPHAGKTVYLLGGTAALS
FT                   PAVQQRLVQLGYTVQRYSGLDRFGTALDIARRGLNDPAKIVVATGMDYPDALAAGPYAS
FT                   SVLGTSGHEAAVVLSQGGTLDPATAGYISSRLNSSSAQAPTVVTVGGAAGHAVDAAFPA
FT                   LAGHELKLQGQNRYQTANAVASQFTSASRVGVATGTGYADALTGGALAAARHFPIVLTT
FT                   PAGLDPAGREAIARFWSQLSGAYLFGGTTALSDQVLRDVDAVVNATAQP"
FT   sig_peptide     complement(237257..237394)
FT                   /locus_tag="Caci_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.989 at
FT                   residue 46"
FT   gene            237642..240188
FT                   /locus_tag="Caci_0218"
FT   CDS_pept        237642..240188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0218"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; KEGG: ace:Acel_1679
FT                   protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69173"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ31"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACU69173.1"
FT                   /translation="MPFLAANARADTVAATVFVGSTSGAPCSDTAAAAGSAATPFCAIQ
FT                   PAIDSPLTGPGTTVLVAAGAAYLGQVNLDKSGTSADPIVLRSASPAQGSRAVIRGTVSV
FT                   NGAHDVTVDGFDIYADTFGVNIEASSDVVVTRDHIEGPHDSSVADSGIMIAMASSAVTV
FT                   STDFVRGFGGGGLFADSVSGLNIVADTITRNTTPSAGLDSIEVTGTSSGVAVADDIIDA
FT                   APSLPAGSAVDYNVIDAGAVGPHDITGDGLAGSTDGDITPGDTSPAIDSAEEAATGELP
FT                   TDMFGNAAADDPLVPNAGTGSRVRDRGAVERTHGDTSYVLTLTPASGDAPLAVTATVTE
FT                   HVGWAQQPRAAFYSFGFGGTEQPATANPTARHTYTTPLYGGDVSVTIYDSAHEAIGYTT
FT                   ALVNVGQPVHATLSVAAASGLNVNAVGSVQGGVGDWSIDFGDGYSTNFYSQTQATANHS
FT                   YAKPGTYKVTLTANGILPSNAAKLTQQVTVTAPPAPPPIVDTDPLVHRIAGSDRYATSI
FT                   VASQVRWSAANSVDGAPAEDQAQAVVLARGDAFPDALAGVPLAAYKHGPLLLTDPKTVS
FT                   QATLEEIRRVLPAGGNHTIYILGGKTAVSPSVEAELRGLGYNVVRYGGTDRYGTALLIA
FT                   HLGLGDPRHLIIAIGGDFADALAAGPFAADSAEVVDGKPAAILLSGKANGNDTITDAGT
FT                   AAYIDAKVQSNGGLSHCTDPNLITAVGGPALTAFLNQEHKATKYACVDGIVGADRYATS
FT                   SQLAGQWTNPEHPGVAVGTTFPDALSGGAYEASLGQPLLLTNPTSLPSSTATALASMYP
FT                   PHENTRTRSVVIFGGTSAVSSAVENQIIAKVHGRAQ"
FT   gene            complement(240596..240930)
FT                   /pseudo
FT                   /locus_tag="Caci_0219"
FT   gene            241186..241251
FT                   /pseudo
FT                   /locus_tag="Caci_0220"
FT   gene            complement(241285..242544)
FT                   /locus_tag="Caci_0221"
FT   CDS_pept        complement(241285..242544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0221"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sma:SAV_347
FT                   IS256 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69174"
FT                   /db_xref="GOA:C7Q0A6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7Q0A6"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACU69174.1"
FT                   /translation="MILKEEDPMTALTSVPAGDDFERQLAAAEPDVLRAMVKSFAEALM
FT                   SAEADAACGAPYGQVSADRTNSRNGYRTRAWDTRVGSIELAVPKLRTGSYFPEWLLERR
FT                   RRAEQALMSVVATAYLLGVSTRRVERLAAELGVTQLSKSQVSAMAKHLDEQVAAFRNRP
FT                   LDAGPYPVLWIDALTQKVRENGRVVNVHALVAVGVNGDGGREILGIDVASAEDGAGWLA
FT                   FLRSLTARGLAGVQLVISDAHRGLVESIGAAIGGATWQRCRTHYARNLMNQVPKTAQPW
FT                   VATLLRTIFEQPDAEAVHAQAGQVIAALEAKFPKAAAHLDEARADLLAFTAFPHEIWRQ
FT                   IWSNNPQERLNKEIRRRTDVVGIFPDRASVIRLVGAVLAEQNDEWAEGRRYMGLEILAK
FT                   IQRTGQGPAPDTAPAAALIA"
FT   gene            complement(242678..244198)
FT                   /locus_tag="Caci_0222"
FT   CDS_pept        complement(242678..244198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_1496 large integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69175"
FT                   /db_xref="GOA:C7QJ33"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69175.1"
FT                   /translation="MTHFQSATPPTASGSHSTPPTPGWLSVGAERADPQDCSEGGCVGD
FT                   YSAPTDLFCRKHDRFLPLSSRLPSRRKTIAINLSRLVVLGGFEYSAQYATNVPLVVLGA
FT                   VLGGLLLVLPLRRFPHTYAAAVRAWAVGGLVCGLAAIPDVTLHRVLGTAVLVIVLGGAT
FT                   LYLGRLASLIGVGDPRIPDQIAPRRAARQHAGRQAALGTPGRVAGLVVGPAVASPAAIL
FT                   TLLALGQGPAQWLFRAPSAIQVFLVTTAIGGPVATLFIAAVAGFLEGAPKVDRQVAPKF
FT                   PEPFAPPRFVLDTVPDGSLGRVASRTVEITVNAVRRAAHVLATSTVRTANWMHRHAVII
FT                   GRKVAATAQCALGILRNAAVIAGYAAMCAVRIVVLPAVGIGAAYALLVPSGSALTRYLL
FT                   SGGFADLGLGIAGAIALAASVMLVWMLLSGLSRDRVLDSATHNVEDLWARVMVLIATGG
FT                   LALGTLGSLGYGKIHIGFVTLSVDAVVAFTVLKGYARTSIPWRRNVTK"
FT   gene            complement(244269..246128)
FT                   /locus_tag="Caci_0223"
FT   CDS_pept        complement(244269..246128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69176"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69176.1"
FT                   /translation="MNQASVHSVLDQLARLGPLRVAFLSGAGVSVEMPTGLPSGAALTR
FT                   RVCEAFFPERTFDTLLDYHAAVGWTITEVCAAQRARAGGIAPKGRLPRLETVLGVAMRV
FT                   LDHDERRVLRILDDVRTAVPNRQHAALAAHLAVGGRQLTLNFDDCIEQRLITLEAPPDA
FT                   ADRLIHLHSSFRADPEGRSLGLTLARIEPGFQKPVEHSLTSTLAAAAAIVVVGYSGSDF
FT                   FDVDQTVAALPSGSLKGTRLYWINHGSHPRWHVIDAANPALPPVIAGLARAGARPTVLC
FT                   GRTGEFLSSLLDAWRLNSGPEPAVSAGPPAPPPTVPVSENERREAALALYRELAIPRAV
FT                   AGILDSGNLAGLPSDAVWLARSELLWEQGRWNDLLHQWLRRTPEGIDPLVRAERVGACL
FT                   WVQGRLVPAYLWLVAHRRAAAVDPDGARRLAETEGRVVEHMARTPELRPIARCLAPQAV
FT                   GRIRALGGLEQQAGVHAFRRRQDLTSSLDAIGGGGVREAGHAAASQNWFAEAGSLTAAL
FT                   SYRHRQLRDEFRPDRPDEELAADYRELADRFDIVGSAAGRVRTCLLPGAERVFGVREFV
FT                   SALFDGQFGWWHRCRLLGHYLPSRVGHIARSALTIRQGRDPRL"
FT   gene            complement(246125..246994)
FT                   /locus_tag="Caci_0224"
FT   CDS_pept        complement(246125..246994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69177"
FT                   /db_xref="GOA:C7QJ35"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69177.1"
FT                   /translation="MTGHRRSPAHDATQRDQLHTHSGHLARIGRDIRDGRGLEGYAVFV
FT                   TGLTMTVLGLTDAVSAPIMGAAQLLAISFLVFHSITPNRHRAVDVLAGREAFAPFPSLL
FT                   PHARDLRIYGPTAINVVVHLAEIRRLVLARGGMVRIVVQKPDPIQLRHTAVQLDQGLDL
FT                   DQTLTAAIRSLERCDGLPGFGYRLLPFNPGFSLVVVNAGDKDGYVIVEPHGFGDQAISD
FT                   RMHLRITRSESPRWFAYWVDRFDAIWAASSDGEHASSGAKPGTDGETRSEGRLGSLSQP
FT                   DAEQGVAG"
FT   gene            247117..249495
FT                   /locus_tag="Caci_0225"
FT   CDS_pept        247117..249495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0225"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; NB-ARC domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69178"
FT                   /db_xref="GOA:C7QJ36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ36"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69178.1"
FT                   /translation="MCGSAGTVGGDVDANREIAAQLKSWRERRHLSQANLADRINVSRS
FT                   HYTRLERGERPLHPVLADALDKALDTGGLFQNLREGSAADPSQHRSSDAASPGESSDRG
FT                   PFVPFPNTVHFTGRADEVQAVCQTLTGQLGHPRAAGICVISGMPGIGKTALARCVAHLL
FT                   ADRFPDGCLCLDLQGFAPGVTPLTDFDALGLVLAMLGVPDEQIPAGRQARVVRYHREIA
FT                   GRRLLLLLDDAVCAQQISCLMPPTAGCSVLVTSRNRLTALDDAHRVVLPVLPPEQAAEL
FT                   FCAVAEYRGGDQTSIDGILAACGGVPLALRIVAARCRPDSGLTPADLAARLAHPRSRLT
FT                   HLADNERAVSDAFGASLDLLPSAQRRLFLLLGLHPAKPLSGWAAAALADIPAEQAERGL
FT                   EELVGASLLEPRGHGRFRVHDLLAEFAASAVRRELPATEIWAATGRMLDAYAVTAEAAD
FT                   RLLTPYRHRLSATEGAATGSPPQTFEDDEHARSWLTDHLDTLSALCVLAATDGWDERSW
FT                   QLAYSLRGVFFLGRHWRLWRATHEAALPAAVRAGNRIGTGMTLANLGFVLGETHDFEAA
FT                   MTHLGAAVEVFRDIGDRHGEFTAQSHLAWIQHCTGDYREALAGQTAALEFRQAVGTPRN
FT                   VAIIMRDMAATELALGKHGEARDHLQTAVAMFTELGLRLDLTMALNGLGELAVHEGDTL
FT                   QADVHHYAALNAARRSGSVFEQARAHAGLGRCAVRRGRPARARHQLTRALRLYDTLGAG
FT                   HVAAAVHAELAALDGAGISAARTRTPGTPSAPSAPGQTR"
FT   gene            249492..250529
FT                   /locus_tag="Caci_0226"
FT   CDS_pept        249492..250529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_5148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69179"
FT                   /db_xref="GOA:C7QJ37"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69179.1"
FT                   /translation="MSPQKTGVPPGEFDIFLSLGGPDRVEANLLKEALVKEGLTVFIDE
FT                   DDIRHFDGITREIERCLRSSRALLAYYSREYPLRSACQFELTAALLAGRNEQDPTRRII
FT                   VVNPEATEDHIQPAYISDARFAVRPGSDHERKALAALIKQKVDTLEGPLSSIAFTRRPR
FT                   WFAFRIAGAPGFVGRYRELWELDSLLTKAALPLTQDTPFGPVAVVTGAARVGKSSLVAD
FT                   YAWQFGAAFRGGVYWIDMSGVEGTADQVLAAYADRVRSSAAIAGLDVAGLSRERMFGVL
FT                   GDHLAATAEPSLWIVDGLPAGLGEQAPHRMIIPAGDRVQTVFVGRRDPFGGAIRAMVLG
FT                   GLSRG"
FT   gene            250633..252387
FT                   /locus_tag="Caci_0227"
FT   CDS_pept        250633..252387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5075 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69180.1"
FT                   /translation="MLAGGRLQDRQGLRSHAEVLADFDGVADIDRFFGVLVRESIGELD
FT                   TARTLVLAVASVCAAAGIPAGLLVRAVATLANGAIDASAVGDALRGLQAAGLAANDDGR
FT                   WSISAVARELAREQNPPGPRRQYLRTVVADALTPMLQDAATSLGDRPGLVTHAVRLCGE
FT                   ADRSEDARWLAILLERLAEHYEARGEAASSAVYRDRLLDIRGENTSDLFYAARAAQAAR
FT                   EFDKAAGLAQRALSGAGSDEPQFRRCRLLLAEALDGALRFQEAETYWEHVAASAGDRDA
FT                   GESTGRAAESVAYARSRIRRGELRRAKQALKLLIEEYARSSGDVEFTTADAVGGQIRGA
FT                   RIEYAHVLALIGDQIEARRVASELVAIYREAGLLRHADMVRAQEILAEAKLVPHIRELR
FT                   LDDTARARAEQDMKQLWQKNREEDGPRSPSALFAGVGYGHALVSQGRKEKARDMLVGLR
FT                   ADAIAVGGPRDPAYLRATFLLGQAYAQMRCYRKALKMFRYAYANQQEILGPAHPYTLAS
FT                   GFELAVMYKTVGEDTEAAKLIREQDALSAKSMEYSNDLRAQIKVAGSLIALIPSPLWRW
FT                   MRGPERDC"
FT   gene            252889..255201
FT                   /locus_tag="Caci_0228"
FT   CDS_pept        252889..255201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0228"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69181"
FT                   /db_xref="GOA:C7QJ39"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ39"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69181.1"
FT                   /translation="MRPEWDRYAQRLKALRSEQGLSQRRLARALHVDHSVISRAESAVR
FT                   RPDPDLAASIDLLLSTGGELQRLARDAVRKQASADSLSTRGGPSGAVPRLRSSIPPDSV
FT                   HFTGRNAEFDQVRSELVERPDAVGAASVCVISALAGVGKTALAIHSAHRLAGRFPDGCL
FT                   FLDLRGFTPGHAPLSSFEALGALLALLDVPVATIHSTEPARSAQFQAETAGARLLLVLD
FT                   NAADAHQVRLLLPSAPGCRVLVTSRNRLVALDEAVHLDLRPLAEVDAAALFRMVSAGGR
FT                   VSQSTVDGIVARCAGVPLALRIAAARCAPGGAFDPELLAAELSRAEDFIGQLDDGERSV
FT                   RAVFDASFSLLPRELRQVLALLGTRLLTVFDIWDVAMLADLPLLGAAGALERLHAASLL
FT                   EVRGTDRFVLHDLVAEYAISAAGQTLGAEQLRAAIGRLLDAYLRVCDRADSQVTPHRHR
FT                   FPLAVAAAGAVPDPDFSDYYEALDWQTKHLDTAAALCETAYEHGFDEQCWQLAYALRGV
FT                   FFLTKHWEQWDRIQRIALAATRRLQDPHAECVTLNNLGLILGERGETDAAHRCLNEAES
FT                   VCRAARDRFGENTARAHRAWLFHTAGRHGESLTEHEGVLEFYTQIDSPRNVAIVMRDMA
FT                   ASEAALGHTDSALAHLHAAEQAFRKLDLTMDLAMALNDLGETYTAIIDPKRAAEYFEAA
FT                   LAACAESGSDHERARAHAGLGALAESAGRQNWANAHYLQALRLFDALGAPAADVVRARL
FT                   HASTVMFPTTAEEDENR"
FT   gene            complement(255268..258165)
FT                   /locus_tag="Caci_0229"
FT   CDS_pept        complement(255268..258165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0229"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: fre:Franean1_4251
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69182"
FT                   /db_xref="GOA:C7QJ40"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ40"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU69182.1"
FT                   /translation="MTAPVRDGGENEAVYDVFFSYSWKNLAEALILVAALEARRLQVFR
FT                   DETGMRDFDDIGTEVFAALAGSRSFVALYTPQFPESAYCRLELAHAMTAAYRLDGDVRR
FT                   ILPVVRELPYEAVRPRALQDKRLPARSTGPDALAAVVAERLEEIDDRPFGIASEPGPPN
FT                   WYPFPTVAEPAFHGRATELWDLHDALAGRDDAAQPGQRLARIVGMGGQGKTMLAEQYAR
FT                   WFAADHPGGVFVLRGFGSHRNANSSPALLRTALEQQLARIAEELPGVPAEVEGRSADRS
FT                   ARSVIRDHLERADQDYLWIVDDLPDHVGPIGVREFLAPTARGRTLVTSRHAHRGFVGET
FT                   VELGPLGESAAVRILLGGAGARADRATIASARRLAADLGHHAMAVALVARTLDNNGTAE
FT                   LDQVRTELADPDRDALEWAAAREHEIATDHQGSVAAAMMRSLARLSSAAYEVLLLASIL
FT                   AAAPVPAAMFDSVLGDSRRLDSTRPGMTVDDALRECAALALATVTVGTFGTLWSVHSLV
FT                   SRAVRFRDRFGSGDREQLRARSVEALGEILERGRDGIVDYLPHVRAVAGGATDVAQQSL
FT                   LNEAGRVQVGLGDERAALAMFERLYQACRESLGEDDFATQAGLVGLGVAYGLLGQHELA
FT                   LDFKTRAYEVLARVEGADEEATLTALNNVAVTFGELGDYAKARVLHRQIYATHLKRRGP
FT                   SHPATLASLNAYATARELDGHESLALRLRTRVVAASRRYLRPDDPQLADAISSLAVSHY
FT                   RAGNSAAARALFQEAYDVRRAIYGPSHPDALSALEFAAVCADPEARTAELRAVYRKRVT
FT                   HADPGSPAARRTLRNLIINLRSVHVSTANPPSDSVNRVFSEPVQEPPGDWTEVAVRLDD
FT                   ETTDERVEDFELASYLHGALVAEFGTDHPETLFAETCLGHATVCLGQLDSQIDDGLNVL
FT                   RDAAEGMRVVLGCPEADLAVVDRLIDWAERLAFDD"
FT   gene            complement(258162..259667)
FT                   /locus_tag="Caci_0230"
FT   CDS_pept        complement(258162..259667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69183"
FT                   /db_xref="GOA:C7QJ41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ41"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69183.1"
FT                   /translation="MAGLDPQERPAGSVPRADQIERMMRRITDGHLRSTGRELTQAAVA
FT                   RYFGVSAETVRSWFSGRRNPGPDRVRDLARFAGVSPIEAFVDAGWLDESDVDPGRSGAG
FT                   GGGDQMYAPEAAVHALLHDETMRARYAVRLLALESHGSYPLTTDVAAQFLLIPGAAVPA
FT                   LADVERLAGMARIVPSPSAAMLRRHPDYCAVRLELAAFVAEPLRWFGQYSWQGDAGSQT
FT                   WRPAADRWPAQILVQDIVSGRSTEAAADGWSCRDQRPLVLIGGRYSSSMAAAMLAGALG
FT                   WQFVLVHSGTVIDRSGQVVATRRDWLSGPAEAWREVAEHVGRSHAAGRPWPAVLAARPH
FT                   SFLTPDGSPDHGALEQLRRTPARIVYARPHEAVLDWWTERQIGLSCEREYKSTALALRK
FT                   QIEAGFDHIEEALRARAETISAERGREDLTIRCRRPSGALDPLRPQIPDGLVDDQVRLA
FT                   WRSLTWLGHTSRHAAELPTRTPRSGPLRRFKRLLEADQEASLS"
FT   gene            259902..260978
FT                   /locus_tag="Caci_0231"
FT   CDS_pept        259902..260978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0231"
FT                   /product="clavaminate synthase"
FT                   /note="KEGG: kra:Krad_3958 clavaminate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69184"
FT                   /db_xref="GOA:C7QJ42"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="PDB:6F2A"
FT                   /db_xref="PDB:6F2B"
FT                   /db_xref="PDB:6F2E"
FT                   /db_xref="PDB:6F6J"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7QJ42"
FT                   /inference="similar to AA sequence:KEGG:Krad_3958"
FT                   /protein_id="ACU69184.1"
FT                   /translation="MKNLSAYEVYESPKTSGESRTEAVSEAAFESDPEVSAILVLTSSE
FT                   ASTLERVADLVTAHALYAAHDFCAQAQLAAAELPSRVVARLQEFAWGDMNEGHLLIKGL
FT                   PQVRSLPPTPTSNVHAVAATTPMSRYQALINECVGRMIAYEAEGHGHTFQDMVPSAMSA
FT                   HSQTSLGSAVELELHTEQAFSPLRPDFVSLACLRGDPRALTYLFSARQLVATLTTQEIA
FT                   MLREPMWTTTVDESFLAEGRTFLLGFERGPIPILSGADDDPFIVFDQDLMRGISAPAQE
FT                   LQQTVIRAYYAERVSHCLAPGEMLLIDNRRAVHGRSIFAPRFDGADRFLSRSFIVADGS
FT                   RSRHARSSFGRVVSARFS"
FT   gene            260978..261880
FT                   /locus_tag="Caci_0232"
FT   CDS_pept        260978..261880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0232"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="KEGG: cmi:CMM_0528 putative metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69185"
FT                   /db_xref="GOA:C7QJ43"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ43"
FT                   /inference="similar to AA sequence:KEGG:CMM_0528"
FT                   /protein_id="ACU69185.1"
FT                   /translation="MSDSFCSTVVTFPEGAIEASSTIVHIQRVLGLDPKATHWAVFTEA
FT                   TPFHPVDPTWPDQPGDTGVLLTDVGELPVTGCVTAAVARAGGELLVDAEITAKRGDPEY
FT                   AWLVCHLVADRAGDLPGRLVGTAAKLLVDRRRRRRLSVAHTACHLTGLALNVNLADRWR
FT                   KPIRTDGLGRPDFDGVAIVSSRIAEDGAMDTYRLGTSLRKAGFVSEGFADGVSALQSAI
FT                   ETSVAEWVRQAGQITVLTKGSALHDRRTWECVLQEGTARTSCGGTHPQNTGELGSVTVR
FT                   CAFDPDTKLLTVATTVVPS"
FT   gene            262900..263061
FT                   /locus_tag="Caci_0233"
FT   CDS_pept        262900..263061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69186"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69186.1"
FT                   /translation="MVLMSSRVGRQVANDVDFERWQRQAREIDYRAVSGGHWSIVDEST
FT                   ADISMFGA"
FT   gene            complement(263392..263476)
FT                   /locus_tag="Caci_R0004"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(263392..263476)
FT                   /locus_tag="Caci_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(263541..264188)
FT                   /locus_tag="Caci_0234"
FT   CDS_pept        complement(263541..264188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0234"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: sco:SCO5845 thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69187"
FT                   /db_xref="GOA:C7QJ45"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ45"
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /protein_id="ACU69187.1"
FT                   /translation="MAELVFFTGTMDSGKSTLALQLDHNHNARGRAGLIFTRDDRAGSA
FT                   TISSRLGLKAAAVEVGQNTDLLNHVVQLMSAGGKVDYVVADEAQFYTEDHIEQLARMVD
FT                   ELSIDVYAFGITTDFRTRLFPGSKRLIELADRIEVLQVQTLCWCGARATHNARTLGGEM
FT                   VVEGEQVVVGDTAVADEIGYEVLCRRHHRRRLTAARSGAAALSPDTLPFGAA"
FT   gene            complement(264205..264516)
FT                   /locus_tag="Caci_0235"
FT   CDS_pept        complement(264205..264516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69188"
FT                   /db_xref="GOA:C7QJ46"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69188.1"
FT                   /translation="MIRRSLTALAAAAAAELCCVAGSYLHAIRLVAHVEGVSVWTALNS
FT                   RHNASLTAWRASLTVGDRLLFVAVALVAAAAVLARPYLKPTFGRIRTRITSVRGLPRA"
FT   sig_peptide     complement(264454..264516)
FT                   /locus_tag="Caci_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.446 at
FT                   residue 21"
FT   gene            complement(264689..265114)
FT                   /locus_tag="Caci_0236"
FT   CDS_pept        complement(264689..265114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0236"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   mmi:MMAR_5292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69189"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ47"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ACU69189.1"
FT                   /translation="MSQQPYGQPGYQQGPPPQQGQYAPPPQQQGFQQNFLCVTTNDIPG
FT                   YRIDAVYGEVFGLTVRSRNAFSQMGAGLKSMFGGELKGMTKALMDSRNDVMQRMIQEAI
FT                   NRGGNAIVGMRFDTSEMGDVWTEICAYGTAVTISRQG"
FT   gene            265300..266295
FT                   /locus_tag="Caci_0237"
FT   CDS_pept        265300..266295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0237"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV_4224 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69190"
FT                   /db_xref="GOA:C7QJ48"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ48"
FT                   /inference="protein motif:PRIAM:3.1.4.46"
FT                   /protein_id="ACU69190.1"
FT                   /translation="MHSLRPSEPRPSERRRSEPVSPVRQHAALRTGASGPGLPRRPALE
FT                   IPVIAHRGASDDVPEHTLAAYEAALLQGADGLECDVRLTADMQLVCVHDRRVNRTSNGR
FT                   GVVSTLELAQLRQLDFGSWKQPAAGEEHEYAEYPDLRREGAHRVLTLERLLQLVVEHPH
FT                   RVEMAIETKHPTRYAGLVEEHLVALLDRFGLAHPRLGETSPVRVMSFSAMSVRRIRRLA
FT                   PSLDTVLLLDRVPLRLRDGSLPRGVRIAGPGIHILRIHPEYVERVHSMGNRVHVWTVDQ
FT                   PSDIDLCVELGVDAIISNRPKAVLARLGRDGTAAAAAARHGVVELNPDSP"
FT   gene            266366..267253
FT                   /locus_tag="Caci_0238"
FT   CDS_pept        266366..267253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0238"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sco:SCO3975 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69191"
FT                   /db_xref="GOA:C7QJ49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ49"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69191.1"
FT                   /translation="MGVVMSVQPESPRKSVSLSTTVTRAPAPRPADSRGTGGTEFPYTP
FT                   ESVGTARHALADALQRMRVAPPAADDAVLILSELVSNALRHALPLAGGTIRVAWWMADD
FT                   KVLRIAVTDGGRQQPGQAPPLKAAEAPDLVAPDLDDIDESAVDGRGLGIVGLLADAWGV
FT                   EPWYAPETEATSPYLHAATTSATASAASSAATSRAIHPDPSAPKTVWAAVRLHARHAAP
FT                   PPPDDQDRRWWRRMRLSLTAHLPGTTRPRTRGTRLGGSRLGEARGGPDSDAAGSDTAWV
FT                   PRYPEARVGCAAAG"
FT   gene            complement(267790..269736)
FT                   /locus_tag="Caci_0239"
FT   CDS_pept        complement(267790..269736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0239"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; Chorismate
FT                   binding-like; KEGG: stp:Strop_2960 glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69192"
FT                   /db_xref="GOA:C7QJ50"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ50"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ACU69192.1"
FT                   /translation="MPHQGQGQDTLTSPSPSLPDGPFALIRRGVEAEVELLTGQAFEQF
FT                   PALADLPTEDSDALLALVPYRQLTERGDECHDDHAPLLAMRITERRRFGIAQLPPATPP
FT                   VLRDGAFDVDDEAYGASVKRVLDEEIGAGEGSNFVLRRTFVGHCDSARETAYGAFCALL
FT                   EKERNAYWTFLIDTGEGFMVGATPERHVSLADGVAVMNPISGTLREAPATASRERVLAF
FT                   LQDAKEREELAMVVDEELKMLAEVGDLGGRVRGPFLKEMANLAHTEYYIEARTTMDPRL
FT                   ILRTTMFAPTATGSPIRNAFRVIKRHERGGRGYYAGVAALIGRDEAGAPTMDAPLLLRV
FT                   AYVENDGTVRVPVGATLVRGSDPYEEVRETYAKAAGVLRAFGVGFGARGGLAVGTEVAP
FT                   LGGSDAAAASVTPAPLSAPDATPIRTTPWSEDPEIAALLSARNESLSGFWLNEHEPADL
FT                   VDPQLAGRKVLIVDNEDAFTSMLAVELRALGLETTRVSHDEVPDHTTYDLVLLGPGPGD
FT                   PRDTASPRMTSVRTLAKLLIDHRVPTLGLCLGHEALAAALGLELVRLPTPMQGTQVELD
FT                   LFGTTERVAFYNSYAARKPEFLVLDTVLLPGTTLTAALRGPSFTGLQFHPESVVTMDGL
FT                   GILSREIRRLLTR"
FT   gene            270018..271001
FT                   /locus_tag="Caci_0240"
FT   CDS_pept        270018..271001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0240"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV_4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69193"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ51"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU69193.1"
FT                   /translation="MGKKSSRTAKAGPAKAVDGEIPVVGAREACPCGSGRRYKACHGRE
FT                   AAAAAHQQAAEVTANKRPFEGLPGEADIVAMRELVPAATAPLKLAGEHADRTVTLATVL
FT                   PMAAPAVHRDTGEIMLALQTLATSGDPDRDLADALLRALDSAPGTVVDSAAPAADGPRL
FT                   RDLLDTSGDSLGITVHEDFSFWIIDGADVSPEAQLSLEHANAAAYPTKKLESVPSAYWT
FT                   RIREKGHLRWVMPHEEEKLMDALARLHAAKQSNLGEGTRYVGAFRACGLVVPVWDLPKE
FT                   MEAAEIEKPAAEFAERLAKALTDDSPLTNDQRRARAGLVSRQVTLR"
FT   gene            complement(271124..272263)
FT                   /locus_tag="Caci_0241"
FT   CDS_pept        complement(271124..272263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69194"
FT                   /db_xref="GOA:C7QJ52"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69194.1"
FT                   /translation="MAGMALSRTVRPRALALLPAVAAGGAALVGAGLPTSAAAAAAAAS
FT                   HAAASTLITVTVDSVPALSLNAFQGSYATSTLAQNAGDGSADGAQDPNGVLDRITLDQP
FT                   TQSKIHSDPAKNWADAQPAVEYTLHGKKLYAVSSVDAHAECTPSGQGVNTYVHTAPNSV
FT                   TVLGTNVGAGKTTMAVTGAQLGVAGVDHGSLDVSYTTTATQGQQAAGTSARAHMDLTIS
FT                   GVFYDSQGKQLYSGQLQKLRLGDVQVACQNSGTTTPAPTPTTAVTVASSSGGSVDGVGD
FT                   PTAPGPAAPSTLKGEPDPAAYMRSPHQAGQNGQVRGNAKDEMGPAVPENGPVLPAENAA
FT                   KSSTSGGSDGSLWWALLSVLGLGGGTALYFATRRRGRHQ"
FT   sig_peptide     complement(272144..272263)
FT                   /locus_tag="Caci_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.403 at
FT                   residue 40"
FT   gene            complement(272436..273062)
FT                   /locus_tag="Caci_0242"
FT   CDS_pept        complement(272436..273062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0242"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_0659
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69195"
FT                   /db_xref="GOA:C7QJ53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ53"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69195.1"
FT                   /translation="MDASRHSDDKILDAAQSALLDLGLRNTTLAEVARRAGASRMTLYR
FT                   RYPDIDALLTEVLGRQLIRVVRRNAGLQELAGGGRSARDLLVTGTVEVVRAFHGDLLMH
FT                   KILESDAEFLLPYMTREFGPLQHYALDLLSMRLEQGHEDTSIRHGSVALQARTVLLTAQ
FT                   SFVISARAAGSVPMDRLLEELREMLDAYLRPSADGAQAPDPEPAV"
FT   gene            273093..273794
FT                   /locus_tag="Caci_0243"
FT   CDS_pept        273093..273794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0243"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   kra:Krad_0170 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69196"
FT                   /db_xref="GOA:C7QJ54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ54"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69196.1"
FT                   /translation="MEAEPVTEVTSSDVFVIIPAWNEQERIAATVRAAAALGPVLVMDD
FT                   GSRDATTRIARRAGARVLTTRNNLGKGAAMAAGVAALPQQARYVLFLDADLEDTASQAG
FT                   PLVDAVRSGSCDMAIALPPPQPGGGHGLVVGLAREGIKRLTGFDAAAPLSGQRCLTREA
FT                   AEAVRYAARFGVEVGLTIDLLRAGYEVAEVPADLRHRVTGEDWRSQIHRARQYRDVLLA
FT                   LRSRSLPPRSP"
FT   gene            complement(273760..274083)
FT                   /locus_tag="Caci_0244"
FT   CDS_pept        complement(273760..274083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0244"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: sma:SAV_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69197"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ55"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU69197.1"
FT                   /translation="MLATTDVNALPEGGLLLDVREDDEWAAGHAPTAQHIPMSEFAARK
FT                   DELGTPEGPVYVICRAGSRSAQVAQYLSQNGVEAVNVTGGMQAWEAAGKAVVTDSGAAG
FT                   IVI"
FT   gene            274186..275463
FT                   /locus_tag="Caci_0245"
FT   CDS_pept        274186..275463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0245"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: sco:SCO3961 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69198"
FT                   /db_xref="GOA:C7QJ56"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ56"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU69198.1"
FT                   /translation="MIDLRLLRTDPERVRASQRARGEDPALVDALLSADEARRAAVSRF
FT                   DTLRNEQKVLGKQIPKAAGEEKAALLEQAKKLADGVKAAEADQHEADDVLKQLQLSLSN
FT                   VVIDGVPEGGEDDFVLRETVGTPRDFAADGFEPRDHVELGKLLGAIDLERGVKVGGARQ
FT                   YYLTGVGALLEIALLNMAMAQATTYGFTPMITPSLVKPEAMAGTGFLGQAAENVYHLTE
FT                   DDMYLVGTSEVPLAAYHMDEILDAAKLPLRYAGYSSCYRREAGSYGKDTRGIIRVHQFE
FT                   KVEMFSYVLPEEAEAEHLRLLGWEKEFLTALEIPFRVIDVAAGDLGSSAARKYDCEAWI
FT                   PTQGKYREVTSTSNCTEFQARRLQIRMRGADGVKPLATLNGTLCAMTRMIVAILENHQN
FT                   ADGSVTVPAALRPYLGGREKLEPVAG"
FT   gene            complement(275522..276583)
FT                   /locus_tag="Caci_0246"
FT   CDS_pept        complement(275522..276583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69199"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69199.1"
FT                   /translation="METENPDTGRMHQLFGAALDDVDLTGDVVPNVLTGYAHKVKVRRY
FT                   QGAGVAVAALAAAGIAVNVLPHGTGGAPPTTSSATPVQQSPDYCQHQQWVRVSAGVVVQ
FT                   NGNVPLAIPLSPDPRADQASCDALQKALHAVFPEARLIPAFNPDLTRDPRLDQARVRTI
FT                   EMEETTDPNKWSADLTKYFGSELTRLAAHPEDPVNVYMPGQYTLVTPGVRESFGVAFVT
FT                   AAPVANAPESFVGSVGSEDCEKMPAALKDKDQCTSVGVSAGWHGALWNTPAQGVNAPEQ
FT                   TVVLTNGSGTRFQLNAHGTDDSARGIAPSGNALTDEQWARLVASPALQKYADDYFGKAP
FT                   VVPHSTPSPTHSR"
FT   gene            complement(276573..277136)
FT                   /locus_tag="Caci_0247"
FT   CDS_pept        complement(276573..277136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0247"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sgr:SGR_2995 RNA
FT                   polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69200"
FT                   /db_xref="GOA:C7QJ58"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ58"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69200.1"
FT                   /translation="MIGRLTQEELADFTAFAQARQRHLMRTAFLLSGNRQSAQDLTQTA
FT                   LLDLCRSWRRVRRADDVDAYAHRVLINAFRTSARRSDRERKALWRKASEAAGSPADGAA
FT                   PDQSVGMRLSLLAALDRLPPKARAVVVLRYWEDLSVEATAAALGCSTGTVKSQSSRALA
FT                   RLRALLGDGFATTDSEHWEISYGN"
FT   gene            complement(277219..278541)
FT                   /locus_tag="Caci_0248"
FT   CDS_pept        complement(277219..278541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0248"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_1492 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69201"
FT                   /db_xref="GOA:C7QJ59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ59"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69201.1"
FT                   /translation="MRTIINRDFTRLWYGEAVSEVGDYVFNTTLVLWIATKLGNGKSWA
FT                   PVAVSGVLLSGLAATLAIAPAAGVFADRWNRKRTMLRMDAIRAVAVGGLAALAFLPAGK
FT                   LPVGVWLAIIYAVVFVINAAGTFFGPSRMAVIPDVVGGPDEIARASGITQSTAALAGMI
FT                   GPPLAAPLLFAGGVQWAMLINALSYVVSFTAIRPVPIPGNAPSPAAKAESGFWSEFRAV
FT                   LAFFAKTRVLVVLIISACIANFGAQAMNTLDVFFATRNLHAAPKLYGLLGMAIGAGAII
FT                   GALLSTRVVRRIGTVNAVWATIGTAGVLIVAYSRQTSIWAAIPVIFLASLPIAMVNTAM
FT                   EPLLIQVTPRAMLGRVFSVITPAISVTQLGSTILFGWMISSLMLHFHADVAGLHVGPID
FT                   TLFTVTGLLFVVAAIYAFVMLPRKDGVPAAEPDDEGELALV"
FT   gene            278772..280166
FT                   /locus_tag="Caci_0249"
FT   CDS_pept        278772..280166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0249"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69202"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ60"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69202.1"
FT                   /translation="MKRRTSSLLTAIALVSGAAASTLAVAPAQAATDSGTCASGSEKQG
FT                   PISFNPSAAVAPATIGIRVAANTIDAANGCKAVLDFGDGTSTALSTDADVAHTYTNPGD
FT                   YRVTLTLQWPGYSPAVESGHLLIGGAAGQAQITRIAGADRLDTAVQISQKQWLTVDPKS
FT                   SWGQAQTAVIATSGTFPDALAGGPLAAYKRGPLLLTPPNAGLYGAANDEINRVVPKGRT
FT                   IFILGGYAAVSASVDQQLITEGYKVQRFAGQTRFDTALQVAKFGLGDPANVVVATGTDF
FT                   PDALSAGPLAAGPRATEVAGQAPQPAAIILTNGAKFFDPSTSAYVKGKLGTANCNAVTA
FT                   VGGAAVHALGALAGGLCHSELSGADRYATSAKVFGEFSLTYLVGVASGTTFADALTGAA
FT                   YVANVQQPLLLTDPTHLPDPIGAYFDAMGKQAGISYVDVFGGPKAITDHVYGQIADAAH
FT                   SGEYNP"
FT   sig_peptide     278772..278864
FT                   /locus_tag="Caci_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            complement(280193..281374)
FT                   /locus_tag="Caci_0250"
FT   CDS_pept        complement(280193..281374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0250"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: saq:Sare_0997 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69203"
FT                   /db_xref="GOA:C7QJ61"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ61"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ACU69203.1"
FT                   /translation="MGSSVTSTLLTGIAELTTHADSGGLADSTVADAAMVVVDGRVAWT
FT                   GPGAGAPDADERVELGGRAVIPGFVDSHAHLVFAGDRAQEFAARMTGAPYSAGGIRTTV
FT                   AATRGASDDVLRSNLRRLVGEMLRQGTTTVECKSGYGLTVEDEARALRLAREQVEAVTY
FT                   LGAHVVPAEYKDRAGEYVDLVKGPMLDACAPYADFADVFCERGAFDEEQTREILTAARA
FT                   KGLDLRLHANQLGNGPGVQLAVEFGAASADHCTFLDDKDIDALAGSQTIATLLPGVEFS
FT                   TRSPYPDARRLLDAGATVAIATDCNPGSCYTNSMPFCIAVAVRDMHMSPAEALWAATVG
FT                   GAKALRRDDVGHLGVGARADFAVLDAPSYLHLAYRPGVPLVHRVWKNGTPVAG"
FT   gene            complement(281646..283079)
FT                   /locus_tag="Caci_0251"
FT   CDS_pept        complement(281646..283079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0251"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: sma:SAV_3494 N-formimino-L-glutamate
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69204"
FT                   /db_xref="GOA:C7QJ62"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ62"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACU69204.1"
FT                   /translation="MTSSENPQTATTIPATTPSPNGGAASAGADRRAFWCELAWINGEI
FT                   KSKVLIEVAGGQISAVTCGVKPRPQNAEKLTGLTIPGLANVHSHAFHRALRGRTQIESG
FT                   TFWTWRERMYAAAAHLDPDSYRELATAVFAEMALAGVTAVGEFHYVHHSPKGGLYQDPN
FT                   AMGHALTEAAEAAGIRITLLDTCYLSGGFDNELNDVQRRFSDGDAGRWAERVEALRKAY
FT                   AGSDTVRIGAAVHSVRAVPVDQLSPVVAFAAENEMPLHVHLSEQRAENDACLARHHKTP
FT                   TELLHAHGALGPRTTAVHATHLSQMDIDLLGTSATAVCMCPTTERDLADGIGPAHAVHL
FT                   AGSPVNLGTDSHAMIDLFEEARAVELDERLRTERRGHWLASELLQAATTDGHASLGWPT
FT                   TGRLQPGTPADFTTIALDTVRLAGVQPAHAAESVIFAATAADVRHVVVAGKFTVRDHQH
FT                   MLVDDVPGRLAATIGAIFK"
FT   gene            complement(283076..284329)
FT                   /locus_tag="Caci_0252"
FT   CDS_pept        complement(283076..284329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0252"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: sgr:SGR_4463 M20/M25/M40 family peptidase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69205"
FT                   /db_xref="GOA:C7QJ63"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ63"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ACU69205.1"
FT                   /translation="MSLFSVHRAVDEAEASAYSDMWRSLLPLGLNSDTGGYRRFAWNTA
FT                   DLACRDWFRSEAAARGLEVETDRNGNLWAWWGPKGPGAIVTGSHLDSVPDGGAFDGPLG
FT                   VVSSFAAVDVLRARGFTPAKPFAVACFSDEEGARFGIACAGSRLMTGALSAEKARGLCD
FT                   LDGVTMASAMEQAGQDPATLGRDDERLEGIAAYVELHVEQGKALAFTESPVAVASAIWP
FT                   HSRWRFEFAGEANHAGTTRLEDRRDPMLTYANAVLAARKKAKLGGAVATFGRLVVEPNG
FT                   TNAIPSRVRAWLDVRAPADEILAAVTEEIIKAADERAGRDGTVLSTERESHTPVVEFDD
FT                   VLRNRLAGSLRQTFGAVPVLPTGAGHDAGILAAAVPTAMLYVRNPTGVSHAPGEHADDR
FT                   DCLAGVTALADVLQELCQ"
FT   gene            complement(284332..286002)
FT                   /locus_tag="Caci_0253"
FT   CDS_pept        complement(284332..286002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0253"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: sco:SCO3073 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69206"
FT                   /db_xref="GOA:C7QJ64"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ64"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACU69206.1"
FT                   /translation="MTATSGPRPVRAARGTSITAQGWQQEAALRMLMNNLDPEVAEHPD
FT                   ELVVYGGTGKAARNWPSFDAMVRTLQTLKNDETMLVQSGKPVGVMQTHEWAPRVLLANS
FT                   NLVGDWANWEEFRRLDALGLTMYGQMTAGSWIYIGTQGILQGTYETFAAVAAKKFNDTL
FT                   AGTITLTAGLGGMGGAQPLAVTMNGGVAICVDCDERSIDRRVEHRYLDVKANSLDHALQ
FT                   LATEARDKREALSIGVLGNAAELVPRLLAMDAPIDIVTDQTSAHDPLAYLPLGMDFHDM
FT                   KQFAKDKPAEFTQRARESMAKHVEAMVGFQDKGAEVFDYGNSIRGEAQLAGYTRAFDFP
FT                   GFVPAYIRPLFCEGKGPFRWAALSGEASDIAKTDKAILELFPENESLARWIKMAGERVH
FT                   FQGLPARICWLGYGERDKAGARFNDMVADGTLAAPIVIGRDHLDAGSVASPYRETEAMA
FT                   DGSDAIADWPLLNAMVNVASGASWVSIHHGGGVGMGRSIHAGQVTVADGTKLAGEKVRR
FT                   VLTNDPGMGVIRHVDAGYDRADEVADERGVRVPMREGDA"
FT   gene            286093..287646
FT                   /locus_tag="Caci_0254"
FT   CDS_pept        286093..287646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0254"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: sma:SAV_3325 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69207"
FT                   /db_xref="GOA:C7QJ65"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ65"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACU69207.1"
FT                   /translation="MSQVVVIGEADLTFGDVVAVARDGARVELSATSLKALAEGRAVVD
FT                   RLAAAPTPAYGISTGFGALATRHIDPEMRAQLQRSLIRSHAAGMGPLVEPEVIRALTLM
FT                   RLKTLATGHTGVRPVVAETMAALLNSGVTPAVREYGSLGCSGDLAPLSHVALVLMGEGE
FT                   VVGADGVSAVAAGPVLAEHGIEPLELAPKEGLALINGTDGMLGMLILALGDLTELVKVA
FT                   DISAAMSVEALLGTDKVFRPELQAIRPHPGQAASAANLVKVLDGSPIMESHREPNECTR
FT                   VQDAYSLRCAPQVAGATRDTMAHAATVAERELASIVDNPVVLLADGRVESNGNFHGAPV
FT                   AMVLDFLAIAAADLGSIAERRTDRMLDVARSHGLPPFLADDPGVDSGLMIAQYTQAALV
FT                   SENKRLAVPASVDSIPSSAMQEDHVSMGWSAARKLRTAVDNLRRILAVELVAAARALEL
FT                   RAPLQPAAGTGAAVRALREAGVGGPGPDRFLSPELRAAEDALKSGAVVAAVETAVGPLN
FT                   "
FT   gene            complement(287731..288150)
FT                   /locus_tag="Caci_0255"
FT   CDS_pept        complement(287731..288150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69208"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69208.1"
FT                   /translation="MAARGWNRQYITQVHIEEPLAGTCGNSLGPETDQNDVWDARYPST
FT                   NGRDYADQQVHTYVSAAYAASRVAASDPKCSGVTARTAGGFAWHGTAREGIQHVLFVRL
FT                   NNKVSTLVITVDGHDYDSALDTALLQTMAQRLANS"
FT   gene            288182..288544
FT                   /locus_tag="Caci_0256"
FT   CDS_pept        288182..288544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69209"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69209.1"
FT                   /translation="MVVDGGAEGVGDASSVGGGELSVVEAVVEPEADADFEVDVEAAPL
FT                   LVLLLVLVLVAGFAGDADELLLPHAPRAALSAIAHPAATTVRILTVSGIEFPVLHWSQD
FT                   GWWTFHLARGLPARAG"
FT   gene            288652..289038
FT                   /locus_tag="Caci_0257"
FT   CDS_pept        288652..289038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69210"
FT                   /db_xref="GOA:C7QJ68"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69210.1"
FT                   /translation="MASQTARHKMAICFVGSAIVLVGWMVFLANTLHGAATVSHWSTVW
FT                   IGLDTMEALALATLGILLVRHDHRARTAATVAATLFGMDAWFDVMLSQGGDFAQALVLA
FT                   VVFEIPLAAACAGIARQTARWYDV"
FT   sig_peptide     288652..288756
FT                   /locus_tag="Caci_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.852 at
FT                   residue 35"
FT   gene            complement(289052..290407)
FT                   /locus_tag="Caci_0258"
FT   CDS_pept        complement(289052..290407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0258"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: stp:Strop_2409 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69211"
FT                   /db_xref="GOA:C7QJ69"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ69"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69211.1"
FT                   /translation="MAGKLPSRFSRIWSASAVSALGDGVYFAAVPLLALTLTRNPIMLG
FT                   AMEACALLPWLFFGMLGGALVDRWDRRRTMVIADLCRFSLLVLVTALIAAGAVDIYFLF
FT                   VVVFLLGIGQVFFDTASVAFLPEVLDRDLDTLQVANSRLQGAQQAFGGFVGPPVGSLLF
FT                   GLGRAVPILGDAVSFLFSSLTIWSLPKSAPKPAKPRGSLLREAREGAAFLFGNRLLVGL
FT                   SLRPAVGNFAFLGASAVLVLYVKETLHLGTTAYGIYLTANAIGALGGSAVAPRLAGKLG
FT                   TGGTLTLTAVVEAVSLLGIGLSPNAWTAGIGEMVLGAAMGATMGLGPAVRQAIVPDHLM
FT                   GRVAATGRLIALCAGPVGALFGGWLANVAGLRAPFIAGAGILAVMAVVAARLTSNTRIE
FT                   AALAEAAGRRERETSQEQEQEQGQGQDRGQKQAQAVEQAVEANVAADAVAMA"
FT   sig_peptide     complement(290303..290407)
FT                   /locus_tag="Caci_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.368 at
FT                   residue 35"
FT   gene            complement(290407..290922)
FT                   /locus_tag="Caci_0259"
FT   CDS_pept        complement(290407..290922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0259"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bcz:BCZK1497 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69212"
FT                   /db_xref="GOA:C7QJ70"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ70"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACU69212.1"
FT                   /translation="MPTDEEPDAIHIQSDEQLRAVASHTRHRILRVLRDKPATITQVAE
FT                   RLGIAKGSSNHHMKVLAKAGLVAVVETRKVGGVTEQYYAMTGRTIELPETGAGQPEMLM
FT                   RHALADIEAAPPSDQRTVFLKHARLSPEAWVEFNERLQALIGELHDASDPTQPAADLFV
FT                   AFYRPKDV"
FT   gene            complement(291017..291988)
FT                   /locus_tag="Caci_0260"
FT   CDS_pept        complement(291017..291988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0260"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69213"
FT                   /db_xref="GOA:C7QJ71"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ71"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ACU69213.1"
FT                   /translation="MTTPEPVTPTTSAEIAAPPSVTPATPAAASAASAGSRLSSTLPPA
FT                   DELLALLDGRRLSPAQRRIAHYLLENLPEVAFLSSMELAERVGVSQPSVTRFAAALGFS
FT                   GYPELRAALRPIALRVPEAGIHGERIAGNELHSALESDQANLEALHKYAADPARLSRLG
FT                   SDLAASEPLSVIGLRMSAPVASYFAYGAARIHPDVRVVHTPGSLAHEALLQAVAAGGTW
FT                   LVVFVLPRYPAESVVVLRSARELGLKTAVITDVPLVPFAHLADVLLPVGVGSRSVFDSH
FT                   AAPMAFAALLLQALADAAPERTQERLEAYEALAETRGFYVSK"
FT   gene            292147..294393
FT                   /locus_tag="Caci_0261"
FT   CDS_pept        292147..294393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0261"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: sgr:SGR_3436 putative
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69214"
FT                   /db_xref="GOA:C7QJ72"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ72"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACU69214.1"
FT                   /translation="MQLAAIVVSLVISVIGFGLLGRTAVYIYQFVKLGQSTAPGVRSNE
FT                   PLERTRNLFREFLGHTRLARKGKRWIGAMHWVVMVGFGLLFFTLVTAYGQLFSADFAIP
FT                   LIGRWWPFEFVTEVISFVMILAIAALIGIRLRNRPAGAGSKEKGKRSRFFGSTMWQAYF
FT                   VEGVILGIGLCIMLLRGFEGALGGHLSYSAHYPVSYPLVHAFDGMSRGSLENWIYAIAA
FT                   VKIVISMAWAITIGLNSTMSVAWHRFLAFPNIWFKKKADGGTALGALSPMASGGVPIDF
FT                   EDPAEDARFGVGAVEDFTWKGLLDFSTCTECGRCQDQCPAWNTDKPLSPKLLMLALRDH
FT                   SAAKAPYLFAGGGKDLEGNEKLAEEKWLSLPDMVRAEAERPLIGTAEENGVIDPDILWS
FT                   CTTCGACVEQCPVDIEHVDHIVDMRRYQVMIESSFPSEAGTMLKNLEKAQNPWGMQPKK
FT                   RTEWIQELDFEVPVFGETLEDISEVEYLYWVGCAGSLEDRAKKTTKAFAELLHIAGVKF
FT                   AVLGGMESCTGDPARRLGNEFLFQMLGQGNVEMLNEVFGEDTPREKRKIVATCPHCFNS
FT                   LANEYPQLGGEYDVIHHTQLLDTLVSEGKLTPVTPIDQNITYHDPCYLGRHNKVYTPPR
FT                   EIIAKVPGLKNTEMHRCKEKGFCCGAGGARMWMEERIGKRINVERVDEALSTNPDVIST
FT                   ACPYCLVMLGDSITARKQAGEVPESMEVVDVAQLLLTSVKPAPASSAEPAAANA"
FT   gene            294505..295530
FT                   /locus_tag="Caci_0262"
FT   CDS_pept        294505..295530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5144 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69215"
FT                   /db_xref="GOA:C7QJ73"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69215.1"
FT                   /translation="MSFDEPDGYRDDLGRTRDDGSRYPASGSPDSEYGDDDDYDDSDPG
FT                   DEPTAPLPTRGRPVVPPEPPSEWRKRGSRVWRFTRTLLITVLVLVGLAAVGNVLINRYP
FT                   RISKHTYTYTNVQRMLIAVDGNGSINVTGSDTDQVTIKATDRATLLDPVERQIISAGGY
FT                   LLVSVHCPNSECSSKYTIQVPRSMSVEAMMDHSSDQADISATGLDAAVQLFTGRGNVTV
FT                   NHLATTSDVSVTANGQVVANDVSAANLDVFAPIGDKIDLQVSGDISNIQNIRVTAGQPA
FT                   EVTLKVPAGGYRFACVPAGHCTGANGDITQDEASPVHEDQTSTHNIQVNVVQNTAKIQA
FT                   N"
FT   gene            complement(295622..295744)
FT                   /locus_tag="Caci_0263"
FT   CDS_pept        complement(295622..295744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69216"
FT                   /db_xref="GOA:C7QJ74"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69216.1"
FT                   /translation="MEVLIIFGGVYAAFLIGRVLQYLSDAKRVLGRGGDRNGKR"
FT   gene            296375..297319
FT                   /locus_tag="Caci_0264"
FT   CDS_pept        296375..297319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0264"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69217"
FT                   /db_xref="GOA:C7QJ75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ75"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU69217.1"
FT                   /translation="MRANQRNQPVTGINVLRWELGSELRTLRLAAGKSIADAARHLECS
FT                   DAKISRMENGQRGAVARDVRDLCKLYGVPAQRRDQLISLSREAVDADKGTTPIPAKYST
FT                   FIALESQARSLRNYEMTFVPGLLQTERYAWETITRNGDSRDEADVERLVQIRMDRQKRI
FT                   WNDSSLKAHFVIDENVLWRPAGVDGRTRAIREEQIDRLIRATGLDHVTLQVIPYVAGFY
FT                   QGMEGATIHLLNLDDGPKTGSACYIEGVFRELFVRGHGEIADIGAKFAAMADTALSALD
FT                   TRKFLMRLLKGNYEHWSSARPQGSSGLGKVAMS"
FT   gene            297316..297522
FT                   /locus_tag="Caci_0265"
FT   CDS_pept        297316..297522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0265"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   sen:SACE_6608 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69218"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ76"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU69218.1"
FT                   /translation="MIGNDGLQWRKAAASSGNGSCVELAPGLAGSVYMRDSKDPQGPVL
FT                   TFTRKEIAAFLEGARGGEFDDLA"
FT   gene            297780..297989
FT                   /locus_tag="Caci_0266"
FT   CDS_pept        297780..297989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0266"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   nfa:nfa56120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69219"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ77"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU69219.1"
FT                   /translation="MEIDRSKARWTKATASSGNGACVEAASVKEDEILVRNSRDPEGPK
FT                   LAFTKAEWVAFLAGVKAGEFDAIV"
FT   gene            298052..300037
FT                   /locus_tag="Caci_0267"
FT   CDS_pept        298052..300037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0267"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sma:SAV_2672 HSP90 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69220"
FT                   /db_xref="GOA:C7QJ78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ78"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69220.1"
FT                   /translation="MSSEKPLVSESASAATDAGGRGLPTAHAFQVDLRGIVDLLSHHLY
FT                   SSPRVFVRELLQNAVDAITARRAVDGGAPGVVRIIADGAQVQVRDSGIGLTEDEVHRFL
FT                   ATIGRSSKRGGAGADGFGGGVGGGFGGGFGDAESVLELGRSDFLGRFGIGLLACFVVAD
FT                   EISVVTKSAVDAEAPAVEWRGASDGHYDIRILAPEETPAQPGTTVTLKPSRGKEFWFQA
FT                   PRVVELARDFGSLLPYETVLEDEAGYTYRITETPPVWDREYPSPGTRFEALAAYCQDTL
FT                   GFAPLDIIELNIPLLGIKGAAYILPTAATAATASEQGGHRVHIKGMLLTDQARGLLPDW
FT                   AFFVRCVIDTDALRPTASREALYEDDRLAAVREALGNRVRDWLAGLAATDPPRLNRLLA
FT                   VHYLGVKALARFDDDLFALTLPWLPFETTSGRLPLTAFADQHRVIHLTAGDEEFQQVSQ
FT                   IAAAVGLGVVNGGYTYDADLVRKLPRALPGVTVLDLDPETIAAHLDTVDSVEELAAGPL
FT                   LATARRVLDVQDCDVALRAYHPVTIPALLLDGRDARHERARADAESEALADGDDLWAGI
FT                   LGALRTVGPRARLVLNHRSPLIQGLIELEDAELAATGIEAVYGQALLLSKRPIRSSESA
FT                   LLNRAFLGLLGYAVGQRQEPETEEED"
FT   gene            300047..303094
FT                   /locus_tag="Caci_0268"
FT   CDS_pept        300047..303094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69221"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ79"
FT                   /inference="similar to AA sequence:KEGG:SAV_2673"
FT                   /protein_id="ACU69221.1"
FT                   /translation="MSSTHMPSTSEPAFHQMTWTPEDLRAALEANENEPPGRARSVRAE
FT                   TLLAAADKLGDPETQICALHTVIEAYERGGESFRSPVLFSRLLRLWDRHGKTLRDASRL
FT                   EYETHWVFKWMTSDLLSVPEVPLATVTGFVDEMERRYRLAGYGMRAVHAQRFRIAEHLG
FT                   DTAQAEVHFGRWLSADRDLMSDCRACEHLTQGVWRAENGDDLAAMRLWRPTVENEISCL
FT                   DEPASTLAASLKPLLRLRRYDEARSNHLRGYRLLRGHVELRTAFGRHIEFCVLSGNGER
FT                   ALEILAENRRLFDPPYEPLDYLEFLSCVALLLRSRVDAGSTAIVAGPEGRDWPVAELLA
FT                   RVRSEIDDLSGRFDRRNGTKVVSARVAATMDQTWLVAELPLIVSQRPRPQQFQKPEQAQ
FT                   QPGQAHEPDQAPLAAVPAQREPVAEPPDPDADTDFYDLLAEARRLFNVAHPSAMKMWER
FT                   VAIAADRRGIVLDLEAQAQLAEERAAEALDREDMDRAVTLLGEAVERYKAGGLEGRAVA
FT                   VQARRLLAEALQKKTYEPIPEQALAALYATARVLQARGLAEPEDILTVRRAQAFEARRT
FT                   TEVGADTDTGTGTDRDRESAFDHFAASVEALLADAIEFDVPARAAAAHTMRAEIAQRRG
FT                   RPEESVPELLAAIALYDRAGRPWANLHPNMLLAQAYLASDRDADAERAGLAALDIAERW
FT                   PEQRFPAGYTRQVLANATGGQGRYTDSAEHALHAVGWADRHGVPDLAASARHSLAFAYE
FT                   QLGRDADAAAILESALPEMIRHLDDPTVVNARWALARCLGRLEDYRGAAEQYLLAASIA
FT                   EHFPQQGGHAMLAASAGHALRAAGLADEARRAFDRAVILLRALPDPINLAKTLRALAWV
FT                   TFGESEETAHDIEREDVLDQVLLLFAEAAQVLETAEASGAYERDAQVIAYELAETDDQL
FT                   ARLHLNADLSDKAMPYAERAAAGFRALLPHSAMDYDFSEQMVAWLLDRYGSRDAAVERL
FT                   REAIAACTEAGVEAVRCVAFLEQLGD"
FT   gene            303169..303735
FT                   /locus_tag="Caci_0269"
FT   CDS_pept        303169..303735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0269"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69222"
FT                   /db_xref="GOA:C7QJ80"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ80"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69222.1"
FT                   /translation="MRGEKRDRDRDRDRDGNDRRGIEEAEFREYMVSRWGGLVRFAYGL
FT                   TGDRGHAEDLAQTALAKAYASWSRVRRADDPDAYVRRILINANHRRFRKRRVDEHAGPG
FT                   AAAREPVVTDGTAAFDQREALVAALMELPPKQRAVVVLRYWDGLTETQAATVLGCSVGT
FT                   VKSQASRALAKLRTSTQLQDGKVIS"
FT   gene            303732..304865
FT                   /locus_tag="Caci_0270"
FT   CDS_pept        303732..304865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1192 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69223"
FT                   /db_xref="GOA:C7QJ81"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69223.1"
FT                   /translation="MNDAYGGPDTDGEAQDGEGLFADLGHFETGAIPVDATVRQGRAIR
FT                   TRRRVIGSGMLAIAAALSIGVPVAIAGGGSSAAGAASGPDGVYAAVSSGPRITVNPTPL
FT                   VHGKGQFSGAVDGKKWSIGFDNKNCYDILWACGSQTLDPSTKYGTLGVNATVGNTDDYT
FT                   LFTQRDVASVTVVLQDGEVLHLETVPVNGTPVVLFALPPGLGVSKIVLFDGNGAQLGFS
FT                   APFTIKGSFSAQGRWYKPGETPPPAAGPVELARGTMGGDQIVMTAYTGPSGPCIVSVLG
FT                   STSNADCIHTGTITGSSIDRNGGVGEAASGLVAPNIARLQLDFADGTNVPVPVKSLGGY
FT                   RFFAYIVPSGKQSTGVTAFDAAGKALPVQTNTQYNAG"
FT   gene            305036..306319
FT                   /locus_tag="Caci_0271"
FT   CDS_pept        305036..306319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0271"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sgr:SGR_3404 putative adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69224"
FT                   /db_xref="GOA:C7QJ82"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ82"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACU69224.1"
FT                   /translation="MPALVLVGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVI
FT                   GDQKYALHLLPSGILSPGCVPVIGNGVVIDPAVLFAELDGLDQRGVDTSRLLISANAHL
FT                   ITPYHRTMDKVSERFLGKNKIGTTGRGIGPTYADKINRIGVRVQDLFDPSILLQKVEGA
FT                   LRDRNQMLVKVYNRRALSAEAVVEEYLGYAERLRPMVADTSLVVNKALDEGKVVLLEGG
FT                   QGTLLDVDHGTYPFVTSSNPTTGGACTGAGIGPTRVTRSIGILKAYATRVGAGPFPTEL
FT                   FDENGEALRRIGHEYGVTTGRDRRCGWFDAPVARYASRVNGLTDFFLTKLDVLTGFERI
FT                   PVCVAYDVDGVRHDEIPMTQTDFHHATPIYEEFPGWTEDISGCKSFEDLPENAQSYVKA
FT                   LEKMSGAPISAIGVGPERNATIQLRSFL"
FT   gene            306400..307788
FT                   /locus_tag="Caci_0272"
FT   CDS_pept        306400..307788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0272"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sgr:SGR_3382
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69225"
FT                   /db_xref="GOA:C7QJ83"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ83"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACU69225.1"
FT                   /translation="MYVLVMTEISSDDLKAAGAQVFADDRAHVFHSWSAQGAITPLPIA
FT                   GAEGSYFWDYEGNRYLDFSSQLVNTNIGHQHPKVVAAIQEQAGKLCTIAPSFANDVRGE
FT                   AARLIAELAPGDLNYVFFTNGGAEAVENAVRMARLHTGRTKVLSTYRSYHGSTSTAISL
FT                   TGDPRRWANDAVGQSTGGAVHFFGPHLYRSHFHATTEAEECERALLHLEQTIQYEGPAT
FT                   VAAIILETIVGTAGVLMPPAGYLAGVRALCDKYGIVYIADEVMAGFARSGAWFAVDHWG
FT                   VTPDLITFAKGSNSGYVPVGGVIISEKIRETFKDRVYPGGLTYSGHPLACASIVATINA
FT                   MKEEGVIENAARLGEEVFGPALREIAAKHASVGEVRGVGAFWALDLVRSKETREMLVPY
FT                   NASGADAAPMNELAAAMKARGVWPFVNFNRLHVVPPCTISEADARKGLAALDEALDVVD
FT                   VYAN"
FT   gene            307866..309344
FT                   /locus_tag="Caci_0273"
FT   CDS_pept        307866..309344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_5291 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69226"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69226.1"
FT                   /translation="MSHEVVFLPHILGQTWAQALAAARTAAREEDPRIVAARLEPWPDL
FT                   VLHAAQILGQIEEFRGRGQRELVHPVTRLRFTFFGEDGVIALPYWYDGPVARMAATMAF
FT                   RFAHAVESDTGLAAYDPQLRTPLSEMGLEKFVAGYLRGRERALGQAQARGPVPVGHALP
FT                   AGRSATRRELAAGPSAGRGAGFDGGGSGGPGAPGASGGAGARQGADSSRPPREVARSPR
FT                   EPKAAPRQNTDVRPGPDASRPTDPARLRPAGPVRGADAAGREAQARPRPNSDQRQPANP
FT                   VRRENKDARQAADSGPIAGSGGWLRRGKPARGEQVPRTGGVAEPRKAPRRGEPLDADPS
FT                   QRSRGPREPKAPRRGEPIDVDPSQRSRRPPEAKSPRRDESGEAQRPRRDPEPRAPRRGD
FT                   RPDAEQAQRSGKVVPPKKLSRRERAEAERAQRAQQARQAQQAKRGPVPPPETGTEWVPR
FT                   PGRPEPPEPRRAPPPERDRRQPPEPPQQQPRSRP"
FT   gene            309566..311551
FT                   /locus_tag="Caci_0274"
FT   CDS_pept        309566..311551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69227"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69227.1"
FT                   /translation="MAPAGAASANAAPTNGPIAYTLSNPTAGFLWHTVNPDGSHDAVVP
FT                   VGDAGAYDGRGPGSGTNDWVNPAGNAVYSPDGSRVLFEGPDGCDYVADADGTGAVALTT
FT                   VPAPELGCTRLTSNSDVPELSPPIPVASARGFVWSADGRSIYYDAAGSIGRISADGRTQ
FT                   TKLAVTVPNGYKLLSVAPNGAMAFTDSSATAHIWILDPGATALRDLTTGRDAHYSPTTG
FT                   RLLVLDQVFPPSGQSALTIFAVDTVNGSRTQVTDPTIEFVQSFTWSPDGTQVAYSGESP
FT                   NGADRSSTGVFTRSLGGGPRKAVVLNPGVIWVTGWHNGPIAPARAADRIGGADRIATAV
FT                   DASQWSYMNHGAGGRQASVAVISRSDQFADALGGSALAAQKGGPLLLTATSGLDPRVRE
FT                   ELKRVLAPGSVVYVLGGDAALSPAVEQQIKALGFTTRRLAGTDRFATSVLTAQQVSAHP
FT                   HTVMVATGVQYPDALTAGAAAAQDPNGGVVVLSDDKTLPASVKSYLSGVNPAATKVYGV
FT                   GGQGVAALKGSFPQWTGKVTPLSGADRYATAAAVASSPLFAANGPVGRIGLATGGGWAD
FT                   ALSGGALIATQHGPLLLTNPGSEYLPPSELSLVKALAPHLSGAVAFGGPQALGSVATNT
FT                   FVSALGGANHFFTYSNRQSPELGGAR"
FT   gene            311616..312146
FT                   /locus_tag="Caci_0275"
FT   CDS_pept        311616..312146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_5729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69228"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ86"
FT                   /inference="similar to AA sequence:KEGG:SAV_5729"
FT                   /protein_id="ACU69228.1"
FT                   /translation="MADYQPGLVEQARQGLGFSITEMREVNAWWQRYLRARSAPRGPER
FT                   FRAVLGPADSEQDLRTGDLVSRLYHWTLPVWPELRFEIVVGPGGQVWQEWLVRAPGAEP
FT                   PVAPADQTLEPWQYVVGDLERMYPQVRHLPEDAPTRWQSEYGYDDGHGGVVRRRARFCY
FT                   GLLQEVSEPLEVP"
FT   gene            complement(312132..312746)
FT                   /locus_tag="Caci_0276"
FT   CDS_pept        complement(312132..312746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0276"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: sco:SCO0748
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69229"
FT                   /db_xref="GOA:C7QJ87"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ87"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACU69229.1"
FT                   /translation="MALTTLDPKTALVLIDLQHGIVAPPAVPRSGAEVVACSKELADAF
FT                   RAQGLPVVLVNVAFSPDFGDAPKGRDDEEPEVDESEAEKDEEDMPADFAVIVDELGAQD
FT                   TDIRVTKHQWGAFHGTDLDTQLRRRGVTQIVLAGLVTSRGVDTTAREAYAHNYSVAFAI
FT                   DAMADRGIEVHENAIERIFPQIGQRATTKEILAMVQRLGNL"
FT   gene            complement(312760..314544)
FT                   /locus_tag="Caci_0277"
FT   CDS_pept        complement(312760..314544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0277"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbn:Mboo_0388 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69230"
FT                   /db_xref="GOA:C7QJ88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ88"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69230.1"
FT                   /translation="MTAPAPIRGTNHPRVENKEPSTAEGRPTGRIPLARSSDTPETRHD
FT                   TPTGSGSDTPGSGSSTPAGSRSDTPGPDTSTLAASRNDTPGSGNSTLPGSRGDTPSSDT
FT                   STLAASRGDTPDSDNSTLAASRSDTPDSANNTPATSRSATPAFNHRLTVPLLLGATLNP
FT                   INSSMIAIALVPIGAAFGASPAATAWLVSALYLATAIGQPVIGRLVDRFGARPLFLTGA
FT                   ALVGVAGVIGAVAPSLGVLIMARVLLGFGTSAQFPAAMHTVRGEAQRTGLKTPSGILTA
FT                   LSISAQSTMVIGPTLGGALIGVGGWRLVFAVNIPLALVCIALGARRLPKSAPVQNESRI
FT                   DLVGMGLFAAMLTSLLVFLMDLSVGNLYLLVIAAAMAGAFVRIELRSGEPFIDMRVFGG
FT                   NTPLLITYLRQTLTYVLTYSFIYGFTQWLEEGRGLSASAAGLVVLPTSLTAIVVAWFTG
FT                   RRNGIRSKLFAGTLSMIAASAALLALNRESAIWILIGVGLLAGATQGMNGLANQNALFR
FT                   QADAARMGTASGLLRTFQYLGAILSSAAVAIVFRTGASTVGLHELAVVMIACGALLLAV
FT                   VLADRSLSLRTENRGQSR"
FT   gene            complement(314541..315068)
FT                   /locus_tag="Caci_0278"
FT   CDS_pept        complement(314541..315068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0278"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bmj:BMULJ_04209 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69231"
FT                   /db_xref="GOA:C7QJ89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ89"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69231.1"
FT                   /translation="MDVQPGTIALGGEDAVDGADAAHAADAVRPAGAAHPADAAHAARE
FT                   LRVLVGRLRRRLREVDDVHELTASQLAVLGRLDRDGPASTSDLAKAEHVRPQSMAATIA
FT                   VLEERGMIARRQDPDDGRRQLIELTPTADETVRGSRRARDEWLERALRERFSPEELATV
FT                   VTALGMLERLSE"
FT   gene            315130..316383
FT                   /locus_tag="Caci_0279"
FT   CDS_pept        315130..316383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0279"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: sma:SAV_4149 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69232"
FT                   /db_xref="GOA:C7QJ90"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ90"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACU69232.1"
FT                   /translation="MKVLVIGTGGREHALARALSTDPAVTALYCAPGNPGIAEVAELRA
FT                   VDPLDPAAVRDLAVELGADLVVVGPEAPLVAGVADPVREAGIPVFGPSKAAALLEGSKA
FT                   FSKEVMAAAGIPTAKSYVCETDAEYAKALDEFAGFPYVVKDDALAAGKGVVVTEDRAAA
FT                   LEHARACGRVVIEEYLDGPEVSLFGITDGTAVVPMMPSQDFKRIGDGDTGLNTGGMGSY
FT                   CPLPWTPEGLTDEVVATVIQPLVDEMRRRGTPFVGLVYAGLALTAKGLRVVEFNARFGD
FT                   PETQSVLAMLESPLSELLYPAATGTLADAPAPRWRDGASVTVVLAATGYPGTPRSDDVI
FT                   TGIDAAEQLGTVVNQAGTKQNAEGAVVTSGGRVLAVTAVADSLGAARGKAYEGVAAITF
FT                   DGAQHRTDIAAEAAKTAA"
FT   gene            316528..317934
FT                   /locus_tag="Caci_0280"
FT   CDS_pept        316528..317934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69233"
FT                   /db_xref="GOA:C7QJ91"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ91"
FT                   /inference="similar to AA sequence:KEGG:SGR_3860"
FT                   /protein_id="ACU69233.1"
FT                   /translation="MTATTARVSAHRAARALLRVRAWVIAAYALSAAAACAALIGLARV
FT                   RGWDGVGAGAVGAAAVVCVLWALPAIRLHRGALAPPKTVQLAGESAPELELLVRQLALQ
FT                   LQVPTPAGIELSPDCDAWLDPRPGGPVLVIGAPFLWWLRVSELRGLLAPLVAGMAAAGD
FT                   ERIVRARAFANRSIGALHGRPGRTPHVFPSLRRRLAGYFEARAEVLERVVAWEAVAASR
FT                   MIEPAARAYAHEQINMAAAGWDRVLTRLAQPAWESGYCPVGLNVALVGALTSLGRRDRM
FT                   AGSLATRLSERPACDLLEEPGDVDARASRMAAELFEGRRIERTVTWERYVTAVTEPELV
FT                   RRAESVPDEHPVAKRIRTLISEAGVPGARQGGVSDGGTRSAVIPAPRVGEADGVPSGDV
FT                   MEPDIDDFAAYLAVRLVEARLAAWGLDWLDGPVLRDRAGDPVPIHDMAASVADVGDVSR
FT                   LSDWLARNLP"
FT   sig_peptide     316528..316641
FT                   /locus_tag="Caci_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.850 at
FT                   residue 38"
FT   gene            318027..318638
FT                   /locus_tag="Caci_0281"
FT   CDS_pept        318027..318638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0281"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_1454 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69234"
FT                   /db_xref="GOA:C7QJ92"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ92"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69234.1"
FT                   /translation="MRVTRESDQHGSEQYGTDETGSITGGSGDEEFGRLVVARSHALRR
FT                   TAYLMCGDWFEAEDLVQQALIKLHAAWGRVQRHDDLDAYLRKTLLRTCIDEKRRARWSK
FT                   EHPASDAMPDTVEAPGEPDPETLSDRDELVAALRELPSGQRAVLILRFWEDLSVEETAQ
FT                   LLKCTAGTVKSQTSRGLGALREAFGVDRAGALLARTEGKA"
FT   gene            318635..320263
FT                   /locus_tag="Caci_0282"
FT   CDS_pept        318635..320263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD3349 putative exosporium glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69235"
FT                   /db_xref="GOA:C7QJ93"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69235.1"
FT                   /translation="MTLMDEGAGDCETTMGNDINDISETNETGTTSATASTAATSLTAN
FT                   DPQDTDASSVELAWAHDLFDNTRGEAEPPWAVDLAVITKAGHRRRRFRRARTGGGVLAV
FT                   LAVTTAAAVTLGAGTTDYGSSAGPAGGWGARPLQDVFRYVEVNGGSFPGNNGDLYHHVP
FT                   KSAAVDAAVLVGHLDPAGTHLRGEPDRPDGPNPRIVGDGDAWVKGAANIEMSSDWSADG
FT                   TGPTSAQVSYGFFDDVNTLRTGIAGRPVSGPCGLNMELFLGVIDPTGTTPLPQWSGCRY
FT                   TTLADGSRVAAASASVGAGTETVAVRIFGSGNVIGMLGTNYQWTAAVDGARPSARAVVT
FT                   PSPWSEDGFRAALSDTALVPVLHPRGPVNADGKLLVPSDIGSDWAYDPTGGSEGTGEFV
FT                   LDNGCTPDHSIFGLASGRAVGYTGTLPDGTAGTGFEGEYRLPAGTGARTMQDAQKYGQG
FT                   GCGGFSQDTVAALPSGIGDSAFLLYQPQQSTVRVTVRLGDTILQTDIGRADHSPLTLTS
FT                   AADRTWLQQIAQRMVAHYTGVAGRG"
FT   gene            320386..321696
FT                   /locus_tag="Caci_0283"
FT   CDS_pept        320386..321696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0283"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: tfu:Tfu_3014 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69236"
FT                   /db_xref="GOA:C7QJ94"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ94"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACU69236.1"
FT                   /translation="MIERYTLPEMGRVWSEAHKYELWARVETLVVEAHAAAGTIPESAV
FT                   EPVRKAAPPTPEAVAAIEAVTQHDVIAFLSAWADNTEPREAATYVHFGMTSSDLLDTAL
FT                   ALQLTEATDLLLEKADKLVGVLRDHALAHRATLRVGRTHGIHGEPDVWGHRVADFAFGV
FT                   ARSRDRLRRAREAVGVVAISGAVGTYSNIDPAIETFVAAKLGMTAADVSTQVILRDGVS
FT                   EWVSALAIMATVLEAIALEVRHGQRTEVRELWEPFGKGQKGSSAMPHKKNPIISERLAG
FT                   LARIVRAQVVPVMEGIPLWHERDISHSSTERIALPDASIAVDYMLNLTIRLMSGLVVDP
FT                   DRMRHNLDSTGGLVYSSTVLLELVEMGLERDTQAYPLTQRASMKTWETGRPFRETLREE
FT                   AATAGLAIDEARLDEATRPERFVQRLDGMFEKLAKLS"
FT   gene            322799..322996
FT                   /locus_tag="Caci_0284"
FT   CDS_pept        322799..322996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_3261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69237"
FT                   /db_xref="GOA:C7QJ95"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ95"
FT                   /inference="similar to AA sequence:KEGG:SACE_3261"
FT                   /protein_id="ACU69237.1"
FT                   /translation="MVRINLRLPSNLKALVEDAAGAAGLSVNAWIVRAAAAGLANEDRR
FT                   AGRAQRSDRIVGDSYSGWAR"
FT   gene            323059..323949
FT                   /locus_tag="Caci_0285"
FT   CDS_pept        323059..323949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69238"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ96"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02601"
FT                   /protein_id="ACU69238.1"
FT                   /translation="MSHSTFNTPAAIAVALDLYVADVRIVAADRADTVVEVRPSDPNKA
FT                   ADVKAAENTRVEYDEGARVLSIVSRKPRNRFVNFSSKRPESIDLLIEVPTDSDVRGETE
FT                   IGDFESVGVLGAVQLKAGVGTVRLAQVGPVNIRDGVGEVLIEEVSGAADVNCGSGVIRL
FT                   GAVDGTAEVSNGNGKVRVGVVTGAANVKSANGEVSVDRALSDITASASNGEVRVGEVVR
FT                   GKATVTSKNGAVEVGVREGSAAWLELSTAVGRVYNELESADAPQAGEPVDKVEIHASTK
FT                   LGDVTIRRVPRLDED"
FT   gene            323955..324878
FT                   /locus_tag="Caci_0286"
FT   CDS_pept        323955..324878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0286"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: sco:SCO4405 ABC transport system ATP-binding
FT                   protein; TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69239"
FT                   /db_xref="GOA:C7QJ97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ97"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ACU69239.1"
FT                   /translation="MIAISARGLRKSFGEKTVLDGIDLSVPAGTILALLGPNGAGKTTA
FT                   VHLLTTYLRPDAGEIVIAGHDLAKSPQAVRRVIGVTGQFSAVDGYLTGRENLMLMADLH
FT                   LLPKAVGRQRADDLLERFELTEAAGKAAATCSGGMKRKLDLAMTLVGDPKVIFLDEPTT
FT                   GLDPRSRRVMWDIIRGLVAEGTTILLTTQYLDEADQLAHRVAVLDGGRIVAEGTPAELK
FT                   TRIPGGHIELTFADRAELDAAALVLAPTHRDDDALTLQLAGDGRVSALRSLLQRLDDAS
FT                   VEVEALAVHTPDLDDVFFALTGKKGA"
FT   gene            324880..325734
FT                   /locus_tag="Caci_0287"
FT   CDS_pept        324880..325734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0287"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rha:RHA1_ro02603
FT                   multidrug ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69240"
FT                   /db_xref="GOA:C7QJ98"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ98"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69240.1"
FT                   /translation="MSAMTVADSGLADTGADTRSHAWVHARIMLRRNLRHLQRYPSLTL
FT                   MVTLMPLVFLLLFVYVFGGTLGSGLGSLTPAGVHGGRAAYAAYVAPAIIVMAVAAAAQG
FT                   TAIAVAQDMTEGIIARFRTMAVARSSVLTGHVVGAAIQTMAGVAVVVGAALAVGFRPHA
FT                   NAAEWFAALGVVLLLTFAVTWLCVGLGLSAKSVETASNSPMFLLLLPFLSSGFVPTDSL
FT                   PTGMRWFSEYEPFTPVTETLRGLLTGTRIGGDLVVTLAWCLGVAVLSYAWSRRLYEREP
FT                   KQS"
FT   gene            325731..326642
FT                   /locus_tag="Caci_0288"
FT   CDS_pept        325731..326642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0288"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: fra:Francci3_4373
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole- succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69241"
FT                   /db_xref="GOA:C7QJ99"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ99"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACU69241.1"
FT                   /translation="MNRRYSERVITGLNHLASGKIRDLYAVGDDLLLVASDKISAFDYV
FT                   LESEIPDKGRILTQLSMWWFRQLADLVPNHVISADVEQFPAELQPYKEELRGRSMLCRK
FT                   LSMVQVECVARGYLTGSGLAEYERTRTANGVPLPPGLVDGSRLDRPIFTPAMKAEVGQH
FT                   DENVSFEDMAERIGDPELAAQLKDLTLAVYSRAREIAEERGIILADTKFEFGRLRGGTL
FT                   VLADEVLTPDSSRFWPADEWKPGRTQSSFDKQYVRDWLSSPASGWDRKSDTPPPVLPEE
FT                   VVQATRARYVEAYERLTGAKFD"
FT   gene            326749..327015
FT                   /locus_tag="Caci_0289"
FT   CDS_pept        326749..327015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0289"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: sco:SCO4077 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69242"
FT                   /db_xref="GOA:C7QJA0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA0"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ACU69242.1"
FT                   /translation="MARVLVDVMLKPEILDPQGQAVQRALPRMGFDSVTNVRQGKRFEL
FT                   ELADADPATLRATAEQMAEKLLANTVIEDFKVTVLPADSSENA"
FT   gene            327015..327701
FT                   /locus_tag="Caci_0290"
FT   CDS_pept        327015..327701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0290"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sma:SAV_4139 phosphoribosylformylglycinamidine
FT                   synthase subunit I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69243"
FT                   /db_xref="GOA:C7QJA1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA1"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ACU69243.1"
FT                   /translation="MPARIGVVTFPGTLDDRQALRAAAAVGAEPVALWHKDRDLHQVDA
FT                   VVLPGGFSYGDYLRAGAIARFSPVMDTIIDAARDGLPVLGICNGFQVLCETHLLEGAMI
FT                   RNGDLHFINRDVTLRIENNRTAWTSDYEDGAEAVIPIKNVDGRFVADEPTLDALEAEGR
FT                   VLARYVANPNGAARDIAGITNAAGNVVGLMPHPEYAIDDLTGPHPGPGTDGLPFFTSIL
FT                   KSLVSA"
FT   gene            327698..330061
FT                   /locus_tag="Caci_0291"
FT   CDS_pept        327698..330061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0291"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sgr:SGR_3871 putative phosphoribosyl
FT                   formylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69244"
FT                   /db_xref="GOA:C7QJA2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA2"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACU69244.1"
FT                   /translation="MSNGNSSENVFDTTDVFVDTAVSFDTVAKAAQTPDVKQPFRELGM
FT                   TEDEYLRVREILGRRPSSSELAMYSVMWSEHCSYKSSRVHLKQFGEKAPKTAALLVGPG
FT                   ENAGVVDVGEGLAVTFKVESHNHPSYVEPYQGAATGVGGIVRDILTMGARPIAVMDPLR
FT                   FGPADAPDTARVLPGVVAGVGGYGNCLGVPNIGGEIVFDPCYLGNPLVNALCVGVMRAD
FT                   EIKLAKAPGPGNQVILFGARTGGDGIGGASVLASATFDEDGPAKRPSVQVGDPFMEKVL
FT                   IECCLEIFAADLVVGIQDLGAAGLTCSTTELAAAGTGGMDVRLDLAPLRDSTLTPEEVL
FT                   MSESQERMMAVVEPAKVEAFLAVCDKWDVTATALGEVTDTGRLRMWWHGEIIVDVPPRT
FT                   LAHEGPVYNRPFARPEWQDALQADAPTAERLKRPGNAEELRETLLRLVGSPNLADKTWA
FT                   VEQYDHRVQGNTVLGHGEDSGMVRLDAALPGTSLGVALSTDGNGRFAKLDPYQGAQLAL
FT                   AEAYRNVAATGAKPLAVTDCLNFGSPEDPDVMWQFAEACRGLADACLELGTPVTGGNVS
FT                   FYNQTGELNIHPTPVVGVLGVIDDVDRRTRSAFEREGEILLLLGDTRDEFGGSEWAHEV
FT                   HGHLGGLPPRLDLQREKVLGEVLIAGSRDGMLSAAHDLSDGGLAQAVVEGCLRGGHGAR
FT                   LVLPETDADGAALDPFVALFAESAGRALVAVPRSEELRFTDMCVARGLPVARVGVVDGD
FT                   VLEVQGQFTVPMAELRTAHEAPFRKLFGHSVVDA"
FT   gene            complement(330071..330865)
FT                   /locus_tag="Caci_0292"
FT   CDS_pept        complement(330071..330865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC12006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69245"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69245.1"
FT                   /translation="MAWFVHLTPEKNSARVRRSGLSPISRSRSDDPRPGLYCTPLLADY
FT                   TLTYQWSREIKRWKSPRLAAVHFRIPDDTAVTVGYYGDAPKPVTAAQAVARFLSLSPEE
FT                   MRGYEVFLPRGVTAKEIRRIKSLERPIGWRYRPNAHGHRPCACPACLDRGEYRISRIRD
FT                   KSSYYDTSHLPPRQEVLEKLATTRDSAEIVTLLDQLRSRGQGDIFRVAHLADHPDPDVR
FT                   EALAYALCGFNKKAAAELLEKLRSDPLKDVREAAGADEDDDL"
FT   gene            complement(330896..331846)
FT                   /locus_tag="Caci_0293"
FT   CDS_pept        complement(330896..331846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2835 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69246"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69246.1"
FT                   /translation="MNTETTATGASFYALGPEFEWMASAWDGFAHELAEVSKTLRQIVE
FT                   AATADPQLAAESSGLAALESATDRLVRELVDDAARIRRTQATYEHADATVHASVPPLHA
FT                   HEQPPPGHAPEVSTIPVFGAGVVTGHQNTPGSAPGSDTAGSYAGTLDGPASAPASVPVP
FT                   DGSGLWHPAVAQDLSETALGTLSRMRRQMIAHADRWVSQHVPYNQGIWHEGYRTDCSGY
FT                   VSMCWGLRDSMVTSTMPQISHRIAKEDLRPGDVLLNTDVATGHVILFDRWADYAHNSYV
FT                   GYELCPQGTLHHVIPYPYYSGFGVYEPYRYNNAGD"
FT   gene            complement(331843..332277)
FT                   /locus_tag="Caci_0294"
FT   CDS_pept        complement(331843..332277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0294"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: met:M446_6942 chromosome segregation protein
FT                   SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69247"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA5"
FT                   /inference="similar to AA sequence:KEGG:M446_6942"
FT                   /protein_id="ACU69247.1"
FT                   /translation="MITAQTPASAPTDDAGRTPERAAMAGAIDAQARRMDQLSAAIVRA
FT                   TSQVTWSGRAAERFRARAAERSRECLQLAVALRASAERVHAAETARPAATHAGQAPADE
FT                   KSGHAAVVGAISGMAGTKIPGVAGGGVGGARPSSESGPAR"
FT   gene            332467..333234
FT                   /locus_tag="Caci_0295"
FT   CDS_pept        332467..333234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69248"
FT                   /db_xref="GOA:C7QJA6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA6"
FT                   /inference="similar to AA sequence:KEGG:SAV_4137"
FT                   /protein_id="ACU69248.1"
FT                   /translation="MPKTRRPASAKVRQAVVNQWQAHVGYAAALTAEQLAAPSKLAGWD
FT                   VKTLVGHVAFTVRTVVTRAAEPVAGDQAEVYDWLTATPTASAAVDAGTRELVEDGVVLA
FT                   DEVTEAEKLMERYGDEDLIAMRFGPMRFDDFLVSRIVEATVHADDLERSTGIEFPHDRE
FT                   ALAITVRQLADAMAAKVPGNSVELRVPPFAAVQCVPGPRHTRGTPPNVVEMTPRTWIRL
FT                   AAGRMTWDEAMDQALVSASGQRADLKEFLPLMG"
FT   gene            333393..334910
FT                   /locus_tag="Caci_0296"
FT   CDS_pept        333393..334910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0296"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: nca:Noca_4316
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69249"
FT                   /db_xref="GOA:C7QJA7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA7"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACU69249.1"
FT                   /translation="MIHPSGFRPGDGRLTHELDPQDTGPQDACGVFGVWAPGEEVAKLA
FT                   YFGLYALQHRGQESAGIAVSNGKQILVYKDMGLVSQVFDEATLQSLQGYLAIGHARYST
FT                   TGSSVWENAQPTFRATAHGAVALGHNGNLTNTGELARLAAERRTTSGAGDKHAMTSDTG
FT                   LMTELLASYSDRSLEDAAAEVLPQLRGAFSLVFMDETTLYAARDPQGVRPLMLGRLDRG
FT                   WVVASEQAALDTVGASFIREIEPGELIAVDENGLRSRHFAEPQPKGCVFEYVYLARPDA
FT                   TISGRNVHAARVEMGRTLAREAPVEADLVIATPESGTPAAIGFAEESGIPFGQGFVKNA
FT                   YVGRTFIQPSQTLRQLGVRLKLNALREVIEGKRLVVVDDSIVRGNTQRAVSKMLREAGA
FT                   TEVHLRISSPPVKWPCFYGIDFATRAELIANGLNTDEIAKSIGADSLAYITLDGMTAAT
FT                   HQPADRLCRACFDGVYPIALPEDELLGKHLLEISVDPLAHTDALSRP"
FT   gene            334959..336044
FT                   /locus_tag="Caci_0297"
FT   CDS_pept        334959..336044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0297"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: sgr:SGR_3878 putative
FT                   phosphoribosylaminoimidazole synthetase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo- ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69250"
FT                   /db_xref="GOA:C7QJA8"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA8"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ACU69250.1"
FT                   /translation="MSGATYAAAGVDIEAGDRAVELMKEWVAKTRRPEVLGGIGGFAGL
FT                   FDASALKAYDRPLLATSTDGVGTKVAIAQRMDRHDTIGRDLVGMVVDDLVVCGAEPLFM
FT                   TDYIATGKVVPEVIAGIVKGIAEGCVLAGCALVGGETAEHPGLLKPGEYDVAGAGTGVV
FT                   EADKVLGAERVREGDVLVAMASSGAHSNGYSLLRHVFFDVAGWELDRDVPEFGRTLGEE
FT                   LLEPTRIYSLDCLALIEAAEVHAISHITGGGVAANIARIIPAGLEARLDRGTWTPPAVF
FT                   GTVGALGGVATLELEKTLNMGVGMVAVLPAASVDPALALLNARGLPSWVCGEVVASEGA
FT                   VTVGGAKGGDGAASLHGDYAG"
FT   gene            complement(336315..336587)
FT                   /locus_tag="Caci_0298"
FT   CDS_pept        complement(336315..336587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69251"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA9"
FT                   /inference="similar to AA sequence:KEGG:SCO4088"
FT                   /protein_id="ACU69251.1"
FT                   /translation="MGRGRAKAKQTRVARDLKYRDVRTDLTQLQRELQQDGVHTSNGHS
FT                   AEAPSQQDDDADDDELYAKYADDDGDDDYDSADDGGAHRSHHRRS"
FT   gene            complement(336830..337918)
FT                   /locus_tag="Caci_0299"
FT   CDS_pept        complement(336830..337918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0299"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG: saq:Sare_0168
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69252"
FT                   /db_xref="GOA:C7QJB0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB0"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ACU69252.1"
FT                   /translation="MSDKPDNDVSEVFASDHEQVVYCRDEETGLKAIIAVHNTLLGPGL
FT                   GGTRFFPYATEQDALKDVLRLSRGMSYKNALAGLDLGGGKAVIIGDPSEIKTEALLRAY
FT                   GRFVQSLNGRYYTACDVGTYVQDMDVVAKESRFVTGRSMESGGAGDSSVLTAYGVFQGM
FT                   RASAEYLWGSPSLAGKRVGISGVGKVGRYLIGHLIEDGASIVATDPYEGAIQWLRDNYA
FT                   QVELVSTTEDLIAADIDVYAPCALGGALDDATVAALTAKIVCGAANNQLAHTGVEKQLE
FT                   ARGILYAPDYLVNSGGVIQVADEIHGFDFERAKRRASGIFDTTMRIYSLASEEGVPPSV
FT                   AADRLAERRMRDVGRLRGVYLP"
FT   gene            338165..339100
FT                   /locus_tag="Caci_0300"
FT   CDS_pept        338165..339100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69253"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB1"
FT                   /inference="similar to AA sequence:KEGG:SCO4090"
FT                   /protein_id="ACU69253.1"
FT                   /translation="MRASPGGAIPAPYMAYLRVYEPLAAFPAGERAEWEAWLLRNPEPK
FT                   SLAEEQSASLRGLVAVPPIAVPENESRVAYVLDNGETTLLCPWQSRLRSWLALTELRAV
FT                   HGDGGVRLFWPRGVLERADSEYERWWAEDPEALPHILTASWQVPIRWLVLFGLEDAVTD
FT                   ADGPGDRSDRGDRGEAGEGDEKVAAVTLQFRTAMSQARKRCARALRVLKRSLGAGPLVE
FT                   AVETLGMWLEEFHPHSVVELDYGGLMGLLVAQGALGAEERVDGIVLDCSVRYVADGLAA
FT                   LAQGDDTGVTAAYLRYRAKWDAVRVLARAN"
FT   gene            339500..339703
FT                   /locus_tag="Caci_0301"
FT   CDS_pept        339500..339703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0301"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; KEGG: sgr:SGR_3882
FT                   MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69254"
FT                   /db_xref="GOA:C7QJB2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB2"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU69254.1"
FT                   /translation="MTARTPDAEPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGG
FT                   HRRYREQEVRALLNGIPPQREG"
FT   gene            complement(340009..341532)
FT                   /locus_tag="Caci_0302"
FT   CDS_pept        complement(340009..341532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0302"
FT                   /product="Lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: fre:Franean1_6988 lysozyme; PFAM:
FT                   cellulose-binding family II; SMART: cellulose-binding
FT                   family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69255"
FT                   /db_xref="GOA:C7QJB3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB3"
FT                   /inference="protein motif:PRIAM:3.2.1.17"
FT                   /protein_id="ACU69255.1"
FT                   /translation="MGLSKRARVIGISLATAAVVGAGAVAAFSAGAAGSSSGSVTAAFA
FT                   KTSDWGTGFQGQYTIANSTGQTVHGWTVSFDLPSGERISSLWNGTMTAAGQHITVANPT
FT                   WAGDIATGTSATFGFVVDATSGSTAPQNCLVNGASCDGGTPGGGQSSAPGGAPSTAPGS
FT                   SSAPSSAPSSAPSSVPSSAPSSAPSSAPSSVPPPPASSGSYSFAPYVDTSQRQDLGAIA
FT                   TAAGAKDVTAAFMLAGGSGCTPAWNGSADAGFEGALKAGVADLRAKGGDVIASFGGANG
FT                   TELAGACKDVPSLKAAYKSVIDAYNLTHVDFDIEGAATTDQASITRRAQALAQLQADYA
FT                   AAGKTLDVSLTLPVLPSGLTQDGVNIVTAAATNNLKISVVNVMAMDFGDWAAPSPSGKM
FT                   GQYADQSAQSVHDQLKSVYPGATDAQLWSMVGITPMIGVNDTSDEVFQVSDASVVEQFA
FT                   AQHHIGRLAMWSLTRDQACAQPSSWASPTCSSIQQNTYDFAHTFEAFTG"
FT   sig_peptide     complement(341395..341532)
FT                   /locus_tag="Caci_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.363 at
FT                   residue 46"
FT   gene            complement(341687..342703)
FT                   /locus_tag="Caci_0303"
FT   CDS_pept        complement(341687..342703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0303"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: fre:Franean1_6579 cytochrome d ubiquinol oxidase
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69256"
FT                   /db_xref="GOA:C7QJB4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB4"
FT                   /inference="protein motif:PFAM:PF02322"
FT                   /protein_id="ACU69256.1"
FT                   /translation="MTAVDLLLGVIVCALAAYALLAGADFGAGVWDLLARGRHADRERR
FT                   LIAHALGPVWEANHVWLIFVIVATFSGFPTAFGIIARGLELPLALALAGIVLRGAAYVY
FT                   RAYGEGAAGPDSLWSRVFAVASSITPFMLGVSGAALATGKITATSGPLTPFDSPFTLVA
FT                   GVFAVVVTAFLAAVYLCHDAGTDPETEDLVPAFRRRALGAAAVAGVVSMALLPLLYQDA
FT                   PIVAHRFTERSIPFVAVAVVCGFGSLAVIWKRHYVLARATAATAVIGVLLGWAAAQYPD
FT                   LAVGAATARGSAAGPANLHALLIAMGFGMVVILPAFYLLLKVFSGPEGAAGGSGLAN"
FT   sig_peptide     complement(342629..342703)
FT                   /locus_tag="Caci_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.409 at
FT                   residue 25"
FT   gene            complement(342700..344181)
FT                   /locus_tag="Caci_0304"
FT   CDS_pept        complement(342700..344181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0304"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: fre:Franean1_6580 cytochrome bd ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69257"
FT                   /db_xref="GOA:C7QJB5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB5"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU69257.1"
FT                   /translation="MLGSSLSDARIETGFSLAFHIVFAVFGVGLPWLLLVTEGRWLKTR
FT                   DPVWLALTRKWSRVMAVLFAIGAVSGTVLSFEFGLLWPAFMARYGGVLGLPFTLEAFAF
FT                   FAEAIFVGLYLYGWKRLSPRAHWLTLWPIAISGTLSTLFIVTANSWMNVPTGVKEVGGK
FT                   VVSAEPLAPLTGPGALPESLHMLLAAIMCTGGVVAAVYAVGMLRGRRDSYHRRGFRVGL
FT                   VTVLAAAPLQLVVGDLAARVVEKYQPAKLAAMEALTHTQSHAPLTLGGIYDPSTGKTRF
FT                   GIEIPDGLSLLTGFRTDKTIRGLDILPAKQQPATPVVHLAFDTMVGGGMAILGLAGLLA
FT                   VVALWRRRKGVRPLIPLTRPWLLAGALTGPAAMAAMLAGWEVTEAGRQPWIVYGRMTVR
FT                   QAATTSGGIGWSLIATIAVYLGLATALLLILRRLATGAPPELAEGAEPSGPQDPESPTH
FT                   EPSGSEGDAEDSPESTETNAESTPESSPELEGAAR"
FT   gene            344239..344628
FT                   /locus_tag="Caci_0305"
FT   CDS_pept        344239..344628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0305"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="PFAM: Penicillinase repressor; KEGG:
FT                   fre:Franean1_6581 CopY family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69258"
FT                   /db_xref="GOA:C7QJB6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB6"
FT                   /inference="protein motif:PFAM:PF03965"
FT                   /protein_id="ACU69258.1"
FT                   /translation="MANERAGGPPRLGELERAVMDVLWNAPDGSTAQEIVERLAARDGT
FT                   AELAATTVLTVLDRLRRKDFVERERVGRAHRYRAARTRDDVIAASMLAVLETTDDRRSA
FT                   LVRFAGSVSAEEAALLREALAGLEE"
FT   gene            345021..345965
FT                   /locus_tag="Caci_0306"
FT   CDS_pept        345021..345965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0306"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: aau:AAur_1766 M48
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69259"
FT                   /db_xref="GOA:C7QJB7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB7"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69259.1"
FT                   /translation="MFADAWPLAVLAILLAWPVPVFLARAAWPRRHARAAIALWQAVGV
FT                   AGGLALIGAPLAVGVAPLDGHLRTGLVELWRDAFHLRVPAALGLAQEIALALAAVLTVR
FT                   LVGVTLLSAWRIERDLRRQRDAVDLAAEHADRDLRVLEHAAPAAYCLPGTRPRIVITEG
FT                   TIAALAPDELEAVLAHERAHARWRHELVVQPFVAWESALPLPPARRATASVTALVEMLA
FT                   DDHAARSVGRPALARALVAIGGTAGPVPNQRTDGAPGSGSDPNPVRATPTLDRVQRLVR
FT                   RPKATSLAERLIGPAAWLAAVLLVAGPTWYVLR"
FT   sig_peptide     345021..345101
FT                   /locus_tag="Caci_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.885 at
FT                   residue 27"
FT   gene            complement(346002..347297)
FT                   /locus_tag="Caci_0307"
FT   CDS_pept        complement(346002..347297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0307"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   sgr:SGR_3783 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69260"
FT                   /db_xref="GOA:C7QJB8"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB8"
FT                   /inference="protein motif:PRIAM:3.4.11.21"
FT                   /protein_id="ACU69260.1"
FT                   /translation="MPIFDRAHTDDLLAFLAASPTPYHAVTNAAARLEAAGFRQLRQSA
FT                   GWESADGGGFYAIRGAAIIAWYLPEGAAAPTGFRVVGAHTDSPNLRVKPLPDTGSAGFR
FT                   QVAVELYGGPLLNSWLDRDLGLAGRLVLRGGEAALVHVDRALMRVPQLAVHLDRGVNDS
FT                   GLLLDKQQHLTPAWGLGPVEDGALIEFAAKEAGVSASDVMGFDLMLHDVTPPTYLGRDQ
FT                   EMIAAPRMDNLVSVHAGVQALIAAASGAGGPLTAIPVLAAFDHEETGSESDTGAGGPLL
FT                   GTILSRVTQAQLGGSADDYARALAATVVMSSDMSHAVHPNYPERHEPGHRPRLNGGPAL
FT                   KTNVNQRYATDGLGRAIWTDVCERAGIPTQYFVGKNSLPCGTTIGPITAAKLGVTTFDV
FT                   GITSLSMHSAREMGGADDPFLLASAAASFFAG"
FT   gene            complement(347404..349626)
FT                   /locus_tag="Caci_0308"
FT   CDS_pept        complement(347404..349626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0308"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: nca:Noca_3656 MmpL
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69261"
FT                   /db_xref="GOA:C7QJB9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB9"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACU69261.1"
FT                   /translation="MFGRLGRFVVHNPWKIIVGWIIAAVALVAFGPQLSSVTNDNQSSF
FT                   LPSKYESVQAKNALDAEFPSTVGQVATIVIRPVGDGALSAAEQQKVSDLATTLTGDHIT
FT                   GVAGVQAGQVSPKQTAQLMFAKLTADQGDQKASSDAVKALRADLAAKLNGSGMKAEVTG
FT                   DAAMGLDTSDSSNKATGIVMMATLLLIIVLMGFIFRGVIAVLLPILSVFLVMMVSQPVI
FT                   ALMAKGFGLHVQSFLEIMLVVVLFGIGTDYIVFLLFRLRERLRAGDTIQQAVATTVERV
FT                   GEAIASAAAAVIIAFCALGLATFKAFTSLGPALAIAVAVMLLAGLTLVPALMVTLGTKI
FT                   FWPGKKWRRVPTAGPARKVGNLVGKRPAAVAAVSFVIMAGLAVGAVGFKADYDQQSQMP
FT                   GGVESTIAIKDMQKAGFAQGATAATDVIVTSTDGKPLDQAKLQTYADGLGAASPELSGL
FT                   MPFPVKPGSPAGTKGATVEYNQAGTAAHIQVLTKDSPFAAAAMSAVDGPLKSAAHSTVP
FT                   AGAKALVGGGTAALSDIQAANNSDLALILPVAGLLIFLVLALQLRALVAPLYLMVAVGL
FT                   GYTGTLGASVLMFQTVQNKPGMMFMLPVMVYLFVVAIGTDYNILMISRLREEAREGHDP
FT                   RRAAALAVEHAGPSVASAGLILAGTFASLMLGGLAMMQQIGFAVSFGISIAAFVMSMFL
FT                   VPAVTALMGAKAWWPGHKGVASATAGVGRPVVSDLDDEVVGAGAHR"
FT   gene            349752..350393
FT                   /locus_tag="Caci_0309"
FT   CDS_pept        349752..350393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0309"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_6185
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69262"
FT                   /db_xref="GOA:C7QJC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69262.1"
FT                   /translation="MRRNSQSEHDPGGTKERIQHVALELFVLHGYEKTSLREISDRLGI
FT                   TKAALYYHYASKQELLKSVTQPLIDEFELLVAGDPDPETLLRSYVDLLHRHQAVFQLVA
FT                   NDHASLAAAELVERSVKLRRDVVRRLAGPEPQPADYIRAAAAFGAISQGFMLARRVEPA
FT                   ADPALPDVEATAEKAAETAAGLPAPADYPEGAELTRILMDTALAVLRSGS"
FT   gene            350452..351315
FT                   /locus_tag="Caci_0310"
FT   CDS_pept        350452..351315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0310"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: tfu:Tfu_2825 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69263"
FT                   /db_xref="GOA:C7QJC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69263.1"
FT                   /translation="MDLALLRTFLAVHRAGSLTRAAADLGVSQPAVTAQVRTLEQRVGR
FT                   ELFVRLPRGVAPTAAADELARAIAPHLDALAAVAHETLVPDSGPLAAVRLGCPASLTTT
FT                   LLLPALAPLVDEGLRVVVAGGRSDDLVAQLATGRLDLTLAVTRPRLPGVTVIPLADEEY
FT                   ALVGAPRWKPFDRTGRTPLLDLSENLPYISLYWSSVYDTRPTSDAALVIPDLRGVLDAA
FT                   VAGCGAAVLPLPLCAPALDDWTLVLLDEPEIPPIRTLFVAVRGQRARSAAVARVRDRLV
FT                   AVASRW"
FT   gene            351679..352761
FT                   /locus_tag="Caci_0311"
FT   CDS_pept        351679..352761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0311"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   sgr:SGR_1348 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69264"
FT                   /db_xref="GOA:C7QJC2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC2"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACU69264.1"
FT                   /translation="MTWELPAQGQAQEATQAIPAQNGSLNPDSLNPEVYASLFRPEGAP
FT                   ARANPNATQVMPSVPDDYGRPGYDQDGYPQAGYDQRAANQPAYDQPIDYQAAGGGAYAE
FT                   PYETGYADDYPDEPSARPSNRGTKIGIGVAAGAVLVIVISLITLGGGSSKPSAGPANTP
FT                   GTVTTPTVPPSTSAPQVAASDPATSTPSSPASSTSHAPGTLQLGDSGAEVKWLQTRLHQ
FT                   LGVYNGPINSKFDAATQAAVAAFQAKTHASDPAGVVGRSTKTALIAAGSKPTLMGQVPN
FT                   LPGGPLGGDKHHRGNNPADVKRLQQALAVALNTNLKATGQFDLDTFGAVVQYQGAMHMT
FT                   PDGLVNGTVWAALQQGRISG"
FT   gene            complement(352923..353228)
FT                   /locus_tag="Caci_0312"
FT   CDS_pept        complement(352923..353228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2449 TfoX C-domain superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69265"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69265.1"
FT                   /translation="MSSTETVTLIQNAVNIGPVLTQRLRDVGVTTLDEVRERGAIEVWQ
FT                   LIAHTAEGNECAHMLLALEGALRGQRWTSIPRSERDALLVEVGLKDASELRAPKKR"
FT   gene            complement(353306..353719)
FT                   /locus_tag="Caci_0313"
FT   CDS_pept        complement(353306..353719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0313"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: tfu:Tfu_2370
FT                   Mov34/MPN/PAD-1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69266"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB0"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ACU69266.1"
FT                   /translation="MLTVSQEIYDAIVAHARRDHPDEACGIVAGPEGSDRPERFVPMAN
FT                   AERSPTFYRLDPAEQFKVWREMDDRDEEPVIVYHSHTSTEARPSRTDISYASEPNAHYV
FT                   LVSTRDTDKLGDFQFRSFRIVDGEVTEEPVTVL"
FT   gene            353797..355236
FT                   /locus_tag="Caci_0314"
FT   CDS_pept        353797..355236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0314"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_1900 putative glucose transporter;
FT                   TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69267"
FT                   /db_xref="GOA:C7PVB1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB1"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ACU69267.1"
FT                   /translation="MTTRTGRESGPNPPGDSAAARVAPRIVFIAAAAALGGFLFGYDSA
FT                   VINGAVTGIQHDFNVGSGTTGFVVAAALPGAAAGAIAGGWMADRIGRIRAMQIAAVLFI
FT                   ISGIGSMFAFQPWDLTIWRILGGFAIGIASVIGPAYIAEVSPPAFRGRLTSFQQLAIVL
FT                   GIAISALVNYLINQWAGGTNTDHLGGLAAWRWMLGAEVIPAILYGVLSTMIPESPRFLV
FT                   ANGEDDRAREVLAEVEGTHANVADRIAEIRDQLAGEVKPKLADLLTPSRKNLLAVVWIG
FT                   IGLSVLQQFVGINVIFYYSSLLWQSVGIDTSNSLLISMISAAVNIAGTVVAMALVDRIG
FT                   RRPLLLIGSVGMAVTLGLCAWMFSYGTHANGKTTLPKAQGVTALLGANAYVFFFAMSWG
FT                   VVVWVLLGEMFPNRIRAVALSVAASAQWLANWLVTVSFPSLSRWSLAGAYSLYAIAAAV
FT                   SIPFVYYLVRETKGKTLESMG"
FT   gene            355276..355788
FT                   /locus_tag="Caci_0315"
FT   CDS_pept        355276..355788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0315"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: stp:Strop_3309 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69268"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB2"
FT                   /inference="similar to AA sequence:KEGG:Strop_3309"
FT                   /protein_id="ACU69268.1"
FT                   /translation="MGLDFRTDPETLREIVDDPAALAARIHTLAALDMDEHPEARSEYA
FT                   TLLRIAGRLDDAALEAELTLAAADLAGDLRRMVRATLLVGHVRQYRGEWDQADTMFHRA
FT                   EKLALYLKDDRLVAAAAHHSGRSFYDQGKHVEAALRFRLALEIDTRIGSPKVSAVWEAF
FT                   EAAMAKL"
FT   gene            complement(355850..356605)
FT                   /locus_tag="Caci_0316"
FT   CDS_pept        complement(355850..356605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0316"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sgr:SGR_5042 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69269"
FT                   /db_xref="GOA:C7PVB3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69269.1"
FT                   /translation="MLDYDLEAARYDQTRGGVERARAAADAVLELVPKDCAVLLDVACG
FT                   TGIVSELLRTPDRTVIGVDMAAGMLALARPRLGGTGRAVRGDATRLPLASGAVDAVTFM
FT                   WLLHLVDEAVVAAAVAEAARVLRPGGVMVTTVDKDSAQFGMNTDVGAIMRAARQELAPP
FT                   ASDQAERVRELAAAVGLEAAGTARYVGHGQGQTPKAWARRLREQAGWARRADPARIAEI
FT                   CRALEALPEQDVRRPDPEYVVASFRLDGH"
FT   gene            356752..357615
FT                   /locus_tag="Caci_0317"
FT   CDS_pept        356752..357615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0317"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sma:SAV_7083 Rif11-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69270"
FT                   /db_xref="GOA:C7PVB4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB4"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69270.1"
FT                   /translation="MHPRTFRFAVVAALAPTAQAWQELARRAEELGYDTLLAPDTMTTL
FT                   EPFTALAAAATATERLRVGTFVLPAPFYPPSEIAWRALALDLLSGGRFDLGLGAGRPGA
FT                   EDEVVHRERRFGTPAERVKQLSDALHIVKEELAAAAAGRSPLKPVQKPHPPILVAAAGP
FT                   KMFQLAAAEADILTLGLDPRTTEDGLAAKIAELRAIAGSRVDDLELSYNLAGVGTELPG
FT                   FLSQQMGVDPAELIRTGAPAVLTGTPQEMADKLRRRRDTLGISYIAVNGMFLEQLAPVV
FT                   EMLAGK"
FT   sig_peptide     356752..356814
FT                   /locus_tag="Caci_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.968 at
FT                   residue 21"
FT   gene            complement(357646..358143)
FT                   /locus_tag="Caci_0318"
FT   CDS_pept        complement(357646..358143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0318"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_4116 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69271"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU69271.1"
FT                   /translation="MQAIRYTGRMLGKTYDSQVCSIARALEVVGERWSLLIVRDALFGG
FT                   ATRYSDFQRSLGIATNVLKTRLDGLVETGVMRRHQYSQQREQYEYLLTDKGRALAHSLV
FT                   ALSEWGDQWATDGEPPILYVHSVCGTGVTQKTVCAHCGVVEDPAEIRAEIGPGMPADRI
FT                   PA"
FT   gene            358175..358705
FT                   /locus_tag="Caci_0319"
FT   CDS_pept        358175..358705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69272"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69272.1"
FT                   /translation="MMQATAEQQQRPYTTGFTVARTPRAAYDAVLDVRGWWSAAVEGVT
FT                   DQVGGVFDYRFQDVHRCKVRVAELVPEQKVVWHVEENYFNFIADQTEWTGTDIVFEISP
FT                   APDGGAEIRFTHIGLLPQDECYDVCSNAWGGYIAGSLRALIETGQGHPNPKHDGDAPSH
FT                   QDAASAIRAERRP"
FT   gene            complement(358702..359427)
FT                   /locus_tag="Caci_0320"
FT   CDS_pept        complement(358702..359427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0320"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69273"
FT                   /db_xref="GOA:C7PVB7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB7"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACU69273.1"
FT                   /translation="MLSTEQLKEFGERGYVVVPGVVARNVVAKANKRIDELIAANPPAQ
FT                   GQVGHHFYFPAAADEPELLETLMDSAFGYAEALTGPGLLETPQQVQVALNIPPFSHRPG
FT                   RPHIDAAISEPTPGFTPNSFTLLAGVFVTDQLRENSGNLWVWPGTHRTHAEYFRERGIE
FT                   MYCAYPDIELPEPEQVTARAGDLLLAHYLLGHNIGGNYESDTTRRMLYYRVSGRGHAEG
FT                   PERILTEPWYEYGPVRALI"
FT   gene            complement(359470..360339)
FT                   /locus_tag="Caci_0321"
FT   CDS_pept        complement(359470..360339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0321"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: nfa:nfa16290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69274"
FT                   /db_xref="GOA:C7PVB8"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB8"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACU69274.1"
FT                   /translation="MRLVIDGIDLTTLAIPFYVLFMALELLSLRFFPDPVEQGYTVKDT
FT                   ATSLTMGIGSIVCNLGWGLVTVAAVAGVHALAPWHIASSLTGWLVLFVAYDFFYYWEHR
FT                   ANHRVRILWASHVVHHSSRHYNLSTALRQTWTGVGNTIFLLPLALVGFPSYMIFATAAM
FT                   NLLYQFWIHTERIATMWRPIEFVMNTPSHHRVHHGSNQGYLDKNYGGVFIVFDRLFRSF
FT                   EPEGEPVEYGLTKNIGTFNPLRVAAHEYAAIARDVRGAAGWRARFGYVLRGPGWSPASP
FT                   VPATAVTV"
FT   gene            complement(360412..361983)
FT                   /locus_tag="Caci_0322"
FT   CDS_pept        complement(360412..361983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0322"
FT                   /product="TROVE domain protein"
FT                   /note="PFAM: TROVE domain protein; KEGG: nfa:nfa39620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69275"
FT                   /db_xref="GOA:C7PVB9"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB9"
FT                   /inference="protein motif:PFAM:PF05731"
FT                   /protein_id="ACU69275.1"
FT                   /translation="MAKFNKTATKTAKTFEGGKAYKRDPKADLFLLAVTNMVGEDTFYE
FT                   SADTRDERYRDLVHAVAVSDPEWMLRFVTWLRAEANMRSAAVVAACESVRARLDAEASG
FT                   YGRQLIAAACQRADEPGEVLAYWTGRYGRALPKPVKRGVADAVAHLYNEYSFAKYDSDA
FT                   KGFRFGDVIDLVHPAAAADKPWQGELFRHALDRRHNRDNPVPEALPKLAKRAALLGLPV
FT                   AERRGVLLAEGGAQRLAEAGMTWEALAGWLQGPMDQAAWEAVIPSMGLMALARNLRNFD
FT                   EAGVADAVAWRVCSRFLDAGQVGRSRMLPYRWLSAYKAAPSLRWGHALEGALGHAIAGV
FT                   PELPGRTLVLVDTSGSMTGRVSARSTVTHLDIGALIGVALADRAAGSGRADDVDLVGFA
FT                   DGVFRHELTKGGSVLRGIEAFAKRSGEVGHGTRMIDAIAATYDRHDRVVIVSDMQAFPY
FT                   FYHQNKGADAFIPDTVPVFGINTAGYGPSALPPGKRNRFEIGGFSDKVFTLFGLLASGD
FT                   DPALPF"
FT   gene            complement(362213..363790)
FT                   /locus_tag="Caci_0323"
FT   CDS_pept        complement(362213..363790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0323"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_5254 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69276"
FT                   /db_xref="GOA:C7PVC0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69276.1"
FT                   /translation="MSTNSPPSGRRQRLILTVLIFAQLLIWIDGTVLSTAYETLADPVR
FT                   GLGATPGQLQWATGSYTLVLATVTFTGGALGDRFGHRNTLLAGMALFGLASVFAAYSQN
FT                   TGQLIAARAVMGLGAALLIPATLAVISFTYPPEQRPQAFGVLSSFAGVGIAAGPVLAGL
FT                   MLANFWWGSVFLINVPVVVLGLVAIARTVPNFQPPAKRGLDFPGLLLSSAGLGLLSYGL
FT                   IRAGQDGTVTEPQVWITVAGGLVVTAAFVVVELRRRHPSFDPRLFRLRQFAAGNVSLTL
FT                   LFLALSASGFYFAFYLQGARGYSALRASLVGIPGALGVVIGGPVAAKLARRTSVRRVSG
FT                   TALTVSTITLLVFSRVGLGLPIPAYIAVSIVQATAIGMTIAPLTGAILGSLPLAQAGAG
FT                   SAVNATMRQTGSVLGIALGGTILSIGYRHAIGGSVAALPAPLKQQAETSAEMARNVARH
FT                   NGIPNLAHQADLAFVHAMHTGMVWSAAATGIGALLVFGAFANPRKTKTEAVTAQLEAST
FT                   VVPESASA"
FT   gene            364025..364477
FT                   /locus_tag="Caci_0324"
FT   CDS_pept        364025..364477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0324"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bbt:BBta_4007 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69277"
FT                   /db_xref="GOA:C7PVC1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69277.1"
FT                   /translation="MSTSDKLGEDGVVSFAIRHVWLGMRAVIEDELTEFGLTVPQFATL
FT                   MMLDSSPGLTVAEVARACGTTRQSANEMVAGLESRGLVERAAHPTDRRAHQLHATEAGL
FT                   EMYAKARPAVRRREEELEAGLSPQVRQAAREWMAAIAISCGLPDKK"
FT   gene            364672..365445
FT                   /locus_tag="Caci_0325"
FT   CDS_pept        364672..365445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69278"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC2"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03810"
FT                   /protein_id="ACU69278.1"
FT                   /translation="MSTSLLFTSDSSADGVRERDFTVGGVPGVLWSPDSRPDRAPLVLI
FT                   GHGGGIHKKAPGSAGRARALVLGCGFHVAAIDAPGHGDRPRTEHDEREIDALFAARDAG
FT                   EPEGPIVVRYNAYLAEQAVPEWRATLDALQELREIGADGPVGYWGINMGTAIGIPFVAA
FT                   DPRITAAVFGQHWPDFLAEPAKRITIPVEFDLQWDDEHIPRSAGLALFDAFASPEKTLH
FT                   ANAGRHKQLPRFEADSAVRFFARHFGAPAAGTAAA"
FT   gene            complement(365498..366184)
FT                   /locus_tag="Caci_0326"
FT   CDS_pept        complement(365498..366184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69279"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69279.1"
FT                   /translation="MAEPHAAWGMRQIEEFNEFLPIGPWTVNLDERRYRQSGRELRISV
FT                   LGSFDTAEGSWLWGWANPGFGKLPVVAAAEALRSFGLDHGVPEFSEELVDLSGFEDPRY
FT                   AAEMLAFGAMGVLRADGYIGVQANETGRLYMVPDDPQVPVADPDPIALPRLLMQGAQFF
FT                   NRSAYEVVAGYFHHFTIPWRQEGDTITAELPGGATASVQFDGQGRVAAVSMGSITKESL
FT                   GNTADA"
FT   gene            complement(366387..367406)
FT                   /locus_tag="Caci_0327"
FT   CDS_pept        complement(366387..367406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0327"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein MerR; KEGG: fre:Franean1_1870
FT                   helix-turn-helix type 11 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69280"
FT                   /db_xref="GOA:C7PVC4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC4"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACU69280.1"
FT                   /translation="MNHPAGRVLTLLELLQSGGVRTAAEIAERLGVDARTVRRYVEQLL
FT                   ELEIPVESVRGRYGGYRLARGFRLPPLMLGDDEALAVLLGLLAGRRSGLTAALGAAGET
FT                   AGAKIRRVLPARLSERLRSVLDSVAFTGAPDQSAALDATVLLTVADAVANQRPIAVRYT
FT                   GRDGVRGDRTLHPYAIVSHGERWYVRALDPAIGEERTFRLDRIDGARALPGSFEAPTMD
FT                   DDPGQSLLAGFAAADYRYEVAIRVHGTVEQIRARFPVSVATIQPLSDANGNGDGNGNGN
FT                   EAQTPWHRLAIRAEHLDWIPPTLAALDLPFEIEDPDELRDLVIAFADRLATRARGGLE"
FT   gene            367470..367901
FT                   /locus_tag="Caci_0328"
FT   CDS_pept        367470..367901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0328"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sco:SCO4486 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69281"
FT                   /db_xref="GOA:C7PVC5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69281.1"
FT                   /translation="MTTNLASTRIITADIASLVAFYEKATALPATWATPDFAELATPAG
FT                   ATLAIGSTRTVPLFAPDSAAPGANRSVIIEFLVDDVDALWQRLAAWIPASDVVAEPKTL
FT                   PWGNRSLLVRDPDGTLVNFFTPVTPEARAKYGLSALIES"
FT   gene            complement(367879..368469)
FT                   /locus_tag="Caci_0329"
FT   CDS_pept        complement(367879..368469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0329"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mab:MAB_1873c
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69282"
FT                   /db_xref="GOA:C7PVC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69282.1"
FT                   /translation="MTADPSSPAQQQLRADALRNRESVLAAATAAFAASEAEPSMREIA
FT                   RQAGVGVATLYRHFPTREALVDAVYQDQVVRLTAGARDLLAAHPPARALRLWMDLFADW
FT                   LTTKRGMTGTLLAMVDAGDISLAHTRGELLAAIATILDAGIAAGEIRADTSAEDVSAAV
FT                   LGLLAVSGERGNPEQAQRLLDVLMDGLRTRSER"
FT   gene            368589..369569
FT                   /locus_tag="Caci_0330"
FT   CDS_pept        368589..369569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0330"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL3688 putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69283"
FT                   /db_xref="GOA:C7PVC7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU69283.1"
FT                   /translation="MADRITPPDTMRTVRFREYGEPADVLRLEIASVPAPSPGRIRIAV
FT                   HACGLAPADWALCRGLFAGDLPRGIGCDVAGTVEAVGEGVTDVAIGDPVFGTADYAGQP
FT                   SAGAADHAIMDHWYTVPEGLDLIQAAALPMALSTAYWHLTRLGLSAGSTLLVNGAGTTI
FT                   GYAAVQIALHRGLHVIATAGETYAPQLKNLGATVTAYGDGLPDRVAALSDTPIDIVFDT
FT                   APPNGALPDLIRIADDDPQRILTCSDLATAPDLGARDTFHEDRTTFTDADRFSHFPEFA
FT                   HLAAKGKFTVPVAGTFPLDQWRTALDISQSGHARGKLLLLPGSQR"
FT   gene            369649..370095
FT                   /locus_tag="Caci_0331"
FT   CDS_pept        369649..370095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rha:RHA1_ro06883
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69284"
FT                   /db_xref="GOA:C7PVC8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU69284.1"
FT                   /translation="MDDVEVVDRISGRVILLDPNGRALLFQGFDPQRPNQLWWITPGGG
FT                   LEPGETPQQAAARELQEETSLDVQPQDLGEAVFRNYVEFFFDGRLLRQHNHFFTLRTEP
FT                   FEISTAGFDALEQRTHLTHRWWTLEELRTTDETFFPEELPDLLS"
FT   gene            complement(370550..371932)
FT                   /locus_tag="Caci_0332"
FT   CDS_pept        complement(370550..371932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0332"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: sgr:SGR_3669 putative replicative DNA
FT                   helicase; TIGRFAM: replicative DNA helicase; PFAM: DnaB
FT                   domain protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69285"
FT                   /db_xref="GOA:C7PVC9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC9"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACU69285.1"
FT                   /translation="MSIDDLPYTADEAYQGGFERTPPQDIPAEQSVLGGMLLSKDAIAE
FT                   VIEVIKAIDFYKPAHEAVFGAILELYGRGEPADPVTVAALLTKKGDINRIGGAPYLHTL
FT                   INSVPTAANAGYYAEIVKERAVLRRLVEAGTRIVQMGYSTDGSDVEQIVDAAQQEMYNV
FT                   TEARTSEDFIPLADAMEGALDEIESISNRSGQMTGVPTGFHDLDALTNGLHPGQMVIIA
FT                   ARPAIGKSTLGLDLARSCSIKNGLTSVIFSLEMGRNEIIMRLLSAEARVALHHMRSGTM
FT                   TDEDWARLARRMGPVSEAPLFIDDSPNMSMMEIRAKARRLKQRHDLQLVIIDYMQLMQH
FT                   SSSNSKRPDSRQQEVSEISRSLKLLAKELEVPVIAISQLNRGPEQRTDKRPMMSDLRES
FT                   GSLEQDADVIILLHREDAYERESPRAGEADLIVAKHRNGPTANITVAFQGHYSRFVDMA
FT                   QS"
FT   gene            complement(372303..373931)
FT                   /locus_tag="Caci_0333"
FT   CDS_pept        complement(372303..373931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69286"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD0"
FT                   /inference="similar to AA sequence:KEGG:SCO4070"
FT                   /protein_id="ACU69286.1"
FT                   /translation="MHVPSRRQSLLILGGLGLAATAGGAYLLENHGGGSGKPAANPPKP
FT                   QPQPQARGRAKSTYGTGDANEGQEGEPSNATGETVPSLALALADDGAWRPDATGYLAVD
FT                   DEGHQIKGFASATSINVGESIDFHISVRPAQSFTVKVYRIGRSAAGKGSELVFTSAKVT
FT                   GKVQPALKVVAPTRTVVAPWQLSYTLNVPNTWRGGLYVATLETADKYRSCIPFVVREDG
FT                   KPADLLVVLPFTTYQAYNMYPVDKALGASLYNAYQPDGREGGADICATRVSFDRPYHQD
FT                   GLPRLFELDQAFAQWVEAQPYTISYASSIDLHAGRIDPAKYKALVFSGHDEYWTPQMRA
FT                   VLQGALSRGVSAAFMAANNVYWNIRLDASQGGSQYRQVTCYKRRPDPAATGSVAPTVLW
FT                   RDLNQPEQQVLGSMYTAIITDTQPQPLVVGETGHWFWAGTGLKNGEQIPRLVAGEADKV
FT                   FPHVKGGPKTTVLATSPFTAEGPKNTPVKDTQQTVLSQYPSGAWMFNAGTFHWNHGLST
FT                   PGFVDVRIQRATRNLLDRMTGKRSA"
FT   sig_peptide     complement(373848..373931)
FT                   /locus_tag="Caci_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.453 at
FT                   residue 28"
FT   gene            complement(374094..374549)
FT                   /locus_tag="Caci_0334"
FT   CDS_pept        complement(374094..374549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0334"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: sma:SAV_4286 50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69287"
FT                   /db_xref="GOA:C7PVD1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD1"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACU69287.1"
FT                   /translation="MATTKLILTHEVGGLGEPGDVVEVKGGYARNYLVPRGYAIAWTRG
FT                   GEKQIELIRKARKVRTVRDLAHATELKGELEGLRVRLATRAGESGRLFGGVTVADVADA
FT                   VKRAGGPDVDKRRIEIGNPIKTVGAHTVSVRLHPEVQAKVEITVVAA"
FT   gene            complement(374568..374804)
FT                   /locus_tag="Caci_0335"
FT   CDS_pept        complement(374568..374804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0335"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: sma:SAV_4287 30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69288"
FT                   /db_xref="GOA:C7PVD2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD2"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACU69288.1"
FT                   /translation="MPKAPLRKPKKKVCGFCKDKVAYVDYKDTTLLRKFISDRGKIRAR
FT                   RVTGNCTQHQRDVAVAVKNSREMALLPYTSTTR"
FT   gene            complement(374899..375558)
FT                   /locus_tag="Caci_0336"
FT   CDS_pept        complement(374899..375558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0336"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: sgr:SGR_3673 putative single-strand DNA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69289"
FT                   /db_xref="GOA:C7PVD3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD3"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACU69289.1"
FT                   /translation="MAGETVITVVGNLTDDPELRFTPSGAAVANFTVASTPRTLDRQTN
FT                   EWKDGDALFLRCSIWRQAAENVAESLTRGMRVIVSGRLRQRSYETKEGEKRTVVELDVE
FT                   EIGPSLKYATAKVTKANRPGGQGGPGGGGGGGWSGNSGGGGNSGSAGGGGGWGGNSGGG
FT                   GNSGGGGGGGGSWGGNSGGGGGNSGGGNQGGGNDPWASGGGGDGGWGGYGNDEPPF"
FT   gene            complement(375589..375894)
FT                   /locus_tag="Caci_0337"
FT   CDS_pept        complement(375589..375894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0337"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: sco:SCO3906 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69290"
FT                   /db_xref="GOA:C7PVD4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD4"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACU69290.1"
FT                   /translation="MRQYEVMVILDPDLDERSIAPALEGFLKVIRDLGGSIEKNDIWGR
FT                   RRLAYEIKTKSGKKVSEGIYAVVDVQATPDAVKEFDRQANLSETVVRTKVIRPDQR"
FT   gene            376147..376506
FT                   /locus_tag="Caci_0338"
FT   CDS_pept        376147..376506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69291"
FT                   /db_xref="GOA:C7PVD5"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD5"
FT                   /inference="similar to AA sequence:KEGG:SAV_4290"
FT                   /protein_id="ACU69291.1"
FT                   /translation="MTQTTPGTGDYGPEVAGRPGSTAADYAEDPKERPGFHIGSHTQEM
FT                   ALTITALVLAVVAAAMIGWTGGHVLGGWIALAGIVVGLYAQLTSDTTYERMVNVCAIGI
FT                   AAVAFAFHLHHGGLW"
FT   gene            376634..377422
FT                   /locus_tag="Caci_0339"
FT   CDS_pept        376634..377422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0339"
FT                   /product="apurinic endonuclease Apn1"
FT                   /note="KEGG: nca:Noca_4666 endonuclease IV; TIGRFAM:
FT                   apurinic endonuclease Apn1; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69292"
FT                   /db_xref="GOA:C7PVD6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD6"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACU69292.1"
FT                   /translation="MAMRIGSHVGNEDPIAEAVARGADAVQIFLGDPQSWKAPTVAYPG
FT                   GASALRAAAEQADVAVYVHAAYIINVAATNNRIRIPSRKLLQQTVALAAEAGARGVVVH
FT                   GGHSTAADAPDAGFDNWRKAVDQLEQHCPVFIENTAGGDHAMARRIDAIAKLWDAVGHS
FT                   GIGLCLDTCHAFAGGIPLESAVADIKAVTGRVDLVHANDSQGGFDSGIDRHANFGSGEI
FT                   APADLIAQVIAEAGCPAICETPGGAEAQAADIKWLRERVA"
FT   gene            377432..378616
FT                   /locus_tag="Caci_0340"
FT   CDS_pept        377432..378616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0340"
FT                   /product="Methicillin resistance protein"
FT                   /note="PFAM: Methicillin resistance protein; KEGG:
FT                   sma:SAV_4291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69293"
FT                   /db_xref="GOA:C7PVD7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD7"
FT                   /inference="protein motif:PFAM:PF02388"
FT                   /protein_id="ACU69293.1"
FT                   /translation="MVLRVRTLSREEHVAFIEERTAEKNAATSVSFLQCPSWGDLKTDW
FT                   RAESVGWVEDASGEVVGAALVLYRDVPIPKRDKLPFLRRSLAYLPEGPILDLTSADAGQ
FT                   ALKLLVAHLRKRRAFTVKMGPQMVSRRWTSETLKKAIAETEGGVRLKDIKPDFEDPTAL
FT                   SIIEKLRATGWSRKESEGAGFGDFQPRYVFQLPLVDESGKPRTLEDIQKGFNQLWRRNI
FT                   KKADKNGVEVTLGGYDDLAEFHKIYEVTAVRDHFTPRPLAYFQRMWKAMEAENPNRLRL
FT                   YLARHEGELLAATTLVTVGDHAWYSYGASADHKRELRPSNAIQWRMLSDSHASGCKVYD
FT                   LRGISDTLDPNDHLFGLIQFKLGTGGQAVEYLGEWDYALNPVLHRAFEMYMARR"
FT   gene            378675..379733
FT                   /locus_tag="Caci_0341"
FT   CDS_pept        378675..379733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0341"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   sco:SCO3903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69294"
FT                   /db_xref="GOA:C7PVD8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD8"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU69294.1"
FT                   /translation="MSLTLHIDAERWRAHQDEVLARHPDLVPVAKGVNGYGIGIPNLMQ
FT                   AASKLAAAGVEITAVGTAAEAEQAKDHYSGRLLVLTPYLIGEDVRDLPDRVIRTVASVE
FT                   AVEALLGRRVVIDLMTSMRRFGLEKQDIPRLHAALESDQARVEGFSVHMPLDRVAGDYL
FT                   REVSDWVDALVAAGIPVRTLFVSHLSPDEISTLAKRHQGTTVRPRIGTQLWLGDRKALQ
FT                   ARGTVHSVQKVSKGDRFGYRQHKARGDGHLLVVSGGTAHGVGLENPKNFGRGPAGLTPR
FT                   AKFAARAAMALLNRTMSPYSWQGKTLWFAEPPHMQVSVLFLPAGVAPPKVGEEIPVEVS
FT                   PVMTHVDRVVFD"
FT   gene            complement(380045..381613)
FT                   /locus_tag="Caci_0342"
FT   CDS_pept        complement(380045..381613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69295"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD9"
FT                   /inference="similar to AA sequence:KEGG:SAV_4147"
FT                   /protein_id="ACU69295.1"
FT                   /translation="MSSTSKFLRDLAKKTNTASAARAVLRATHLKSGPGRLSDPRVGLP
FT                   ASVLPAGGNRITAENAKAGSADWRMGASKSRPGTDYERQIKGYASTDSVAAGEAIDFHI
FT                   AVEPAGSFTVSVYRLGYYGGASARRVLVSPTLTAAPQPVPTPDQETGRIALEWPVAWTL
FT                   DIPKDWTPGTYVAVLDKADGFRNYVPFVVRDDEASADFLVVLPSTSWQAYNWWPRDGIT
FT                   GRNVYYGYVTKEAAESDAALKAKFSTDARGWISNPARATQVSFARPYFADGLPDGFVRE
FT                   QSFIQWAEGMGYDLSYATGLDLHAGRIDPTKYRGLIFAGHDEYWSTDMYRHAEEAVAAG
FT                   TSLAFLTANNAYWHVRYDEHTRTMSCYKGFEDPHTEDFPTGMWRAGEGNPRAEQQLMGV
FT                   QYSGILKGRHPLIVHEADHWFWSGTGLTNGDEIPGLLGGEADSLFEAMPRAKAEEQALL
FT                   TASPYTISNGTNFTQNTSIYRSPSGAWVFTAGTFLWPLGLGHPTYQDKRITRATANFLS
FT                   RVKGS"
FT   gene            complement(381644..382711)
FT                   /locus_tag="Caci_0343"
FT   CDS_pept        complement(381644..382711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69296"
FT                   /db_xref="GOA:C7PVE0"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE0"
FT                   /inference="similar to AA sequence:KEGG:SGR_3221"
FT                   /protein_id="ACU69296.1"
FT                   /translation="MAVLTWISAWVFVAGPTKQGSLLARWDRWDEGIFTSVAQHWYFAA
FT                   GTDPRHVAFFPGFPIAMWLAHLVVWNWIAAGLVVSAAAGAIATMALGRLARDEVDASNA
FT                   DADAGQAAANATLFFVLAPAAVFLAAGYSESLFAAFAFSAWVAARRDRWWLAGLLAAGA
FT                   STVRVNGLFLAAAIALEFILAGRERRQWRQAPLLVIPALPVIAYVVYLHHETGDWLAWQ
FT                   HAQAAGWFRTFQSPESAWNQTWRAAFGGTQAGHTAWVFQLELIAVVIGLALTALLLLKR
FT                   RWPEALYVALSLLALGTTTWFMSVPRAMLLWWPLWTMLGAWAARRPMVRTLYVCCVAPV
FT                   MVGVALLFLSGQWAG"
FT   gene            complement(382884..384455)
FT                   /locus_tag="Caci_0344"
FT   CDS_pept        complement(382884..384455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0344"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3902 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69297"
FT                   /db_xref="GOA:C7PVE1"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE1"
FT                   /inference="similar to AA sequence:KEGG:SCO3902"
FT                   /protein_id="ACU69297.1"
FT                   /translation="MQTGDGAVGHDVQVSSDVSDQAPGPSAEPTGRGAATAPVIVAPSL
FT                   DDPVVNAASDAVGGPLGVRAWRPRLGSGAAIRTVARVLVLLTLLTLGIGVAQRSPCYST
FT                   AWNGTGKQQYNHLCYTDVPYMYYGRGFDKSLTPYRQSDPASGNYGLEYPVVAGATMETA
FT                   ALLAQKLGADTPDQVRWFYNVTTWFLIVFALVCVLAVIGLAGRRPWDAAMFALAPGLLL
FT                   TGTINWDLIAVALASVGMLAWARNKPVVAGIALGLGSATKLYPVFLLIPLLVLCWRAGR
FT                   MRQWSQATGTAVVTWLVVNAPVMILAFKGWKYFFTFNDNRPIDLGSPWFAIRHWWGWEP
FT                   PNKNVVIIALVLAGWLGVALLGLMARRRPRFAQLAFLTVAVFILLNKVYSPQYVLWLIP
FT                   LAALARPRWRDFLIWQICEAAYYVAVWYYLVWQAGPSNGNTRGLPDNFYVWAIVIHLAG
FT                   IVYMMVQIIRDILDPRRDPVRADGIDDDPAGGALSDSPDVWAWSQPRSHRAGHGAGAEP
FT                   ELVASV"
FT   gene            complement(384476..387439)
FT                   /locus_tag="Caci_0345"
FT   CDS_pept        complement(384476..387439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0345"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: sma:SAV_4294
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69298"
FT                   /db_xref="GOA:C7PVE2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE2"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU69298.1"
FT                   /translation="MSEHGSRRGGGGGGGSRGRRSAGGGGFSDKLDGLAHQLSGMFGKR
FT                   GAGRRGDDGYDEYGSYDDRGYGEEPYDDGYGAEPADVAVGGRRGLGRRTAAGSGGAGRG
FT                   GRPGGSGRKDGLPPKDWWMKFINYPRYGKRGWRHWMPSIKQVLSIFLGFLFVVIGGVAY
FT                   VYASTQIPQVKNSIAAGNPTYYTYDDGKEQFANIGVNYYQVNDINTIPKVFQNAFVAAE
FT                   NYSFWSDPGVSFTGVARSALNDLFGSGGTQGGSTITQQYVKNAYLSQDQTLGRKVNEIM
FT                   ISIKLNHTESKQQILLGYLNQISFGRGAYGIDAASRAYFGHPINQMTDANVGEAAFLAA
FT                   LVNDPSNFSTALANGKARTDNPKTFDRFEKRYNAILANMSQYGFVPKTTTAPLENKLPN
FT                   VIDFKGPNLGQYVGYMKDAATAFLAAQMQEYPSDPTTQKYANIDNLSKGGYKIVTTYNH
FT                   VMMNDSVTAANALWTGTSGGGGGKLNPKHASDHDIHLAFASVDPHTGELKSFYTGTDGK
FT                   EDYGSNAFNYALQGGVQVGSTFKPITLATALQSGKFSLDSQEPGTNEKPLFLPGSKQPI
FT                   TFYDTSLHKTAFWPPNEDEEAPPNGGSTTLKQGLAMSLNSVFAALELDPAVGMDAVYNM
FT                   AEQLGIKPGTPDFLKVASLTLGTAEITPMRMANVYGAFANGGVSHEPVQVTAIIDQRTG
FT                   QTVWTPPALRSNSGVNKQVMSVNTAAGVTNALQSVLQKGGTANANHDAAALAAEANYNL
FT                   AGKTGTTDSNHSAWFTGFSTSLATSVAIFRSTADGTLESIKGLGYNDQSTRINGMDWPT
FT                   TVWSAFMKIELDKNKSGFAKPFPPYAPTCSGVSDIPSFPNQSVAPGTLASGSLPGTPTG
FT                   SEANCQSVFVPTPTPTPTPTPTKPTTSTQAPLCTLPMVFDPASQQCVVVPPTSTDTSTQ
FT                   QQPTGTGTSNPTGPGQPTTSPTTPSSRCSRNPQQPGCQTTSPTTSSTSSLSGFPPAG"
FT   gene            387837..388442
FT                   /locus_tag="Caci_0346"
FT   CDS_pept        387837..388442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0346"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sco:SCO3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69299"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE3"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACU69299.1"
FT                   /translation="MAKRSQILELAVLGLLHEHPMHGYELRRQLNVQLGAFRALSYGTL
FT                   YPCLKDLVARGWIAEDDTQTANVAASRRAKISYKLTAEGKERFQELMTTSGSAAWEDDN
FT                   FGVHFAFFGRTNAGVRIRILEGRRSRLEERMEAVRTSLARSRDRLDSYTLELQRHGLES
FT                   TEREVRWLNELIRTEHEQAFPAPPQQQPQQGSPEPRPS"
FT   gene            388574..389653
FT                   /locus_tag="Caci_0347"
FT   CDS_pept        388574..389653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0347"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sco:SCO3899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69300"
FT                   /db_xref="GOA:C7PVE4"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE4"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ACU69300.1"
FT                   /translation="MGSVRVAIIGVGNCAASLVQGVEYYKDADPNAKVPGLMHVQFGDY
FT                   HVSDLEFVAAFDVDAKKVGLDLADAIGASENNTIKIADVPPTGVVVQRGHTNDGLGKYY
FT                   RQTIVESDAEPVDMVAALKAAKADVVVCYLPVGSQSAVEYYAQVAIDAKVAFVNALPVF
FT                   IAGTKAWADKFEAAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVVLDRTMQLNVGGNM
FT                   DFMNMLERERLESKKISKTQAVTSQLSHDLGAGNVHIGPSDYVAWLDDRKWAYVRLEGR
FT                   AFGDVPLNLEYKLEVWDSPNSAGVIIDAVRCAKIALDRGIGGPILSASSYFMKSPPVQY
FT                   FDDEARDAVEAFIKGEVER"
FT   gene            389821..392364
FT                   /locus_tag="Caci_0348"
FT   CDS_pept        389821..392364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0348"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1461 cell wall binding
FT                   repeat 2- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69301"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE5"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69301.1"
FT                   /translation="MGRKREISVISSLVVAGAAFGGSVVSAPTASAASITVSASGADVV
FT                   AINPAMFGGGAPTDQVSTQLAQILRNSARYLGTTWYNQTYGNSLASDGYLNLDIPGAVP
FT                   EQSFRLPGMAAVSIATAVKLGDWDAGASGISADEAENRAATMVRALAHRYYANNSLAGV
FT                   STWGNSWQSPLWAFYTGQAAWLVWDKLSPSERNDVARMMADEANRLLTGNDVYLTSDTG
FT                   SQQLYQYNRGGTDVTPGDTKAEEDNYEAQLLGLAVAMMPNHPNAARWQRRNEDLLIADT
FT                   ATPDDLTNSAAGNAVVNGRQLNQWLQGYNMQADGTVQNHDILHPLYMTALDQSLQQVGT
FT                   FALAGQCAPQAATNNVGLTYKALTTQTSFPYAPDPNNLTQDVTAKTPDGKPIYESTSSP
FT                   QINYPQGNDWGTQFPAYYGSFDALVSAYSPYLVGENNQAPTATANAVTHLQSEISLQSR
FT                   FGDGQTYQPWNPATTPGDKAENSYVGAEQRVGQITAQAYMAEFLNHHSRGCFTNSGNPT
FT                   PPNVPPVQPTAVSRLSGTDRYGTGVAVSQAQWSNAGGDNTPRAIADAVVLARGDNFPDA
FT                   LAGTPLAKRDRGPLLLTEPGALNPVTANEIKRVLPKGKTVYILGGNQAVSPKVQSQLVA
FT                   LGYTVKRFGGSDRYQTALLIAQQGMGSPHQVVVATGQDFADALAAGPLAADEGNAILLS
FT                   NGKTLDANTKAYIAGAQRKNGAADPAFHLNAVGGAAVAATHYLGSQSHALMGNDRYQTA
FT                   AAVAARFAADMPVTQFGVATGTQFADALTGGAFMANANEPLLLTAPTALAPSDTTLLHG
FT                   MRSQLSAVTLFGGPVALKQAVMDQIAHAVGGVERR"
FT   sig_peptide     389821..389919
FT                   /locus_tag="Caci_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 33"
FT   gene            392494..393327
FT                   /locus_tag="Caci_0349"
FT   CDS_pept        392494..393327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0349"
FT                   /product="protein of unknown function DUF1684"
FT                   /note="PFAM: protein of unknown function DUF1684; KEGG:
FT                   sco:SCO1747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69302"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE6"
FT                   /inference="protein motif:PFAM:PF07920"
FT                   /protein_id="ACU69302.1"
FT                   /translation="MSETEQTATIPAAPADWYQWAEKREASVSGEYGVLALVGTHWLDE
FT                   GPAVSIDGLPGLWAAAGHRVSVTALPADALLVDGVPVDGVRFLDPDLALDPSVLFHHGR
FT                   KLVPIIREGVLALRVYDPEAENRRSFAGISRFPYDPALVFTARYERYVHGHVERVLNAD
FT                   GKERGLALNGDLVFEHGGAEYRLAVTANGGEDFDVTFGDATNGPDTFGFRQLTVPAPHL
FT                   DDPDNPDSGTTVLDFNRAQLPPCAFSDHFICPVPPVGNRLELAVAAGEKRREVRT"
FT   gene            393416..393871
FT                   /locus_tag="Caci_0350"
FT   CDS_pept        393416..393871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0350"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   fre:Franean1_1175 BadM/Rrf2 family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69303"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE7"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACU69303.1"
FT                   /translation="MQISAKADYAVRVMLELAAHGPNLVKSTVLIDHQGLPRKFVESIL
FT                   VELRRADLIRSHRGAEGGYTLARPASAISIGQVIRAVDGPLAEVRGLRPHETEYSNAAQ
FT                   HLSDVWVAARAALRKVLDETSLAHVLSGKLPAHVRRMAESPEAWLPR"
FT   gene            complement(393958..394182)
FT                   /locus_tag="Caci_0351"
FT   CDS_pept        complement(393958..394182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69304"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69304.1"
FT                   /translation="MRKFATFAALALSAGTAVAGGACVANADVNLGVDAPTTSTAPAAG
FT                   SMDFAGTWCGAPWLWSGQQAGAGCNAQGH"
FT   sig_peptide     complement(394099..394182)
FT                   /locus_tag="Caci_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.660 at
FT                   residue 28"
FT   gene            complement(394286..397018)
FT                   /locus_tag="Caci_0352"
FT   CDS_pept        complement(394286..397018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0352"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: Peptidase S53 propeptide; KEGG: sma:SAV_5949
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69305"
FT                   /db_xref="GOA:C7PVE9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE9"
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /protein_id="ACU69305.1"
FT                   /translation="MVGRFRHVTATLAVAALMAAPNAVSAATTSVTAADGPTTARIGLA
FT                   GADPDGLQQLARAVADPHSTQYRHFLTPAQLQAKYGPTPAQLKQVHQWLTTGGLTITGE
FT                   NAHWIDVAGSSAKVRKAFGHLPQLRIRQGIGAGYAARAAATVPPALAGAVSSVAGLMPE
FT                   RQGMRQFSYRVMTGARSRALTGGGVDPGGPMQPAQPAAPGGQGGQGGPLQPTQGTQVNP
FT                   GGPMQPAQPAAPGTQGGQNGPVQPTLGTQINPGGPMQPAQPAAPGTQGSQGGPVQPTSG
FT                   AQPAQPAAPGTQRASVQQAPRTQINPGGPMQPAQPAQPAAPGTQRASMQQAPRTQINPG
FT                   GLMRPATREMPAAQVDPGGPMQPSAPVMPAPKGPVGSGGAGGGVNPGGPMQPSGPAGSA
FT                   GPVGPIVVGGPIRRSLPGGAGGLVSPSVSSTACSADWGASPAVGVPEGYNKPDPLVACG
FT                   LTPKRLRAAYGVTAAGFSGRGAIIGIVDAYGSPTMRADADAFAKSVGDLAFGAGQYMES
FT                   VDRGAWKHLGDGVCETPAAWGGEEALDVEVAHGLAPGAVVHYFGAASCQDQDIAAMLAS
FT                   IVDKHLADEVTGSFGEIMHSAGGDIDPALVMQENQIFTTGAAEGIGFAFATGDCGDQAA
FT                   GLSGPGCDTGSARAQVEWPAASPWVTAVGGTALAVAPNGTRRWEAPMGDLRSDLSADGS
FT                   KWAPLPGQFFFGGGGGLSGDFDQPAYQKGVVPADLASPVVGGKATGKASGTASGKAAST
FT                   AVGPAKRTVPDVAMDGDLLTAVLTGHTDPTLGGYGQDVIGGTSAAAPMFAAVQADAMQA
FT                   AGGALGFANPALYKRSGTKQFTDIVAGPKGAPNPISAVVDHGTFGDVHEARLFKLGADH
FT                   GLSARKGYDTATGLGSPTAAYITSFKPAPSKTGTGKKKP"
FT   sig_peptide     complement(396938..397018)
FT                   /locus_tag="Caci_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 27"
FT   gene            complement(397134..398669)
FT                   /locus_tag="Caci_0353"
FT   CDS_pept        complement(397134..398669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0353"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fre:Franean1_3555 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69306"
FT                   /db_xref="GOA:C7PVF0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69306.1"
FT                   /translation="MRKWLPLVAVCLGTFMLLVDVTIVTVALPDMARSLDTTFADLQWV
FT                   MDVYALVLAALLLAAGSLGDRAGHRRLYVAGLVVFAAASLACGLATSPGVLIAFRAVQG
FT                   VGGAAMLATTVALISHLYSGRDLGTAFGVWGAVSGAAAAAGPIMGGLLTQHLDWRWIFF
FT                   VNLPISVAAVAMTLRYVGESRGERRRGLDLPGLLTFTAAAGLATYALIKGNDYGWGSAR
FT                   TIGVFAGAAVALVAFVVAELRVRTPLLDLSLFRRGTFTGVMIGALLLSGAAFSYFAYES
FT                   LWLQSALGMSPVTAGLCFVPMSGAAFVTAGLGGRLLEDRLSPRVMIGGGLLLIAAGSAA
FT                   QMLVSAGSSWTVLVPGLVVSGVGVGLATPTLVSTAVAAVGYQRAGMASGAVNTARQLGN
FT                   ALGIAVLGVVFHAGLASSVRGAGVPQSAAVADALAAGQTRGVLASGPAAQRPALEHMVH
FT                   AAFASGLRSAFLAAAVMGAVGGLAVLALVRRPGGGHAPGEQSSAANVPIPAEA"
FT   sig_peptide     complement(398610..398669)
FT                   /locus_tag="Caci_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.679 at
FT                   residue 20"
FT   gene            398804..399820
FT                   /locus_tag="Caci_0354"
FT   CDS_pept        398804..399820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0354"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: sma:SAV_1846
FT                   transcription regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69307"
FT                   /db_xref="GOA:C7PVF1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU69307.1"
FT                   /translation="MSTDQRVEEFDRLDRQLAQALMIDGRASFSRLAEVLGVTDQTVTR
FT                   RYRRLRSGGLLRVIGLPLGNRVGLYQSNVRVQCVPGAAGAIADALARRRDIGWVTINAS
FT                   GTEVSCMTRSPSRRERDLLLLDKLPRTRQVTGVSVKTIMHAFVGGPGGWPGLAADLGAD
FT                   QAAALHRDFPEVPGEFELDDADHALLAVLARDGRAPYPELAAAVGKSESTVRRRVEHLM
FT                   DNGVLYFDVEVLPVHLGFHVEAMVSAAVAPSDLDAVGRAVGSHPEVPFAAATTGPTNLA
FT                   AVVVCREIQDLYEYVTGRMGAIKEIGQLEVVQVLRTVKRAGLLTDGVRLFDPPETVY"
FT   gene            complement(399928..400599)
FT                   /locus_tag="Caci_0355"
FT   CDS_pept        complement(399928..400599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69308"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69308.1"
FT                   /translation="MSTAAETAGSKPINYRLNLGEGWTRIRLDDHAEADVNAFLDTVFA
FT                   AVPADAAEAGRDLIGGRLTTQIVAGRAKGGIDFYIPTPGGGPVPALTVMASEVKIPSAA
FT                   VPEPADVVARVAASNPTARTGVIAGMPAVRIDRSAGAGLDAEPAGEDAEEDKDGFQPPR
FT                   PRHIEYVVPVAGDPDHRWLSIALTGQAGPGGDEAKVDAAISRFDQAVADLAWTEGEGSG
FT                   A"
FT   gene            400940..401581
FT                   /locus_tag="Caci_0356"
FT   CDS_pept        400940..401581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69309"
FT                   /db_xref="GOA:C7PVF3"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69309.1"
FT                   /translation="MGAATALTLLGPAAASAAADTTPAPPAGVTVDVLGGSTPADEHAA
FT                   IDYTIELRDAGTVPYRHVAVTAMLPPGFHILRASPALAASAGPGSMPTWTADLLPGRTV
FT                   DIHAEITAGTVQDLAEAAEPLTGPSDVLDGSGPGSGSSSGAMAWYSLSACAQSGPSGVP
FT                   VCGLSRQLLVKTDDDTRRGIEAMVLILGVPLLVGGLGVYAWRARREPDMD"
FT   sig_peptide     400940..400999
FT                   /locus_tag="Caci_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.745 at
FT                   residue 20"
FT   gene            complement(401672..402214)
FT                   /locus_tag="Caci_0357"
FT   CDS_pept        complement(401672..402214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0357"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: dge:Dgeo_2488 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69310"
FT                   /db_xref="GOA:C7PVF4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF4"
FT                   /inference="similar to AA sequence:KEGG:Dgeo_2488"
FT                   /protein_id="ACU69310.1"
FT                   /translation="MDASVWIVNIVVLASVLGTDLGRRKVGMARLLRPAIVAAVIVPMY
FT                   VKHPATSGSGLVLELAAAALGLLLGLGAAALLKVRRNPSDGVIYTHAGVGYAALWTAVI
FT                   GARLLFVYGSNHWFTEQLGRWMTQHQISVDALTDALVVMAIAMLLGRTGTLAAKRRTAV
FT                   TGHVATGASAQRTQVVR"
FT   gene            402413..402868
FT                   /locus_tag="Caci_0358"
FT   CDS_pept        402413..402868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0358"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   sma:SAV_5952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69311"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF5"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACU69311.1"
FT                   /translation="MHLMKSTDLALRLLMRLAVVPPDTHPDELPTTRGVAEAMGAASTH
FT                   MAKVVGKLQHLGLVQARRGRGGGLVLTPAGRVASVGAVVRTFEGSGDLAACVDGEDPCP
FT                   LNAACRLRSALRAAQEAFYASLDQLTVEDVTAAPTGPLLLSIAMGRP"
FT   gene            complement(402891..404087)
FT                   /locus_tag="Caci_0359"
FT   CDS_pept        complement(402891..404087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0359"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   globin; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: sgr:SGR_2266 putative flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69312"
FT                   /db_xref="GOA:C7PVF6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF6"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ACU69312.1"
FT                   /translation="MLSEQSAATVRATLPVVGAAIGDITERFYARLFQAHPELLRDLFN
FT                   RGNQAAGTQRLALAGSIAAFATQLVEQPGTRPDALLSRIAHKHASLGVSPAQYKVVHQH
FT                   LFAAIAEVLGDAVTPDVAAAWDEVYWLMAHALIAIEGRLSTERGYLVGGTWRDWEVVGR
FT                   REETADVASFLLRPVGGGTPQPFQAGQYVSVQVELPDGARQIRQYSLTSAPDAAVRQIG
FT                   VKRERGTDADPAGEVSNHLHDTVQPGHVLRISAPFGDLVVDAGASEQPLLLASAGIGVT
FT                   PMISILAELVNREHAAPVLVVHADRSPEAHALRSDQNILAAKLISGRTYYWYENDAGES
FT                   GRVGLADLSDVEIPAGTAAFLCGPLPFMRAMREQLLAKGVPAADIHYEVFGPDLWLAA"
FT   gene            complement(404219..404491)
FT                   /locus_tag="Caci_0360"
FT   CDS_pept        complement(404219..404491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_1411 vitamin B12-dependent
FT                   ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69313"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69313.1"
FT                   /translation="MAQVRLPRQRSSETVSVRVGGYAGRVTVVRPDDRPPQVLLMAGGH
FT                   GSTVAGFADAIGTAISLGLANGAGFDDYRVALELVGLSADQLERE"
FT   gene            complement(404691..405515)
FT                   /locus_tag="Caci_0361"
FT   CDS_pept        complement(404691..405515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0361"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ret:RHE_PE00204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69314"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACU69314.1"
FT                   /translation="MAPLIDYRSPGLFTDVRGVEPAALRGVATDPVDLIRPVSRLVIQP
FT                   HEAEAAGIAAERLAENQIRPAAVLVERLLAVDAAPLSEPREAGKRVVGTCRHFAVLACA
FT                   LLRNAGYAARARCGFATYFQPGQALDHWVIEYRLDDAAHWIRLDPETLGGSVLPNADDL
FT                   SPGDFLTGAEAWAAYRRGEVDGATFGVHGTENFGPAEIKGNAVRDLAAMNKVETLPWDE
FT                   WGRMTDAYAGLTGEDYDALLDELAAACASDDDRALSELYRDPVFEVPAELLL"
FT   gene            complement(405526..406497)
FT                   /locus_tag="Caci_0362"
FT   CDS_pept        complement(405526..406497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0362"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_3810 epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69315"
FT                   /db_xref="GOA:C7PVF9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69315.1"
FT                   /translation="MNKRSVMVGGLRMNVVEAGSGPDVVVLLHGFLNYSYSWRHQVRDL
FT                   AAAGYRVLAPDLRGYGETGCPEDVEQYSMLHLVADVVGLLDAFGIERATVVGHDWGSVL
FT                   AWHTALLRPDRVRGVVGLSVPYVPRADISLLTAMRERFGDLYYMQYFQEVGPADRELAR
FT                   DVAATFRSVLSSGSEPWNPVLPEGGGWLDCLPDKGIPDWLTAADLDAHVAAFERSGFTG
FT                   ALNWYRNIDRNHELTAAWQGAKIQVPALFLYGTRDAFGRYASELIDDLPRSVPDLRSVV
FT                   RLDAGHWVQQERPDEVTAALVDFLERDRDRDGARPMPVGAAL"
FT   gene            407168..409477
FT                   /locus_tag="Caci_0363"
FT   CDS_pept        407168..409477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0363"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sgr:SGR_935 putative sensor-like histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69316"
FT                   /db_xref="GOA:C7PVG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69316.1"
FT                   /translation="MTAADRVQEAPPRPGHGAPGRHSAYNAAGAERRPAGRRPTAWVVA
FT                   PSVCSAVLAGAAIVLVVDGAHSAGYHISSGTMTAVWVLGGLILAVVAATLAFAGRPGRA
FT                   TEIPAFGGPDPRQAPPPMAQPQPQPQPQPHQQPQHQQHRPQPAPAPLPQQAPPPPPMSP
FT                   QVVANATEAAATLAAATKAAAGPIAVSEEGVDLQVIFAQLVRRLLTLVLQQINRLDELE
FT                   NEVEDPKLLKSLFGIDHQATQVRRYGENIGVLVGALPQRQWTHPVPVTVAQRSAVSETP
FT                   DYPRVQVIPRAPGRIHGHAVSDVIHILSELVENATNYSNPTTKVTVGAHRVSAGLAIEI
FT                   NDHGIGMESDQFRRLNTLLRDPSGANVKDLLSQGRIGLSVVAKMAQRHGIAVELAPNVT
FT                   GGTMALVVIPDALLAAEELPADKGHQPRRGIDHTQLPARPALAPLPDTLPPATTSSTAS
FT                   TAATAPSSAASLSPVAASMPPPLSSPATAHVPPLPTSPAAAAQESARAGQPTPIRATPP
FT                   PLPTSPLPTSPAAADQAARTAQQGYAQPDSFQSGQGRQAWSQPAPAEPQWPSINPPVTG
FT                   GASAPTAAAPVPGPTGSVASFQAPSADMYQGSELGAAAPAQTDRYPAQDFGTPAPAQPD
FT                   RYSLQGPDTAVLPLTPDRYPAPGTGTSVPPWSRLGDRSAAGEQASEPASEKAPGLLPDG
FT                   RPQLRRRTPQGHISARLLQAEPQENPHGGGALSPTMMSDFWQGLSSGIAPAGPPAAGAD
FT                   PSQHDRTTANRQEWNQ"
FT   gene            409474..409905
FT                   /locus_tag="Caci_0364"
FT   CDS_pept        409474..409905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0364"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   sma:SAV_1632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69317"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG1"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU69317.1"
FT                   /translation="MSTQTEENLSWLINRMLQSIPAARSVLLMSTDGLVRAYTTGLNKD
FT                   EADTLAAAESGMWGIVTAIGKTVRAGGVRQVVVELDGAFLCVGAAGPGTCIGVLADREA
FT                   DPRQIGFEMQRCVTAVVRELSTAPRGAADGAVAAARARS"
FT   gene            409902..410273
FT                   /locus_tag="Caci_0365"
FT   CDS_pept        409902..410273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0365"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   sco:SCO6796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69318"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG2"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACU69318.1"
FT                   /translation="MSRGDPDAFVDSAAGRLIRPYAVAGGRTAPNADFHLVTYVVATGR
FT                   ALSDLGPDHDDILSLCDRPISVAEVSALSGLPLAVTKILLSDLLGWRAIDTRAPVPVFE
FT                   RARPSTDLLEKVLDALYKL"
FT   gene            410254..410889
FT                   /locus_tag="Caci_0366"
FT   CDS_pept        410254..410889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0366"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   tfu:Tfu_2447 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69319"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG3"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU69319.1"
FT                   /translation="MPSTSSDRASENLPGGLKLLIAGGFGVGKTTLVGAVSEIAPLKTE
FT                   ATITEASVGVDDIALTGGKTTTTVALDFGRISIANEYVLFLFGMPGQERFWFMWDQLCI
FT                   GALGVIVLVDTRRIEDSFEAVDYFERTGIPFLVAVNEFEGARFAYTSVEVREALQLRAE
FT                   VPVVMCDARSRTSAVNVLIALVKHLQSTDFRPVRPAAPELAAHEGSYI"
FT   gene            410886..411854
FT                   /locus_tag="Caci_0367"
FT   CDS_pept        410886..411854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0367"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: sma:SAV_1629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69320"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG4"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69320.1"
FT                   /translation="MTDRDDFQTPALRLGQPAPSDAAARAARQRELSLSATADSVFDEV
FT                   ARRAAEATGATAAMVNMVGENGQYLVGLYGKEPGSGEAAFLGDPGRYAAMDQGFCVHVV
FT                   GRKAALTLDDVFDFSRFRGNPIVDELGVRSYIGVPLIDDGGTVIGTVCAIDPAPRSESD
FT                   GNSWGNQGLQVLKAARDEVLAEISGRQKIAAILENAGGTAMIAARPGLEVLYANTLHDQ
FT                   LFGAVQVLGTPALEAFPHLAPVGILAVIETLDRGGEPTTTAPIPLSEPATGSVIFAAVP
FT                   VRVPGHASAVLTLGLRDSDAATVLNRAAQIAADIGALSDTR"
FT   gene            complement(411918..412919)
FT                   /locus_tag="Caci_0368"
FT   CDS_pept        complement(411918..412919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0368"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: sma:SAV_609 3-oxoacyl-(acyl carrier protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69321"
FT                   /db_xref="GOA:C7PVG5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG5"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69321.1"
FT                   /translation="MTKAAVISGIGSSVPASVVTNDMLAERLDTTDDWIRRLTGIQTRH
FT                   WIEPGQATSDLAVEAGSRAIESAGGEPPQAVVLATITPDRPCPATAPEVASRLGLEGVA
FT                   AFDVAAVCSGFVYGLATGTGLIAAGIAERVLVIGADTISTILDPTDRSTGVIFGDGAGA
FT                   VMLRAGEADEPGALQALDLGSDGTGTDLITVPAGGSRQRSTKSVPPTTDTYLKMAGREV
FT                   FRESVRRMVESCEAVLERTGWDAADVDRLVPHQANLRIMNSVADRLGMPRDRAVVDLDR
FT                   VGNTSAASIPLALARAAAEGTVESGHRLLLTAFGGGLTWGSATLTWPDIKPV"
FT   sig_peptide     complement(412863..412919)
FT                   /locus_tag="Caci_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.688 at
FT                   residue 19"
FT   gene            complement(412969..413247)
FT                   /locus_tag="Caci_0369"
FT   CDS_pept        complement(412969..413247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0369"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: sco:SCO0549
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69322"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACU69322.1"
FT                   /translation="MESYQHVLDTLRVIIEGSVDEVAAGDITADSDLAGELGVDSLAMF
FT                   EIADKAQERWNIKISDDDISRFTTVESLATFIQAAVGAQGLPAMTEA"
FT   gene            complement(413303..414853)
FT                   /locus_tag="Caci_0370"
FT   CDS_pept        complement(413303..414853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0370"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: npu:Npun_R2083
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69323"
FT                   /db_xref="GOA:C7PVG7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69323.1"
FT                   /translation="MTADGMIAFLRQYADDRLDSWLMDERRSLPLSLISHLGSEGLFGL
FT                   RVDRRYGGRELSHTDTFRVIRQAAAIDPNLAVLLAVHNSLGIPPVRDYADEETKQRVLP
FT                   TLATGRGLVTVASSEPGMGSNVVRGMATTAIRQADRSFIVNGKKSWISLGAASSHITVL
FT                   ARLQEPNGRRRGITAFLLPTSTPGFRPRSEAMTIGLRAVPQDHITLDNMRLPPSAVLGA
FT                   EGGGAALAQNSFRMGRAFLAASGTGAMQRCIQLAERFAGRRGISTGRLLDNGVTQRILA
FT                   DCAAATRTVEALVFSLAERLDRGGPVPDEFFFACKVIGCELAGQVVDQCVQLMGARGFV
FT                   DTDIVGKYFRDFRVLRIFEGATEAMSVFVGTRIVRDLESFHTTMVKTFGATKLESDLMA
FT                   GLHDLVERAGSGLTPQQGHVLARAVGDVACWGVTAAAIAETAENSHGDLDVYAAYWAAR
FT                   QLEQRLASARNELRPAFALSANVLARHIAEYADSIGDTQQSYGGERRAVDAFLHRDPA"
FT   gene            complement(414952..415155)
FT                   /locus_tag="Caci_0371"
FT   CDS_pept        complement(414952..415155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69324"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69324.1"
FT                   /translation="MPCKTASAILLTPTMNAPILFDVNETAAHQPSAERHGANGGHDHT
FT                   GVRILKPVRSCHACEKSSKLVG"
FT   gene            complement(415643..416230)
FT                   /locus_tag="Caci_0372"
FT   CDS_pept        complement(415643..416230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69325"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69325.1"
FT                   /translation="MSAPPVLRDVYRTLMAARGDAAASLTFDDGPGPIARLDVFVYRPA
FT                   EPAGLTTFATVGMATAPMPTADGAEGSRAELLLSRSGELAPEDEQQIAMQLANLAVYPW
FT                   KTGRAVGWAQIVGFEQDFPTFPGCPAVFLAGPLLKDTPNWIDTCEGAVQVITVVPITEA
FT                   ERASAASMPPKTFAGNLIEARDVFTAPPVVGA"
FT   gene            416438..418825
FT                   /locus_tag="Caci_0373"
FT   CDS_pept        416438..418825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0373"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein; coagulation factor 5/8 type domain
FT                   protein; KEGG: sco:SCO7015 secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69326"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH0"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ACU69326.1"
FT                   /translation="MTVTRRRFLTTAAAGSAAALLAGPDLLAAPAARAASPAGDVVGKI
FT                   TVGYQGWFACAGDGAPIGGWWHWAQNWAQTPSPSNNVIKAWPDMREYTHAYQTAYSNLG
FT                   NGQPATLFSSYDQQTVDTHFLWMQQNGCDTAALQRFNPNSSEGPTRDAMATKVRSSAET
FT                   HSRKFYIMYDVTGWTAMQAEIKADWTSKMSALTASSAYAHQNGKPVVGIWGFGFNDANH
FT                   PWDAATCLDVITWFKSQGCYVMGGVPREWRTGTGGSRAGYLGVYHAFDMLSPWMVGAIG
FT                   TAADSDNAYTNLTVPDLADCTANNVDYQPCVLPGDLSGRQRVHGDFMWRQFYNMARAGT
FT                   QSVYISMFDEYGEGNQIAKTAENQSMSPNGAGLLALDEDGTACSSDYYLRLTADGGRML
FT                   KGQIPLTATRPTQPVAGSGGGSGNLALGKPASASGTSQNFGPGNAVDGDPNTYWESVNN
FT                   AFPQWFQVDLGSVAAVGSVVMKLPASWGARTQTLALAGSSDGSTFSTLAASAGRTFDPA
FT                   TGNTVTINVGTASVRYLRATFTANTGWPAGQLSEFQVFAPTSGGGGDTTPPTAPTNLAV
FT                   TGHTSSSVSLSWTASTDNIGVTGYQVRVNGTTALTVTKTTATVTGLSPSTAYSFAVVAT
FT                   DALGNVSLPSATVSATTDPATNANLALGKPTSESGHTQSYASSNTVDGDANTYWESVDN
FT                   AFPQWLMVDLGAVTSVSRVVLKLPPATAWAARTQTVAVTGGADASAASTLSASAGRLFD
FT                   PATGNSVTITFPATSVRYVRLTFTANTGWPAGQISEFQVYAS"
FT   sig_peptide     416438..416524
FT                   /locus_tag="Caci_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.471 at
FT                   residue 29"
FT   gene            complement(418891..419883)
FT                   /locus_tag="Caci_0374"
FT   CDS_pept        complement(418891..419883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0374"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: fal:FRAAL3598
FT                   LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69327"
FT                   /db_xref="GOA:C7PVH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69327.1"
FT                   /translation="MDLDLAQVRAFVAAAERLHFGQAAEQLAVSQQALSKRIARLEGEL
FT                   GVQLFLRGGHAVELTDAGRRFLEPARQTLAHGDAAVAAARHVERPLRIDYWGHLFAPMR
FT                   TLAPVIERVGGAVTVETGPGRDLPGVLDALDRSATDVGFGRVHGVGGGVGSGGGGTRDA
FT                   AYTHRLVRLEPVDVVISEDHRLAGQSEVRPAELRDSVLWCPAALNRLDFFQRFAEHFDI
FT                   TAESGTANLGIDRFLEQVAADPVRFALIPADLELPERTRVRSLPLVEPTPLYAWSLVWR
FT                   AADPHPGIEPLLRAFADVAGRSRWLEYQPGRDWLPAGDVSEVWHPAERK"
FT   gene            420005..420925
FT                   /locus_tag="Caci_0375"
FT   CDS_pept        420005..420925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0375"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr3236 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69328"
FT                   /db_xref="GOA:C7PVH2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69328.1"
FT                   /translation="MKAMTATGRTEPSVALTAVDQPQPRPDEALVKVEAYSVNRGETFQ
FT                   LEAPRPGWRPGKDVAGLVVQAAADGSGPAVGARVVGHPPQGGWAEYVAVPTSSLADLPD
FT                   TVPAATAAALPLAGLTALRLLRVTRAAAGSRVLMTGASGGVGHYFVELAAAAGLEITAV
FT                   SSSPERGARLLELGAARVVPSIDAAEGPFDIVLESTGGPNLPAALAKLARRGTLIWFGQ
FT                   ASRQPATLDFFDFFAGPESATIRHFHYADSDSTYGQDLQTLVRLVAADRLHPEIGLVTD
FT                   WTGTADVLTLLRDRGVRGNAVLTIA"
FT   gene            420994..421407
FT                   /locus_tag="Caci_0376"
FT   CDS_pept        420994..421407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0376"
FT                   /product="Limonene-12-epoxide hydrolase"
FT                   /note="PFAM: Limonene-12-epoxide hydrolase; KEGG:
FT                   fal:FRAAL3597 delta-5-3-ketosteroid isomerase- like protein
FT                   (fragment) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69329"
FT                   /db_xref="GOA:C7PVH3"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH3"
FT                   /inference="protein motif:PFAM:PF07858"
FT                   /protein_id="ACU69329.1"
FT                   /translation="MTTITDPKTVVVRYVEAVRDGDTETIVASFAEHATWLYPGNLPIS
FT                   RLWEGRDAIINDFLGGMGAYLDTSAPVVIALVHAFADGDQVLAEWTSKATAANGATYDN
FT                   RCAAVFTVEDGKITSVREYADTHHVAAVLFGEA"
FT   gene            complement(421534..422022)
FT                   /locus_tag="Caci_0377"
FT   CDS_pept        complement(421534..422022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0377"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sen:SACE_5162 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69330"
FT                   /db_xref="GOA:C7PVH4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU69330.1"
FT                   /translation="MMDGMTTTDAWTARRATVREPDAIDLLVSYYDELVSRYWGRPCEP
FT                   GEVDAAMRDEPNDDLVAFLVASVGEEPAGCVGVRMLAPEVAELSRMYIRPQFRRSGGGR
FT                   LLLGEADRAAAELGARAIRLDTRGDLVEARAMYARYGYREIPAYNDSKYANHWFEKTL"
FT   gene            complement(422022..422486)
FT                   /locus_tag="Caci_0378"
FT   CDS_pept        complement(422022..422486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0378"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO7709 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69331"
FT                   /db_xref="GOA:C7PVH5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69331.1"
FT                   /translation="MNATPADPPPPAVEDVATHLRSAVGTLVRSTRAVDRIAPIPAAVL
FT                   DLLAARGPMTTADLASSRGVRHQTMAATVKDLADAGFLSAGPDPDDARKKILALTEAGR
FT                   HALDADRRQRTVLLAAALDQALDADELRVLARALDLLDRVSVAVNQMTAT"
FT   gene            422561..423196
FT                   /locus_tag="Caci_0379"
FT   CDS_pept        422561..423196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69332"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH6"
FT                   /inference="similar to AA sequence:KEGG:SCO7708"
FT                   /protein_id="ACU69332.1"
FT                   /translation="MQLIKHAHACVSLVGDQGRIVIDPGTLTPDAAAAVAAAEAVLITH
FT                   EHFDHFDEDMLAKALDARPELRVYGPASVVGRWEARRGQVTAVAAGDRHAVAGFDIAVF
FT                   GELHALIHRDVPRVTNVGYLVDEKLYHPGDAYHVPEAPVETLLLPTSGPWTKLGEAVDY
FT                   VREVAPKQAVQIHELLLAEVGQQAAKTMIGNLTEAAMAIVPVGEAITV"
FT   gene            complement(423278..423928)
FT                   /locus_tag="Caci_0380"
FT   CDS_pept        complement(423278..423928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0380"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_3047
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69333"
FT                   /db_xref="GOA:C7PVH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69333.1"
FT                   /translation="MVQTETGTPRQRYRAQVQEEIKQHAWEQIATAGASALSLNAIAKQ
FT                   MGMSGPALYRYFANRDELITALIRDAYQSMADAMRAAVADGAGLRGLARTLREWALEDP
FT                   QRYLLIYGTPVPGYQAPEDTTRLANDVMALLLDASSAEGLGALPPSPVQTHLEQHSPWA
FT                   GAHAGEGTTLHRAVILWTRLHGVLSLELAGHFAGMEFDPALLYAAEVEAVAGY"
FT   gene            424024..425055
FT                   /locus_tag="Caci_0381"
FT   CDS_pept        424024..425055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0381"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV_1467 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69334"
FT                   /db_xref="GOA:C7PVH8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH8"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69334.1"
FT                   /translation="MTDQTLVQVVLPGKVEPEDLQVQHAAVPQPAVGQVVIAMEATGVS
FT                   FAEQQMRRGRYFDQPPFPFVPGYDVVGRVYAVGAGVDPGLLGRRVAVLTKVGGWASHVL
FT                   ADARDAVEVPEGLTAEQAETVVVNGITAWQMLHRRARVKAGQTVLVHGVNGGVGSVLAQ
FT                   LAMAAGATVIGTASARHHDALRAAGILPVDYRAGNVPEQVRALAPHGVDAVFDHVGGRS
FT                   VIDSWHLLAPGGTLVSYGSASTRDDSGWKQWPVLKILARTTLWTLLPNGRSASFFNIWA
FT                   GKKLNQDRFRARLRADLTEVFAALGRGDIVTTIAARLPLAQAGEAMRLAESGTVAGKII
FT                   LTP"
FT   gene            425100..425504
FT                   /locus_tag="Caci_0382"
FT   CDS_pept        425100..425504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0382"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   ana:alr3729 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69335"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:4H3U"
FT                   /db_xref="PDB:4HVN"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH9"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ACU69335.1"
FT                   /translation="MTTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGRE
FT                   QISGWKARTDAMIENVHVTITKAYRAGDHVTIEAVYGGHIKGAPTPFAVPMATLLRTRG
FT                   EEITSDQDYYSLSSVLAQSGLPADWTPSDS"
FT   gene            complement(425684..426577)
FT                   /locus_tag="Caci_0383"
FT   CDS_pept        complement(425684..426577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0383"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sma:SAV_7306 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69336"
FT                   /db_xref="GOA:C7PVI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69336.1"
FT                   /translation="MQFHQLRYFIAVAETRHFTRAAEALHVTQPSLSQQIRALEHELGA
FT                   DLFLRARGNITLTDAGEALLPMARRILADADAARREVQELAELRRGHVRLGATPSLCTG
FT                   LLPDVLRTYHRRYPGIQLLVQESGSHDLVRDLARGALDLALVVLPLPSPSPALTTEELL
FT                   REDLVVVSAPNLPPPGDGRQVRIADLEHEQLIMFRHGYDLRDLTVAACRAQGFEPVFAI
FT                   EGGEMDAVLGFARAGLGVAIVPSMVAQNVDPSLRVTPIAPPALHRTIALAHRTDVALPR
FT                   AAQEFRRTLLERTTAE"
FT   gene            426686..427390
FT                   /locus_tag="Caci_0384"
FT   CDS_pept        426686..427390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0384"
FT                   /product="succinate dehydrogenase (or fumarate reductase)
FT                   cytochrome b subunit, b558 family"
FT                   /note="TIGRFAM: succinate dehydrogenase (or fumarate
FT                   reductase) cytochrome b subunit, b558 family; KEGG:
FT                   sco:SCO0924 cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69337"
FT                   /db_xref="GOA:C7PVI1"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI1"
FT                   /inference="protein motif:TFAM:TIGR02046"
FT                   /protein_id="ACU69337.1"
FT                   /translation="MVTATWTDRRPPSLRTAWDSSVGKKTVMAVSGLVMVLYLLAHAFG
FT                   NLKVFFGPGQFDSYAHWLRTMGEPVMHYSWTLWVIRVVMVLAVVAHTVSAYQLSRRDIR
FT                   ARPVRYEHRKAGSSYATRTMRWGGIILGLFIIWHLLDLTTGTVHSGFQPGHPYANVVST
FT                   FNHWYGDVIYIVAVCALGLHIQHGFWSAAQTLGVGSAKRDRLIKTTGNVVAVLLTLAFV
FT                   AVPVGVMSGVVK"
FT   gene            427387..429336
FT                   /locus_tag="Caci_0385"
FT   CDS_pept        427387..429336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0385"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="KEGG: sco:SCO0923 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69338"
FT                   /db_xref="GOA:C7PVI2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI2"
FT                   /inference="protein motif:TFAM:TIGR01811"
FT                   /protein_id="ACU69338.1"
FT                   /translation="MTDYTDYTVGDPIADAKAPAGPISERWDTRRFEAKLVNPANRRKR
FT                   TVIVIGTGLAGGSAGATLAEAGYHVVQFCFQDSPRRAHSIAAQGGINAAKNYRNDGDSV
FT                   HRLFYDTVKGGDFRSRESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQV
FT                   SRTFYARGQTGQQLLLGAYQAMMRQVAAGNIELHARTEMLDLIVVDGRARGIVARDLLT
FT                   GEISTYFGDAVVLASGGYGNVYYLSTNAMNSNATAIWRAHRKGAYFGNPCYTQIHPTCI
FT                   PRTGDHQSKLTLMSESLRNDGRIWVPKAKGDSRSPDAIPEDERDYYLERQYPSFGNLVP
FT                   RDIASRAAKNVCDEGRGVGPGGQGVYLDFADAIKRLGRKAVEEKYGNLFEMYQRITDED
FT                   PYRVPMRIYPAVHYTMGGLWVDYDLQTTVPGLFAVGEANFSDHGANRLGASALMQGLAD
FT                   GYFVLPATISDYLARHAGDVPVTADHPEAVAAVRETQERLDAILAVDGDRTPDSFHREL
FT                   GELMWELCGMARDEAGLRKALDQIPAIREEFWRRIKVPGTGEEFNQSLEKANRLVDYFE
FT                   LAELMCLDALHRGESCGGHFRTESQTPDGEAARKDEEFSYVAAWEYTGLGQAPVLHREE
FT                   LDFEYVHPAQRSYA"
FT   gene            429333..430082
FT                   /locus_tag="Caci_0386"
FT   CDS_pept        429333..430082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0386"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; ferredoxin; KEGG: sco:SCO0922 succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69339"
FT                   /db_xref="GOA:C7PVI3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACU69339.1"
FT                   /translation="MKLTLRVWRQENASRPGRMQPYEIDGVSRDMSFLEMLDVLNEKLI
FT                   LDGEDPVAFDHDCREGICGACSLMIDGEAHGPEKKTTTCQLHMRSFRDGATIDVEPWRA
FT                   AAFPVVKDLVVDRSALDRVIQSGGYITAPTGAAPEAHATPIPKPAADLAFENAECIGCG
FT                   ACVAACPNGSASLFTAAKINHLNTLPQGAPERETRVLTMLQQTDAEGFGGCTLTGECAT
FT                   ACPKGIPLASIAAMNKEWLRAQRKASR"
FT   gene            430499..431446
FT                   /locus_tag="Caci_0387"
FT   CDS_pept        430499..431446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0387"
FT                   /product="sugar hydrolase"
FT                   /note="KEGG: sma:SAV_5252 sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69340"
FT                   /db_xref="GOA:C7PVI4"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI4"
FT                   /inference="similar to AA sequence:KEGG:SAV_5252"
FT                   /protein_id="ACU69340.1"
FT                   /translation="MPRTVRKSLIAGAAFLLPAAAVGVAAGASTAAAATHAASFPAHYS
FT                   APYLQISSSDAKDMAADMAASGDKFYTLAFLTPKSGCTPEWEDGGDSVGAFSSQITALQ
FT                   NAGGNVIISFGGAEGGELAQTCTSVSSLEAAYAKVVSTYHVTRLDFDIEGSVLDNKTAN
FT                   SRRDQALAALQKANPAVQVDFTLPVDPTGLESNATALLSDAKSKGVAVNLVNIMTMDFG
FT                   DGQNALKDAESGANATVPQLEKVFGVSSTKAWNMLGLTPIAGKNDDNENFTQANASTLE
FT                   SFAASKGVQELSFWEVDGYDKGVGYAYSKIFNKI"
FT   sig_peptide     430499..430612
FT                   /locus_tag="Caci_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.464 at
FT                   residue 38"
FT   gene            431687..431824
FT                   /pseudo
FT                   /locus_tag="Caci_0388"
FT   gene            431849..435232
FT                   /locus_tag="Caci_0389"
FT   CDS_pept        431849..435232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0389"
FT                   /product="WGR domain-containing protein"
FT                   /note="KEGG: stp:Strop_2883 WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69341"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI5"
FT                   /inference="similar to AA sequence:KEGG:Strop_2883"
FT                   /protein_id="ACU69341.1"
FT                   /translation="MSGATNAPTAVSEDTCQIPGAMRRLVIPRRGDVPSEPVAVDPKAA
FT                   AYYAAWFDEQSPIVAGIVDHGHSEADLVEEYRASKGDLVIATPLAAAVAAAMTISQSTP
FT                   AYENPAGIVDAWIATRGLAFAAAAAVELFGVKTSGRTSKGEQASAWLCRKDGAYEDIPH
FT                   GIAVRVRQHLASAGEQDYAEVADVLARYRLSLASPTTSGQVLSRMLTSFLTPENVDWVE
FT                   SDFAFVSRAHYSAWLALASITTEEQVAALPAQKISAWGIARELSALWTALDNVGVHLLP
FT                   VLTGWLAPESDPESVQRLLSIVAGIASADAFRYLVDNIDKKYFTVATQNAATTFPRRAL
FT                   QILGDAALRDTPRGLAAANVLRLHIVAHDELVQDELANLTPAVRDHVEKIRAANVPVPD
FT                   AETDSLPTLFVSPPWLTAVKPARPVVITGLEAPTETVLAWRDGEKEQWASAELITNPQW
FT                   KLESWKDIADRISTGGSAGWYANGHFAVEAPEDLVRSVLTSWEPDSWQSDTWIPTLVMR
FT                   FGADALPPILSLARSVPASGAVFLAPFEAPEVALLAADWLSRLKTARPFALAWLTRHPG
FT                   FAARTLIPAALGKAGKARSAAELTIRTLAARGFTAEITEAAAGYGDAVAQAVAAIVADD
FT                   GTLTLPKTMPAVPDWAETRLLPQILLKGRQTALPEQSVKHLLLMLAVSKGTEPYAGIQM
FT                   AKGICDPASLATFSWALFENWRGVDYPAKESWAFDALRWFGDDETVRRLSPMIRLWPGE
FT                   NGHQRAVAGLDVLADIGGTVALMHLYGISQKVKFKGLKEQATQRVTEIADDLGLTAEQL
FT                   GDRLVPDLGLASSGTLSLDYGPRSFTVGFDEQLKPYVADQSGKRLKALPKPGAKDDQEL
FT                   APAAHQQFSALKKDVRTLAASQIARFELAMVTQRRWTSQEFGEYFVGHPLLRHLVRRLV
FT                   WVTFVDEKVGSAFRVAEDLSLADIADDEFTLADDAVIGVAHPLHIGGDVAAWSDVFADY
FT                   EILQPFAQLGRTVFAFTDAEKASTRLTRFGGIETPVGKVLGLERRGWRRGAPQDAGIQG
FT                   WISRALLGGGSVTATLDPGITVDYVAEWGETQRLQEVFISRHADGESYWNASAKFRELG
FT                   SLDEITASELLRDLTEATTQ"
FT   gene            complement(435538..436866)
FT                   /locus_tag="Caci_0390"
FT   CDS_pept        complement(435538..436866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0390"
FT                   /product="Putative cell wall-binding domain-like protein"
FT                   /note="KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69342"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI6"
FT                   /inference="protein motif:COG:COG2247"
FT                   /protein_id="ACU69342.1"
FT                   /translation="MATTAHAGTAPHPAVAMAAVNVPAPPSGVSRISGGDRYLTGVQVS
FT                   QSQWADAGGDATGRAPAQAVVLARGDTFPDALSGVPLAAKVHGPLLLTTPAALSAGTAA
FT                   EIRRVLGPGAGQPVYILGGTGAVSPSVEAQLVRDGYAVTRYQGSNRYQTALDVARRGLG
FT                   DPARIVVATGDGYADALAAGPFAAGPDAVGGVPAAVVLSDGRSLDPATAAYVSGKLAAA
FT                   APGDCNAVTTVGGQAGTAVQAVTPAGSCTNPLAGADRYATAVAVAQQFPAGTSVGVATG
FT                   GGFADALTGGAAMAALGRPLVLTDPAVLGDNPRLWLVGAHQGGVGATAVFGGPSAVGGE
FT                   VFTQLQDIANGGAGLPTNALCGAPANPYGFNYCGVGSEVTVKAVPAAICSYFSCIGTDS
FT                   AHTSFWRGLGYLEVCDDGDISLSGGRSGACSSHGGENHPVWKR"
FT   gene            complement(437082..437510)
FT                   /locus_tag="Caci_0391"
FT   CDS_pept        complement(437082..437510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0391"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   ace:Acel_0050 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69343"
FT                   /db_xref="GOA:C7PVI7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI7"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU69343.1"
FT                   /translation="MRIPLIKTLLSLAGTVGTMGGLLAMKTSAHGLAPQPLQAAKVVHD
FT                   RTAGATMTVTGPAIPVTHGIVQVRITLTDGHITDVSATSLPHDNDDSWTRSVTAAMVLD
FT                   REVIAKQSAHIDGVSGATYTSKAYKASLQAAIDAGYRH"
FT   sig_peptide     complement(437421..437510)
FT                   /locus_tag="Caci_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.558 at
FT                   residue 30"
FT   gene            complement(437531..438940)
FT                   /locus_tag="Caci_0392"
FT   CDS_pept        complement(437531..438940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0392"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding 8 domain protein; Ferric reductase
FT                   domain protein transmembrane component domain; KEGG:
FT                   fal:FRAAL0548 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69344"
FT                   /db_xref="GOA:C7PVI8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69344.1"
FT                   /translation="MVQGWSAGFEVPYDPDWVVPRRDWRHSLPLLPRRPLSAVLLAVLA
FT                   AGIAGLLALWWQETPADRMQSLPDYLVMLAQITGLVGAYLLLVEIALMARLPWLEHRLG
FT                   SWLASAHRSLGGYLVLLLCAHVGFVIAAYSVSVHDSPPAVLVSILRTYPGVLAATIGFL
FT                   VMLLAGFTSARSIRRRLGYEGWHAIHLLMYPAAAAAFWHQITLGAQFTRNPWAADVWVG
FT                   LHAVVGAAIVCNRIVIPLLNNRHHRFRVSRVEAVGPDAMNVYITGRRVADLGAEAGQYF
FT                   RWRFMQRSLWYQAHPFSLSAAPHADTLRLTFKCVGGYTRRLKRRLRPGSRVFLDGPYGA
FT                   FTGVLRRQPGVVMIGGGIGVTPLRAIVETMHNRRRNDIIFIQRASKVGDLILTNELEAL
FT                   NAVGRIIYIPAIGSRRNDPLSADRLLDLIPDLEFREVFICGSVGMAAAAVRNLRRAGVR
FT                   RGRIHTEIFDF"
FT   gene            complement(439201..439677)
FT                   /locus_tag="Caci_0393"
FT   CDS_pept        complement(439201..439677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0393"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mxa:MXAN_2836 Aha1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69345"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI9"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACU69345.1"
FT                   /translation="MTTQKIQIERTYPAAPEKIWELWTTAAGIESWWAPEGFDVHVETL
FT                   ELKPGGALVYTMTAVGPDQVAFMEQVGLPLSTTSTKAFTEVEPVRRLAYTSLADFIPGV
FT                   EPYDFLTEVELRPTADGGTHVVMTADAMHDEEWTGRLSAGRTNEMDNLGKVVGE"
FT   gene            complement(439714..441039)
FT                   /locus_tag="Caci_0394"
FT   CDS_pept        complement(439714..441039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0394"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   saq:Sare_2937 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69346"
FT                   /db_xref="GOA:C7PVJ0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ0"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ACU69346.1"
FT                   /translation="MKARSCQVCGAALSDRGRGRTSVYCSAACRQRAYRLRHTTADQSA
FT                   ADVLAEIERQVRTLALRPPQSFRTDADALATTVRRLRRLAQNVTPEPVTKSAAEEQPPQ
FT                   LAGEPGFAALVEPHRKWLHLHCYRMAGSYDDAEDLVQETLLKAWRDRSGFEGRAAARTW
FT                   LYRIATNVCIDHLRRTGRRPQRYESTATSGAAEPPERMAWLQPYPDQLLDEAVAEDEHP
FT                   EAAAVSRETMELVFLATLQHLPPRQRAVLIFRDVLGRPAEETATLMDMSVAAANSALQR
FT                   ARQTLRERLPQRRTDWTRGDHSRQEQEIVRRYMAAAERSDVSMMADLLSADVLVTMPPN
FT                   PVWFAGRDALLTQIGPLFDRTSPGYFGRWRHLPVGANRLPAVAGYVQRPGTSVFRAQMV
FT                   DVLRIEAGQIMEITTFEAHLVAAFGLPLTLPMTDRPGARPTL"
FT   gene            complement(441225..441893)
FT                   /locus_tag="Caci_0395"
FT   CDS_pept        complement(441225..441893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69347"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ1"
FT                   /inference="similar to AA sequence:KEGG:SAV_696"
FT                   /protein_id="ACU69347.1"
FT                   /translation="MQKFETPSPVTVVLDIPAGQIRLVAGERADTVVEVLPSEASKRRD
FT                   AKAAAQTTVEFSGGVLRIATADPHKILGSSGSLDVTIALPAGSRIEGKAGAAELHSTGR
FT                   LGEVAFDGGYRSVELDEVAGARIKMHMGDVSIAKLTGPAQLRNGKGDITVAEAAGGAVD
FT                   LRTDMGDLKIAAAPGVSGTLDASSASGRITNALKNSEGAGAGLNIKATTSHGDIIATSL
FT                   "
FT   gene            complement(442044..442469)
FT                   /locus_tag="Caci_0396"
FT   CDS_pept        complement(442044..442469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0396"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   sma:SAV_4279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69348"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ2"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACU69348.1"
FT                   /translation="MSISLVQAEAVVAAARVGADERGVAVAFAVVDAGGNLVAFARGDG
FT                   ANLITVDTAIGKAFTAISIGADSINLTAAIQPGGPLFGTGLVLAGARSFVPYGGGVLIR
FT                   VDGRVVGALGIAGAASSEVDHEIAAAAAVQVPVRVAA"
FT   gene            complement(442903..444330)
FT                   /locus_tag="Caci_0397"
FT   CDS_pept        complement(442903..444330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0397"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sma:SAV_4421 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69349"
FT                   /db_xref="GOA:C7PVJ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACU69349.1"
FT                   /translation="MPLSGDGQQTQGQIGARLQEVRTRRGLTQRALAEPGYTAAYVSTL
FT                   EAGKARASEAALRYFAERLAISYEELATGVPAGLRAEIRDGLAEANAAMDAGRAAEAEA
FT                   LLAALLERAAGNDVPDLAADVRVALGAFLLRRGDLAAGREQFEQAEALLADRPLVARVR
FT                   AIRGRATAYYLEGDVRYSCYLLENTISELNGGGLPDPASLVLLYAAVIGPYLELGALER
FT                   ATKAATLALDLAPRVADPIAVATLHRSVARTLAAGGRFDEAEAALVKAQDVYQQWEIRA
FT                   ELAQCHWMRGYLYAQHERFADAETELRTAATMLRAADAVFYAVQVEVELADVRWRLGHT
FT                   DEAEHLLTRLLADLGPGHGAVHAAAAHRLLGLIRERADDPQTAERHYRQAIELQQDADV
FT                   AGDLADTSRLLGDLLDKQGRTREAVAAYRNGLTALARPGTTTLGAAPLPPPVISALDSV
FT                   HRAVHVVPGGGDSAAHE"
FT   gene            444478..445764
FT                   /locus_tag="Caci_0398"
FT   CDS_pept        444478..445764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0398"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7423 prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69350"
FT                   /db_xref="GOA:C7PVJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69350.1"
FT                   /translation="MPPAIRQTDHLFTVPLHHDRPRGEQIELYAREVTADETLPWLVFL
FT                   QGGPGHRSPRPLPAALATGWLSRALQDYRVLLLDQRGTGRSTPATRQTLPSRGDARRQA
FT                   EYLTAFRADSIVRDAELVRRQLTGGAPWSVLGQSFGGFCTISYLSDAPEGLAEVFITGG
FT                   VPTLEGDADDVYRAAYPRMEDKNALLYHRYPQDVDIARSIAEFLREHETVLPDGTLLTV
FT                   EAFQSLGIMLGATDGVDRLHYLLEDPFCQTAHRTELSDRFQWQVQAALSFAERPLYALL
FT                   HEAIYAQGSGPTAWAASRVRKQFPRFDAERVLSETGTPLLFTGETIHPWHFRTDPALRP
FT                   LRAVADLLAGYEDWRPLYDTSVLAANTVPTFATVYTDDLYVDPKQSLTTADAIRALTVH
FT                   VSDDHEHDGLTASGTDVLDHLLGMARDAR"
FT   gene            445809..446606
FT                   /locus_tag="Caci_0399"
FT   CDS_pept        445809..446606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0399"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   gvi:gll1344 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69351"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ5"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69351.1"
FT                   /translation="MPAQALRALLGNLRTRIAAAAVSAAALGAVVVLPASSAHAAQCWY
FT                   GSCFSYVTGRQYTNTTGASVTMEQAAPRNVAADGHSLQELSLQTSGGTTVADTIEIGWT
FT                   VDPELNGDYQPHLFVFHWVDGQPTCYNACGFVQVSTTVRAGMAVTPGTTGVFALRYYQG
FT                   NWWAYYNNVAFGYFPGSAWKGAFTSAQIVSAFGEVASDSAPSCTQMGDGIYGSQSGASS
FT                   ISGYQLYGSTDRPALTVTATDPGSYNYGAVTGTSFNLGGPGAC"
FT   sig_peptide     445809..445931
FT                   /locus_tag="Caci_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 41"
FT   gene            446596..447435
FT                   /locus_tag="Caci_0400"
FT   CDS_pept        446596..447435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0400"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69352"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ6"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69352.1"
FT                   /translation="MLAKVRVGLVSGLFSMSLLGSTAAAAVPAASAAVLAPRVPTVSAA
FT                   ATDSGPICWYGACYDYVSGHQWTDTTGVSVLMKVEKPVVNPAQTGEHSLQEIALQNTAR
FT                   TSTVEIGWTVDPELNGDNQPHLFVYHWVDGQESCYNACGFVQVSRAIKPGMALHPNEAA
FT                   NFATQNIHGDWWVFFRDEPVGYFPGSLWSGTYQTAQLVSVFGEVAENTADSPSCTQMGD
FT                   GRFGSSPAASWIRDYRIAGTKDAPNLAVSSTSPNHYDAGAVTPTSFKLGGPGTGACS"
FT   sig_peptide     446596..446694
FT                   /locus_tag="Caci_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.399 at
FT                   residue 33"
FT   gene            complement(447462..448199)
FT                   /locus_tag="Caci_0401"
FT   CDS_pept        complement(447462..448199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0401"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_4255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69353"
FT                   /db_xref="GOA:C7PVJ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69353.1"
FT                   /translation="MTNAKTEMAKPQVAAPAAPRPLRRDAERNRQLIIDTAKTVFAARG
FT                   LDASLDEVAHEAGLGVGTVYRRFPNRDALIDALFDDMLASITRIVAESMALPRAWDGLV
FT                   HFMTAMLESQGRDKALRDLMLSRQKYLDQCELDREEVVRETVQPALYDIIGRAKAEGDL
FT                   RPDVVPADVGVLLISAVGVVDFTAPADPEVWRRHLAVLLDGLRARAAGDTTVLAPAPLD
FT                   DEQLDLCMSGWKYGTRETPRRRS"
FT   gene            448361..449890
FT                   /locus_tag="Caci_0402"
FT   CDS_pept        448361..449890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0402"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69354"
FT                   /db_xref="GOA:C7PVJ8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69354.1"
FT                   /translation="MADLRTTGAEAQTADAAPADHTDHTDPHHARRWFILGIIGLAQLM
FT                   IVLDVTIVNIALPDAQKALGFSNGDRQWIVTAYSLAFGSLLLLFGRVSDVIGRRAMFLI
FT                   GLVGFAAASALGGAAPNFEILVLARALQGVAGAMLAPAALSLLSTTFTEAKERATAFAV
FT                   FGGIAGSGAAIGMLLGGVLTEFLNWRWTLFVNVGISVIAIAGAAVLIPRHARSADRPSL
FT                   DIPGTVLVSAGLFGIVYGFANAESHPWSAPGTWGFLVAGLVLLGAFTFWQTRTKHPLLP
FT                   LRVILERNRGGSYLAMFLTGIGMFGVFLFLNYYLQEILRYSPVMTGVAFLPMVAALMIT
FT                   ATISTTQLYPRVGAKILVFAGMLLAGAGMVWLTGISLTSSYAANILGPTVVVGIGMGAI
FT                   FAPAMNAATSGVEAGDAGVASAMVNTAQQIGGSIGTALLNSLAASALTSYLVGKNATNP
FT                   VVQANAAIHSYVVAFWWAAAIFGVGAIICGLILKSGKPDPADPDAAPAIHA"
FT   gene            complement(449980..450621)
FT                   /locus_tag="Caci_0403"
FT   CDS_pept        complement(449980..450621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3956
FT                   TetR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69355"
FT                   /db_xref="GOA:C7PVJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69355.1"
FT                   /translation="MPSTLSTDDREVEGTLDFVRLTDMAPARTLRADAARNREKLLSAA
FT                   TRLFAERGLDVPMEHIARTAGVSIGTLYAHFPTRVALFEAIFPTRLAALQELGRKALAE
FT                   PDAWQAFVGYLQDVFAMHAEDHGLNEVLARDIPDAAGVVQSCRQGAGHAAELIDRAHAD
FT                   GRLRADFTITDMSTLTRAMTRVIRDSINGGTDEWRRFLGIYIDGLRAENP"
FT   gene            450664..451374
FT                   /locus_tag="Caci_0404"
FT   CDS_pept        450664..451374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0404"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: fal:FRAAL2466 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69356"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69356.1"
FT                   /translation="MPTAVVIGVGPGLGMSIARRFGGAGHSVALVSRSDARHADYLAEL
FT                   ASAGIESEAFVADVNDREQVGSVVDAIEAKHGIDVLYYGPGASDVSQPAPITETTADEV
FT                   RASMGVVYAAVDIVGRVLPGMMARGRGGLLFAGGLSAVVPVPSLGALAVTSAALRNYAL
FT                   TLNAGLADTGVYAGTLIIGGLIERGDIHGFVVAHPEMFGHVPLRTLNPDDIAAAAWEMY
FT                   AARDRAEETFSVLS"
FT   gene            complement(451736..452164)
FT                   /locus_tag="Caci_0405"
FT   CDS_pept        complement(451736..452164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0405"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: sen:SACE_3470 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69357"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK1"
FT                   /inference="similar to AA sequence:KEGG:SACE_3470"
FT                   /protein_id="ACU69357.1"
FT                   /translation="MAELWDPAADGVLHLPSGRLIRGRGLSRPMPDGPAPSFAVYLLGK
FT                   QPPDVSWESRWVRWPDFRLPADRAAARECFVEAWQRCETERVEVACAGGRGRTGTALAC
FT                   IAVLDGVAPDAAVAYVREHYSPHAVETPWQRRFVAAFR"
FT   gene            complement(452188..452937)
FT                   /locus_tag="Caci_0406"
FT   CDS_pept        complement(452188..452937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0406"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: gdj:Gdia_2872
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69358"
FT                   /db_xref="GOA:C7PVK2"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK2"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACU69358.1"
FT                   /translation="MSASILWEEPTGQGWTQVGELTTALVLSSAIGLEREIRQKAAGLR
FT                   TYTIIGLGAALFMLVSKYGFTDVLRPGLVQLDPSRVAAQIVSGLGFIGGGVIFMRRDSV
FT                   RGLTTAAAMWLTAGVGAAAGAGLGLLALLTTVAYFVVCYGLRPLTHWMPALRTPPVTYR
FT                   IEYQDGRGLLRTILDICTGAGFFVASFSGTGHDERDAQREPGAHPHTVEVVLTLHGRGN
FT                   ANALTEQLVDTSGIVAVAYNHEDDEFT"
FT   gene            453076..453852
FT                   /locus_tag="Caci_0407"
FT   CDS_pept        453076..453852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69359"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK3"
FT                   /inference="similar to AA sequence:KEGG:Franean1_1635"
FT                   /protein_id="ACU69359.1"
FT                   /translation="MKALRKPERHAARQAWRMPGADLDRMFTLVRAVGQVELKFTVADA
FT                   SFDAVRGLLGVGVERVRNVYYLDTPDLTLRRHGVLARVRGGQRPNDSVVKLRPIDPGRV
FT                   PTAMLRCEDFTVEVDVTPDSFICSGALKQRLPGNAVERAVAARTPLRTLFSEDQIALLD
FT                   SRLSGRLTIDDLDPLGPVEVHRTRPRDGEPGRGLELQEWLYPDGSLLLEVSTRCTATDL
FT                   LQTAIQAKALLDEHGIQQAGPCPTKADTTLDYFTRQ"
FT   gene            complement(454259..455722)
FT                   /locus_tag="Caci_0408"
FT   CDS_pept        complement(454259..455722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0408"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6391 drug/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69360"
FT                   /db_xref="GOA:C7PVK4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69360.1"
FT                   /translation="MPQTDSLARDAERVGSGAEARFDSDARSGSGSGSSSGSARSVGSP
FT                   KLTLFAALLGFVMIALDASAVNVALPAVGRGLGGSTAGLQWIVDAYTLMFAALLLSAGA
FT                   FSDRLGASRLYGGGAAAFTLASVACGLAPSLGFLIGARLVQGSAAALMLPSSLALVRQA
FT                   FPDASARAAAIAQWTMAGAASTAVGPVLGGALTSSVSWRSIFFLNLPVGLVILGALRRT
FT                   ERSVRRPAPLDLPGQLTAIVGLAALTYGVISGGASGFGRPQAWASVLLALVSFGAFGVV
FT                   EHRATEPMLPLGLLRDRVVAVCLAVGFVVNAAYYGLIFVFGLFAQDILGRSAVGAGLVF
FT                   MPTAILCTITNLFSARAAARWGARTPVLVGQLACAAGLLVLLLVNTHTSALELALLLLP
FT                   LAGGLGFAVPSLTAMMLSGIAPERAGLAGGVLNSFRQTGGALAVAGFGALVAQHGGFVT
FT                   GLHVSLLISVALLAVTTLGTLALPKVGRR"
FT   gene            455920..456831
FT                   /locus_tag="Caci_0409"
FT   CDS_pept        455920..456831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0409"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: art:Arth_0445
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69361"
FT                   /db_xref="GOA:C7PVK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69361.1"
FT                   /translation="MTEQQPELGRFLRARRAGVAPADLGLPLGTGTRRTPGLRREELAA
FT                   LAGVSIDYYIRLERGKETRPSPAVVDALGRALRLDPEELAYLRELAAQAARGGAPTRQR
FT                   PAASRAVRPTLRRLLETVRPCPAYVLSRTNDVLAANPGGLFLTPGMVDWPEKKRNTIRY
FT                   TFLHPQARTLWPDWDIKARACVAHLRAVAGTDPDDPELAAIVGELAVKSPEFSHMWERY
FT                   DVRRVGNGQKTFLHPIVGTMTLCHEVMEINHTGGGRIVVYSAEPGTPDHDAMVLLDMEA
FT                   ATALASRSNASGAVSVDADRDG"
FT   gene            456966..458864
FT                   /locus_tag="Caci_0410"
FT   CDS_pept        456966..458864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69362"
FT                   /db_xref="GOA:C7PVK6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69362.1"
FT                   /translation="MSAGTAVPDAAESVGELKPSRRSRRSAPDFASSLLRRDVFGVRLG
FT                   VLLLILPVILAGLGMQLTSRQGWNHPPDSRYYVAMMARDVGYSWSHSIHAELRVQPDNH
FT                   LSPWYFADNDPTWQMVRTRLLYPVLSVPFIWMWGLSGGSMAVPVLGTVLFLWATARLLQ
FT                   RLYGPAIAVIVAGGFSLTVPVNGFTWAGTDTLALGLAAVLVLNLPIERRIGKANLVWIG
FT                   AASIFIALTRQVGVLAPAMAGAGWLWLLVRERQWRNRWLGSLIVTAATTFLFQVLSMTL
FT                   APANTAGVIGHGETSYWGIFREFVHYLRIVTEEACTYMWHNDRMLYALFIAAGISVLAR
FT                   FKSDATAVFVGAVGATYVITAGVGFSGFMRYEMVMFPAAAVAAGQLVQLALGDHVRQPV
FT                   GAVAELEPAPTRTRTWFSDRFAALALTKPGRFLGLNLQRQDRWKPQLLFNSLVLAIVIG
FT                   VSLDGSWSSTVNAPASPSYAAAQGGSGYAVPPLAKPSADQTLRIMFAQAIGIAHGSAQL
FT                   QGALDWTHAMQYRPMAPDQPGWPNRAKDGTAVVNPNSMGMDIDMSEAYGRGLSLNSTVK
FT                   PDSVKILSRQVSEYGEDVVFTVEDTSGKVHQGTATTLYPIWHKNDPATVTALVFDA"
FT   gene            complement(458870..459403)
FT                   /locus_tag="Caci_0411"
FT   CDS_pept        complement(458870..459403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_4855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69363"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK7"
FT                   /inference="similar to AA sequence:KEGG:SACE_4855"
FT                   /protein_id="ACU69363.1"
FT                   /translation="MHELKALLREYDRARAYTDDLWTDLTPDEVTWRPHEESSAIGWHL
FT                   GHQAHVAHFMIRNLTAAEPSPDPELDELMDSANPEKFRGALPTVERLTTFRNTVAQRVH
FT                   ARIGAIADGQVGAPSQMTIVGSYLLVALINHEYQHDQWIGEVRAQNLGHALPADPTADG
FT                   LRRVDGYLVLEPLG"
FT   gene            complement(459406..460905)
FT                   /locus_tag="Caci_0412"
FT   CDS_pept        complement(459406..460905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0412"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69364"
FT                   /db_xref="GOA:C7PVK8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69364.1"
FT                   /translation="MSHLQTTSLGPNAAHDPHDPHGEHAPQHARRWWILAVICLAQLMD
FT                   VLDVTIVNIALPDAQKSLDFSVGDRQWIVTAYSLAFGSLLLFSGRVSDLVGRRRMFLVG
FT                   LVAFAAASALGGAAPDFGVLVTARAVQGAAGAMLAPAALSLLSTTFTEPKERAKAFAVF
FT                   GGVSGSGAAIGMLLGGVLTEFLNWRFTLYVNVAIAVVAFIGAATLIQRRNETQSEIGER
FT                   PKLDLPGTILVSAALFGIVYGFADVESHAWTAPSTWVSLTSGVVLLGVFAWWQRQAANP
FT                   LLPLRIVLDRTRGGSILAIFLGSIGLFGAFLFLNFYLQGVLHYSPLMTGVAFLPMVVTL
FT                   VIAGGICTTQLYPRFGAKLPVTAGMLIAAAAMVLLTDIGPHSTYAGTVLGPLLVFGLGI
FT                   GATIAPAMSAGTADVEPRDAGIASATVNTAQQIGGSIGTALLNSLAASALGRYLVGKDA
FT                   ASHAVQTDAAIHSYSVAFWATGAIFAGGAVVCGLVLRRGKP"
FT   gene            complement(460925..461656)
FT                   /locus_tag="Caci_0413"
FT   CDS_pept        complement(460925..461656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0413"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: amr:AM1_3890 oxidoreductase, short
FT                   chain dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69365"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69365.1"
FT                   /translation="MTVKTALITGTSRAAGLGFAVARELAEQGFHVILTARDRAAAEPL
FT                   AEQLRLDGHAATALRLDLSDRASMDAVAKHVAETFGHLDVLVNNASGMPDFQVLSALEA
FT                   DMDTVRAALEVSVIGPWGLVEAVLPLLKAAPAARVVNVSSLSAQQIATGLNLGAPLRSP
FT                   AYSMAKYMLNALTSVLARALADTPILVNAVDPGNTATHPERGDDDSDRPAAESARDIVR
FT                   AATFGSDGPSGVLFSGGQPVA"
FT   sig_peptide     complement(461588..461656)
FT                   /locus_tag="Caci_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.779 at
FT                   residue 23"
FT   gene            461750..462451
FT                   /locus_tag="Caci_0414"
FT   CDS_pept        461750..462451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0414"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracyclin repressor domain protein;
FT                   regulatory protein TetR; KEGG: sma:SAV_775 TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69366"
FT                   /db_xref="GOA:C7PVL0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL0"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ACU69366.1"
FT                   /translation="MAAEPAEPAEPAEPAPRKTPITLERITDAALQVVATEGYDALTIR
FT                   RVTNVLGTGPSSLYAHIATKTDIDDLLIGRLCSEITLPDPDPATWQHQLRDVYAQLRDQ
FT                   YLKYPGISKAALATVSANPETLRVSEGIFAILLSAGIDPQTAAWTMDAITLYVAAYALE
FT                   LSLVHHRRKDPTTPWLLSHEALTAHLTSLPEATFPQTRRHAAALTSGTGHQRFDFALTL
FT                   LIDNLTSQTKS"
FT   gene            462581..464764
FT                   /locus_tag="Caci_0415"
FT   CDS_pept        462581..464764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0415"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein; KEGG:
FT                   sgr:SGR_1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69367"
FT                   /db_xref="GOA:C7PVL1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL1"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACU69367.1"
FT                   /translation="MPRGQAFTNSSGVKSVLHAAADAETAIREMHEGDERRHQAVRDAY
FT                   QASHAVAVLGRLRSISIERLRDVTGARLPVTKLEEAGYKSIADLLEATPEQLQQVPGIG
FT                   TKGAERTVDAARRIADAAMSGTHVTADMDLRVADAATLLAALYRVQTADRVLLKVREPA
FT                   KRIGGALTSLADTAKPLSSRMRRVITGRAKREEAQGAVDRLEGLLGDPATNQDLERIKA
FT                   ANEKLRGVKPPRPSVVRNDFEKRSADYFSTLSRIAGARANGEAARGFLPTSLADRIGVQ
FT                   QLDETHLRVSLRAYQAFGVRFALAQKRVVIGDEMGCGKTVEAIATLAHLRAEGAKHFLV
FT                   VVPASVLINWLREVRAHSSLRPYRLHGPQGEAALKAWLSGGGVGITTFEALPNLELPPR
FT                   TRISMLVVDEAHYVKNPNTMRSRAVRAWTDRVERVMFLTGTPMENRVEEFRNLVGYLQP
FT                   DLVDSVGEIDAVAGSEAFRKAVAPAYLRRNQEDVLSELPEMVKIEEWEEFGPEEEAMYR
FT                   DAVAARNFMAMRRAAYATGDPATSAKLRRLVEIVDEAEANSRKVVVFSYFRDVLDTVCR
FT                   ALGDRASGPLTGSMQPQHRQELVDAFTAAKKHAVLVSQIQAGGVGLNMQAASVVILCEP
FT                   QVKPTLETQAIARAHRMGQIRRVQVHRLLVADSVDQRMLEILDAKSGLFDAYARRSETA
FT                   ETMPEAKDLSDASVRKQLIDAEQERLGLDKARS"
FT   gene            464809..465810
FT                   /locus_tag="Caci_0416"
FT   CDS_pept        464809..465810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69368"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL2"
FT                   /inference="similar to AA sequence:KEGG:SACE_2039"
FT                   /protein_id="ACU69368.1"
FT                   /translation="MEPARLGQLRRDLAHAVRMGPFSATLHLAIEASGMTLEQVRLELA
FT                   ARGAFVSMATLSYWRRGMSRPERPESLHAVELLEEVLALSTGALTGQLGPRRPRGRTAA
FT                   RRESGLDVVDAWDAHREYDHLLQGLDPAGRLELTRVSTLDRYSLGADRRELSLTTCQVL
FT                   RAEADDLSRMTVLYRTYDPPSPSPVLKALNGCRVGRVRIAQDSGFVAAELLFDRVLRRG
FT                   ETAVVDYELTGLSPSPPTETDFYQRFFPYATALYVLRVQFDPATVPARCVRYERRTETA
FT                   PDQGVREVWVGATGQAHVMATDVPPGVVGLRWDWGAGLHDLPSLGRGDPPAR"
FT   gene            complement(465862..467640)
FT                   /locus_tag="Caci_0417"
FT   CDS_pept        complement(465862..467640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0417"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: bam:Bamb_0804
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69369"
FT                   /db_xref="GOA:C7PVL3"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL3"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69369.1"
FT                   /translation="MRRILLAGVITSALSTVAAMAMVQPAEAAVSPQIVPASCASAPAG
FT                   HAHCNAVQLVPSGARPAAPTGFGPSDIQSAYNLGTNPGSGQTVAIVDAYDDPNAESDLR
FT                   TYRSQWGLSACTTANGCFSKVDQNGGTTYPSGDSGWGAEITLDLDAVSAACPGCHILLV
FT                   EATTNDDNDLGAAVDEAVRLGAKFVSNSYSDAESDFTTGMDAHYNHPGVMIAAATGDNG
FT                   TQSGSSAQFPATFPSVVAVGGTSLSQASNSRGWSESVWNKGGSGCSSLFAKPSYQQNVT
FT                   TNCAKRASADVSADANPNTGLAIYDSYGQSGWEEYGGTSLATPLISAMWAQAGAPASGD
FT                   SGVSYLYANEAKFNDVTSGSNGSCGTVICNAGTGWDGPTGVGTPNGVSGFASGTTPPPP
FT                   ANDFSVSVSPASGSVNPGSSATSTVGTKVASGSAVTVQLSASGLPSGASASFNPASVTA
FT                   GSSSTMTIATSASTPAGTYSVTVTGTAGSTTHTAAYSLTVNGTGGGGTVTVSNPGTQLW
FT                   FVGYQSQPLQIRASDSKNLALTFSATGLPPGLGISASGVISGTPTRAGTYQVTVKATDS
FT                   GGGSGSTTFGYQVYGF"
FT   sig_peptide     complement(467554..467640)
FT                   /locus_tag="Caci_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.535 at
FT                   residue 29"
FT   gene            468043..469284
FT                   /locus_tag="Caci_0418"
FT   CDS_pept        468043..469284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0418"
FT                   /product="protease-like protein"
FT                   /note="KEGG: bmv:BMASAVP1_A0748 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69370"
FT                   /db_xref="GOA:C7PVL4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL4"
FT                   /inference="protein motif:COG:COG4934"
FT                   /protein_id="ACU69370.1"
FT                   /translation="MRTNLRPAHRRAAISLAAAAVLGITAAAVATSANAAGAPAAKSAG
FT                   PAWSRACDAPAPGMAACDALHVTNVPEHIRALGVTPNATPSGFGPADLRSAYKLPANGG
FT                   AGQTVAIVDAYNDPNAAADMATYRSQFGLPACTVASGCFKQVSQTGTSTLPANNTGWAG
FT                   EISLDLDMVSAVAPNAHIILVEAKTASMANLGTAVNEAVKLGAKFVSNSYGGGESSADT
FT                   GYDTKYFQHSGVAITASSGDGGYGVEYPAASPYVTAVGGTALKKDSSARGWSESVWSTN
FT                   STEGAGSGCSAYEPKPTWQKDTGCSKRTVADVSAVADPATGVAVYQTYGGSGWAVYGGT
FT                   SVASPLIAAVYADAGTPKASVPAANIYSHTSALNDVTTGKTATCTPKYLCTAGTGFDGP
FT                   TGWGTPNGLAAFTG"
FT   sig_peptide     468043..468150
FT                   /locus_tag="Caci_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 36"
FT   gene            469477..470052
FT                   /locus_tag="Caci_0419"
FT   CDS_pept        469477..470052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0419"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_1454 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69371"
FT                   /db_xref="GOA:C7PVL5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL5"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69371.1"
FT                   /translation="MPEFTEFAQARQAHMRRMAFLLCGNWHDAQDVTQIALMNLCRAWS
FT                   RARRADSIDAYAHRVVVRAYLSQRKKVLRQQARAVEYARASERVPGSAEESGEPELRMA
FT                   LLAALAQLPPRGRAVVVLRFWEDLSIEATAEALGCSTGNVKSQASRSLAKLREILGDSL
FT                   FDEGDGGGPRRAHVHAGVRPVWEVDGRA"
FT   gene            470049..471098
FT                   /locus_tag="Caci_0420"
FT   CDS_pept        470049..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69372"
FT                   /db_xref="GOA:C7PVL6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69372.1"
FT                   /translation="MTENPGRLRALLDDTLTDEPPLLDLVPDAVTAAEQGRRRGRMMAG
FT                   GAAVAVLAVSVGAYAVADHGRSGTNGSPIVSPGISRSSTSAAPPVRLSHKSTLGIPGLF
FT                   DHPGTPQQECAKVNGPVMDSKAQLSSPAERNYCIQSLQTIRALLPDAVVVLNPFVDFNQ
FT                   PAWSAPLVQTPDGGTAPGFTQAYQQSAKNSAKTVYLAGTFAFRTANGEGSIIYTTTSPG
FT                   VKAKPQGGDLPLDDGTSGRIAHEDSGSIDVTGVTADGVWYRLEISGVGPVYGADGSTLE
FT                   PNLHTDGQGHSVFPDGYVAAGDSALHMHIPNPYTVTEVRQKIVDMGLGNVIHTMGVDPL
FT                   SDYPAPPAG"
FT   gene            complement(471179..471757)
FT                   /locus_tag="Caci_0421"
FT   CDS_pept        complement(471179..471757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0421"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   sco:SCO1356 iron sulphur protein (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69373"
FT                   /db_xref="GOA:C7PVL7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL7"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69373.1"
FT                   /translation="MTTVDLAAATQTTDKHACLGHPEGTSRRTALLGIAVAAGAVCAGC
FT                   SSSKSSSASTSPSTSAAAGSTSAADSSSSSSAAGSSTGTASSSASSSGSSGAAGALAAT
FT                   SAVPVGGGTVLTDQKIVLTQPTAGTFKAFTAVCTHQGCVVGSVANGLIVCPCHGSAYHI
FT                   ADGSVANGPAPTALAEIAIKVSGGEITQA"
FT   gene            complement(471902..473704)
FT                   /locus_tag="Caci_0422"
FT   CDS_pept        complement(471902..473704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0422"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: sma:SAV_2262
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69374"
FT                   /db_xref="GOA:C7PVL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69374.1"
FT                   /translation="MSGWIVPGYTETGILGAGATGRVVAAVHDATGTEVAIKYLSPRFV
FT                   NNPDFIERFREEAALLAEIRHPNVVQLFEYAESDEGSAMVMELVSGPTLHRMLHENGRM
FT                   APEAALSVMRGSLLGLGAAHQMGIVHRDYKPSNVLLNAYGISKLADFGVAERAEPVSEI
FT                   DPDATMPGGTGTPAYMAPEQWDGAPAQPVTDIYAVTASFFECLTGKVPFSADTVYELEE
FT                   KHRTAPIPLDDVPEGVQPLVAHGLAKDPAERPQDVWAFVAEVERAATDAYGVDWEERGR
FT                   QDIVALWPLFGFFVPGGAAGGGGALETLGIGPNGPADPGEPGDLDAPHASGPEDDDWDD
FT                   GHGSHRSRLPDKVKTAAIVAGVAAVVLAIAAVAVAGNGKPAKKASPPSSTSSVFTPTPD
FT                   GPTGTPTSNDAGSAPTVAVSSSSSGSGSSSSSGSSSSSSGSSSSSSSSSRSSSSSPSTK
FT                   PSSKPSTSPSSVSLPSTPSTSSPSSSPSTPSTSTSSSPQVSIGATVSVVSDPPGQCVAS
FT                   YNVTFAVGNAPGGTVVVNYTWHLASGRLVPEGPVTLKSNSSQGFGIRETSNGTPKGSVV
FT                   FVTWTTASSSGTSNSAPVSITCLK"
FT   gene            complement(473819..474556)
FT                   /locus_tag="Caci_0423"
FT   CDS_pept        complement(473819..474556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_6625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69375"
FT                   /db_xref="GOA:C7PVL9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL9"
FT                   /inference="similar to AA sequence:KEGG:SAV_6625"
FT                   /protein_id="ACU69375.1"
FT                   /translation="MTSMAGSTPERRRSWVRGRLRDGKVAREGGVQKGRVREGRVRRFT
FT                   VAERMVHRGTGVLMLLCVATAACLYIGPLAQAVGRRHLMVTVHEWSGILLPAPVLLGLL
FT                   SPAFRADLRRLNRFAPADRHWLRAVRRRLMEPPDRPAGKFNAGQKLYAGWIAGAVLVMM
FT                   FTGLLMWFTHLLPGISRTSSIFVHDILAWGIAVVLLAHMRKAYQDPESRRGMRTGYVDR
FT                   VWAKRNHSEWLAKDEPDGSHQQV"
FT   gene            complement(474528..475229)
FT                   /locus_tag="Caci_0424"
FT   CDS_pept        complement(474528..475229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0424"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   sma:SAV_6624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69376"
FT                   /db_xref="GOA:C7PVM0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACU69376.1"
FT                   /translation="MPDSEAENTPDGAPLARRTLFGVLGAGAAGLIAAPYLQAGWEKVL
FT                   AKASEDDPTGLSGLLPNPGGFRYYSVVGSVPRKDETNYELRIGGLVDRARSYTLADLRA
FT                   LPQTRIVHDVQCTDGWRVEKTPFEGVRLSDLLDDAGVAGNGKALRFTCFDGAYSESLTL
FT                   EQARRDDVLIALQMQDAPITHDHGGPVRLYVAPMYFYKSAKWLSGISVTDRVVPGYWEE
FT                   RGYDVDGWLDA"
FT   gene            475544..476416
FT                   /locus_tag="Caci_0425"
FT   CDS_pept        475544..476416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0425"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   nca:Noca_3836 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69377"
FT                   /db_xref="GOA:C7PVM1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69377.1"
FT                   /translation="MTSLRLADGRNLEYLVAGPDGGTPLVFHHGTPFAAVLFEPMVEAA
FT                   TRHGLRFVVHSRPGYADSSPQPGRTIASVAEDVAALLAALDAERFLTVGWSGGGPHALA
FT                   CAALLPERCVAAATVAGVAPYRAEGLDWLDGMGAENIEEFAAAVSGAAPLTEFLSAQAA
FT                   GLANVQGADIAAALGELISEVDGRALSDAFADFTAAAFRKAVSAGIDGWHEDDLAFIGD
FT                   WGFDLAAIKTPVSVWQGDEDRMVPFAHGRWLAGALPGAAAQLLPNEGHLSLVLDRFDDV
FT                   VADLVKRLP"
FT   gene            476447..476965
FT                   /locus_tag="Caci_0426"
FT   CDS_pept        476447..476965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0426"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: rha:RHA1_ro03342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69378"
FT                   /db_xref="GOA:C7PVM2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM2"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACU69378.1"
FT                   /translation="MLETPEELAALQTLLDDSAAAAGPHMRGIFTDDRRLNAAELSARL
FT                   QGMCLIAVATVTADGRPLTGPFDGYFLHGSWWFSSAPDSVRIRHLQARPGVSATYLPGE
FT                   ELSVTAHGRAELFDLHAPECDDLRQAMLDFYLPKQGPAFQEWMDGLEGGIGVRIDARKL
FT                   FTFFASSTA"
FT   gene            477158..477562
FT                   /locus_tag="Caci_0427"
FT   CDS_pept        477158..477562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0427"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3738 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69379"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM3"
FT                   /inference="similar to AA sequence:KEGG:SCO3738"
FT                   /protein_id="ACU69379.1"
FT                   /translation="MRTRSLLTTLACAAVMVGAGAESAFADATPTTQPSAVPTRSAAPS
FT                   VPPTTAPTATAMPSAVPSDSARTAAPATPPPTLPGRQVGAVPSGAPNTGEPVAASKGHG
FT                   EAEAVGASLALLLAGSGSVMVRRRKLKGRG"
FT   sig_peptide     477158..477238
FT                   /locus_tag="Caci_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            477565..478272
FT                   /locus_tag="Caci_0428"
FT   CDS_pept        477565..478272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0428"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sma:SAV_92 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69380"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM4"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACU69380.1"
FT                   /translation="MRRAWTRGWPAVIAALLLASGCAAGSSTSAGGSGRNAGGTGTNPA
FT                   AATAGGPAGSQAGGTAGTPAGGTSGTSSAGNSTSAGAIARSDPVRLQIPAIGVDTSVMA
FT                   LGLAADGTVQVPPIEKDSPAGWYNGSPTPGQTGPSVILGHVTVGKYGDGVFLKLAQLKP
FT                   GAHVVVRLQDGASADFTVDSVRTVAKAQFPTQEVYGNVNRPELRLITCGGERTSDGYLD
FT                   NVLVFASLTGTAG"
FT   sig_peptide     477565..477654
FT                   /locus_tag="Caci_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.402 at
FT                   residue 30"
FT   gene            478313..478825
FT                   /locus_tag="Caci_0429"
FT   CDS_pept        478313..478825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0429"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: sco:SCO3736 RNA polymerase ECF sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69381"
FT                   /db_xref="GOA:C7PVM5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM5"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69381.1"
FT                   /translation="MSRSKDSGEKSRAASDLFTDLYPGLAGWCRRLVDDDGTAHEIASE
FT                   AFTRLWGHWTSVREPRGFLYVTAANLVRDHWRKMDRERRAIRQVSAEVERAAHHDGADA
FT                   SVSVRMLVRSLPERLRTPVLLYYYADLPIREIAQLTRRKEGTVKSDLHAARELLRAGLG
FT                   GHLDHAH"
FT   gene            478809..479513
FT                   /locus_tag="Caci_0430"
FT   CDS_pept        478809..479513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_94 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69382"
FT                   /db_xref="GOA:C7PVM6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69382.1"
FT                   /translation="MITLIEPADDDDDAVTGDQGGVGGVGGARGSGGDGDSDSDSFGYS
FT                   IEGDDGDGDELVVLLRPGVSVLAPPAGAFQRIRRRAARRRLARAAATVGAGAAMAAVAV
FT                   TVALWPSNSALGPPAPVSPVAPPVQRTSIPDAPATTPLTSSSPSPSPSSLPSSSPSPTP
FT                   QRPHAGPSDSAAPPTAPPSTAVRTAPTRVPTTRPATAATPSTPPRTEGSVTPEGSATPA
FT                   GRATPTCPSGCG"
FT   gene            479655..480716
FT                   /locus_tag="Caci_0431"
FT   CDS_pept        479655..480716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0431"
FT                   /product="Carbohydrate-binding family V/XII"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; 3D domain
FT                   protein; SMART: Carbohydrate-binding family V/XII; KEGG:
FT                   sgr:SGR_6088 putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69383"
FT                   /db_xref="GOA:C7PVM7"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM7"
FT                   /inference="protein motif:PFAM:PF02839"
FT                   /protein_id="ACU69383.1"
FT                   /translation="MSLFPIRRRIPEHAPSRRPGPRLRALLGAVALTLTAFGAVGVVAA
FT                   QQASAAGTSSLPTCPFWTNVTPPPRTDTPWVPPLQTAQPVNFSSRLAAPGGVTGTLTGS
FT                   QVDISFNRVAGAQAYRVWRNGQAIAWVSDWGQPALTAVDNAPCQNAYYTFEAMSDQSGA
FT                   DSSLGQMSSPYQLNSDGAVVPWQIPVGSTVTMMVTSYNDGGMTASGYNSQLGVCAVDPR
FT                   VIPWGTYFTVPGYGTCYAADIGTWIQNDTVDVWLPGSQANGWGVQHRTVTIIANPFGGP
FT                   TPPPSSSPSSSPTSSPSSPPGGCTTAAWNSATAYTGGQTVSYGGHTWTAKWWTQGDVPG
FT                   ANSQNVWTDDGPC"
FT   sig_peptide     479655..479789
FT                   /locus_tag="Caci_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.437 at
FT                   residue 45"
FT   gene            480710..482398
FT                   /locus_tag="Caci_0432"
FT   CDS_pept        480710..482398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0432"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: cellulose-binding family II; Fibronectin type
FT                   III domain protein; SMART: cellulose-binding family II;
FT                   Fibronectin type III domain protein; KEGG:
FT                   fre:Franean1_6988 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69384"
FT                   /db_xref="GOA:C7PVM8"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM8"
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /protein_id="ACU69384.1"
FT                   /translation="MLRALRASLIAAGAGALLVSGLTIASPTASAATTPTPTATAPTTP
FT                   TATAPTTPTPLPTAVYSKTSDWGSGFQAQYVITNPMSVPLNTWSLQFSLPSTEKITSMW
FT                   GGTDTASGTTHTVLAQSYDTTIAAGASITIGFDGSYSGTYADPSACKLNSDPCDGSADA
FT                   QAPTAPTALTTLSTTSSAASLSWTGSADNVTVAGYNVYSGSTMVATSPGTAATVTGLAP
FT                   STSYSFTVRAVDEAGNLSAPSAAVSATTLASTGGGHLPGVAAPFVDIGAWPTPNLTQIA
FT                   ETTGLRQFSLGFIVNGTATCTPSWFNAYAMSAGFEQSDIATLRAIGGDVKPSFGGEAGT
FT                   ELAQSCTDVPSLTAAYQSAITAYNLTQIDFDIEGSAVADPASIDRRSQAIAALQKNAAA
FT                   AGKPLTVTLTLPILPSGLTTDGLYVVQSAVKYGAKITTVNGMAMDFGDIEAPNPSGKMG
FT                   TYAIDTAQSLHTQLTPLYPALTATQLWNMIGVTPMIGQNDNSSEVFYQTDMHQLLTFAQ
FT                   QQHLGELAFWDVTRDANACTGSLSKCTDIPQTPYEFSKMIAPYQG"
FT   sig_peptide     480710..480805
FT                   /locus_tag="Caci_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 32"
FT   gene            482489..482917
FT                   /locus_tag="Caci_0433"
FT   CDS_pept        482489..482917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69385"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM9"
FT                   /inference="similar to AA sequence:KEGG:gll3649"
FT                   /protein_id="ACU69385.1"
FT                   /translation="MDVVGEALPAIISAVRTYGDTVLTAGEQAAASGTVSLGRRLLQKL
FT                   FGGAPKPVVFEDAVANLAAAPESDDAVAALRLQIGNVLARHPELRDEIAAMLPHQTGNT
FT                   VSGDGSANAGRDQNISASGGTAVGVLNIHPSSPDPTTR"
FT   gene            483007..485148
FT                   /locus_tag="Caci_0434"
FT   CDS_pept        483007..485148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0434"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="KEGG: fra:Francci3_0876 putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69386"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN0"
FT                   /inference="similar to AA sequence:KEGG:Francci3_0876"
FT                   /protein_id="ACU69386.1"
FT                   /translation="MAAAFTATGVPQVQVLFGLGGVGKTSVAVEYAYRFADSYGIVWQF
FT                   SAEHPESLDGQIGELAAHLGLLVPPTTDDAAGSLRSHLVNADRPWLLVLDNVVDDAVVH
FT                   RLVPAAGPGHVVVTSQRATWPGRARVREVPVLDRDVAIKYLLSAADSSDVAASGLLVDA
FT                   LGGLPLALAHAAAFLRVTGRPVQFYLDKLSAMLVRPGRGKAVARTWSAAIGQLGSAGSP
FT                   AMALLRVLACFAPDAIPVRLLFPDDAPVPEGLSADVADQLAALADDGLAVDDALIALRE
FT                   FSLVGSPVGDGVVSIHRLVQAATLEAMSPEEQSAWRQAATALVVRATPDDPNLPETWPA
FT                   FTALLRHIEQVVPAEHDCYLRAADHLGAVGNYRAAVAMARRSLEARARRQGPDAPETLA
FT                   ARQSTAQWTGHAGDFEGARDQCADLLPIRERLLGVEHPDTLSTRSVLAFWTARAGSYAA
FT                   ARNQGIDLLSIRERVLGIEHPDTLLTRSNLAGWTGNAGDPAGARDQFADLLPRYQHVLG
FT                   DEHPVTLITRTHLARWVGEAGDPAGARDRFADVLPIRERVFGAEHPDTLHVRANLARWT
FT                   GKAGAAAEARDQYAVLLPLFERVLGPEHPATLTNRRNLAHWTGKAGDAHGAREQLVALL
FT                   PLHQRVLGPEHVSTLHARHNLARWTKNAGDNAGARDQFTDLLPIRERVLGSEHLDTVKT
FT                   RNGLASCITETERVPGATE"
FT   gene            485629..485889
FT                   /locus_tag="Caci_0435"
FT   CDS_pept        485629..485889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K10592 E3
FT                   ubiquitin-protein ligase HUWE1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69387"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69387.1"
FT                   /translation="MVASAHAKASIKVKLGWDQAGISDVGGVEGVGSVGSADRVEDADR
FT                   VEDADSADDADDAGSDSSDGSAKAEDPAEDTAQDTAQDQEP"
FT   gene            485889..487886
FT                   /locus_tag="Caci_0436"
FT   CDS_pept        485889..487886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69388"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69388.1"
FT                   /translation="MALAQLPNPGGPHLIAQAERSAVAVLAPEAPPEPGAEPALCLIGS
FT                   GFFITTDLVLTCAHVVADEPELYVLSGSVTLRVKAVELIDPPYDGDDSWPVPDLALLRI
FT                   EPAPPDDESDPYPVWLDLAPNASFISSAGYLSVGYDKRGPGGAAALASRLYDAGGTRKA
FT                   NAPGLPSFTYVELAGNTVPTYRSGSMVIDLSTGRVTGIVKAARAEDDGDGGYAVPLAGV
FT                   LPRVLSRQLGVQKAKDILAAHDSFHARTVDWPAMCEHYFTGPQPPGAIRADSTKLPLNE
FT                   VALLGLLVSIRHVVTDAELFEIIQSHSGLELAADAGLRDVALGLAATTTWSSTDVHSLL
FT                   RFMDGLTTRLEHRVSQQWLAEARKWADGLAAKLNQTSRLRALRMQTSAIRRTSGAAEAG
FT                   SSSLRVLVDPAFDPAGGYHVSIRMHHSAGVGAEQSPEETIGSASVLAHLRDVLPAAVRA
FT                   AARLDGGCLIDLVLPLDLLAEPVHKWEVSGSTPLGHLLPVAVRSVERYRDRDDVPGARL
FT                   REIWDRASKEAVSLQWIMCEDPENTGRAVEHTGLGLVNPPTSRHRRSRRLLDEAVQDGV
FT                   PLLVWSASDCGVDHADPQNVSVLCAGPYFQGIAEEALRDVVLEDVPHRLFAKRSQAGAE
FT                   ELDAVALFWDNPGLGHEENLLTEPCYPEDS"
FT   gene            487888..488886
FT                   /locus_tag="Caci_0437"
FT   CDS_pept        487888..488886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0437"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: sco:SCO2449 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69389"
FT                   /db_xref="GOA:C7PVN3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN3"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACU69389.1"
FT                   /translation="MKDWWIFKGEGVPHRRVEQLPPPMASRSFGGAPLVELTLEEDRAA
FT                   VARLGRSEAEQRLLLSEPDLDLINAAILLRRPLLVTGKPGSGKSSLAYAIARELSLGPV
FT                   LHWSITSRTGVKEGLYGYDALGRLEETNLRRIMGADTAPDLGEYIRLGPLGTALLPQKH
FT                   PRVLLIDELDKSDLDLPNDLLHVFENGEFEIEEVVRQRGTDSVEVGVTGQPTPVTVHGG
FT                   LVRCNAFPIVVLTDNGERDFSAAFLRRCVRLKLADPDRDRLVGIVEAHLGEEGVRTGRT
FT                   LIEDFLVKRRAGTVATDQLLGAVYLAIAAKLGGTDRAELADRIMAPLDQVG"
FT   gene            488883..491351
FT                   /locus_tag="Caci_0438"
FT   CDS_pept        488883..491351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69390.1"
FT                   /translation="MTRIVPDDARAALADFIEAVAPAELSAEEIAEALWLAQWINQSAG
FT                   ATAGSAEPQQESGQEAPPPHRVPVSIPRTPAGRQQPARAHPPATVADAESEPERRTSPP
FT                   PRLMGSALIRVPSPTGSEAVRFARSLRRLRPLPVRRAPGTADAAATVDEAETARFAAET
FT                   GLLWPVYTRQRPRRGVAKVVVDTSVSMQVWEGLEEDIVRGLSLSRVFRRVETWSLYQRG
FT                   ETAVVCERRAGVAAGHEGPLARLADGSGDGAVLILSDGVARLWYDGAVLDAVDRLAVQG
FT                   PVALVQPLPNRLWRRTGLRPRLTTVTGTARGPEALHLTRVAIGTAAPAVPIIEADESWF
FT                   ATWAALASGRLATARFAVLGSRSPAGYAQSVAAGGVQEPGQLVGDGMAVPVVRRFRAAA
FT                   SQGARELAAALSVVPLSLPIMQMVLATCFPDRSRAHLAEVITGGLMQRDPKVPEGGGPP
FT                   AFRWLPGVGEELRREVDDRQAERVRAALSGYLDAELGFRPDSRGFIAIMGTPAMPAERE
FT                   GRFGSPFARILPDTVRRALNHAGVAYTVSDTVGTASEAQRITHALALAEAARNTGRSAE
FT                   IDEAIEAARLAVSEAAGRDWPLTDALAELLEHRGRREGSPFDAEEAVIVLREYVDRAPA
FT                   DDPHRQEGLERLADALLARYQSTESPDDLDDAIRMRRRLAEAEDAAQDQLVLLADALLE
FT                   HHRLTGASLSAYEATDLMSGLRRTGQSEGVRVAATAILARGLDIMSRSTRAEEDIEASD
FT                   AVWLALMPELGELTEDQAAVTRTAIEARIRFHKSSGRAGRARALEAAYEDALGRLGQQW
FT                   GLPGAQASAI"
FT   gene            491560..491793
FT                   /locus_tag="Caci_0439"
FT   CDS_pept        491560..491793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69391"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69391.1"
FT                   /translation="MERTITAALETDGSAAGVDVSGFAAGHDLAWTEPGPETVPSPLAR
FT                   GMQRLLAEYVQETEWVVGWSSCLLPPPPDRAP"
FT   gene            491790..492959
FT                   /locus_tag="Caci_0440"
FT   CDS_pept        491790..492959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0440"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   fre:Franean1_5726 radical SAM domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69392"
FT                   /db_xref="GOA:C7PX41"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX41"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69392.1"
FT                   /translation="MSLDTGAGLPRPARAGWTATGLRQFVLKLHSRCNLACSYCYIYEG
FT                   PDQSWRDKPGTMSPETIALTASRIAEHVATHRPPWIEVVLHGGEPLMAGLPVLRNAAET
FT                   IRAAVPDTTAVRLIVQTNGLLLTEQMLEGLDALGILVAVSIDGSASDNDRRRRFRDGRG
FT                   SFDAVSTGLRMLTSERFRHLFVGFLCVIDLESDPLAVYEALTVWDPPTVDLLLPHRTWA
FT                   DPPPPGARYAAWLSEVFDHWYRSGSATGIRVFDEIIAVLLGARTGTTAIGAGPVQHVTV
FT                   ETDGSLEADDILKIAYAGAPETGLTLARHSFDDYLATPALMDRRSGIDALCRECRECPI
FT                   VGVCGGGTYPHRFRPGHGFANPSAYCHDLMAVISHIKEAIIGDLSGRPA"
FT   gene            493087..496119
FT                   /locus_tag="Caci_0441"
FT   CDS_pept        493087..496119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5712 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69393"
FT                   /db_xref="GOA:C7PX42"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX42"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69393.1"
FT                   /translation="MVLHSAIPGVRDALVVHCDADETWVSWIDEALADQGFQTHRLSWT
FT                   ADGEDLGRTIGDVLGGGVSCCVVVLSEAFLAAADYSPQQWRTALRDSADLLDRLFPVVV
FT                   DRAQLPAELPLEVRQQIIDISDVGEQAARERLIQAVSGEPPVGRVPVRTREGKVRTRFP
FT                   ASDPAIWCPWTPNRNFSFVGRDKELKALHARLWDAPRGQARVAVTGLGGVGKSQIAVEY
FT                   MYRYQSEYDAVWFVRATRTAIARQDVVNVGAELGAPSADDLQAGIDGALRALLEDARTR
FT                   RWLVVIDDARSAAAVKDLLPSFPGQHGHVIITSTDENWTDIAAELPIQPMSAEESFRYL
FT                   RSRLPETGDEDLQALVGYCDGLPIAMDLAAAQVRGAAQSVRAFLQSASERGVDQYQVKL
FT                   GRHEKTVAQTYLTALDSVGREVPAAGELLRLLSFMASAPIPIRLFGALSQDSGLPELAD
FT                   LAQVSRGFADSSALLGMLSEIRKHSLATIGLQGEESVISMHRVPQRVIVADIAEDQALR
FT                   YRHAVHLMLRARDIGAARTSAQWLVMLEIWRNLESSDGWDCELCAADISCRQMMLHVIR
FT                   ALMIWSESTQCEAAAARAIAAWTPVLGPHHTDVREATLERANALRNMGRAGEALELDEA
FT                   LARDVAEMPDVRPAIAIRTGLNRGGDLRRLGRFADASTIDTQTRDRAVDEFGEIDRLSL
FT                   MARGNVSVSYLLLGEAANAMRNDEDLVRDQVRLRGDGDRAAFQTRTRIARAHRDMGQYR
FT                   SAVEMQEHNTYRCERVFGPHDATTLTAKGTLASCLRKAGQYEEARRVASTTVTDLQKLI
FT                   GDRHPEMVLAMTELANCLVRTDRRADAAELGRQALMLAVEVCGTDHPFTAICQNNLALV
FT                   HLVQHEPFEAETLLNEAAQVFAALPTDHPHQLIVAANLATALWDRGEYTKAEDLEKQLE
FT                   PKFVQALGENHPTTLAVASNRVTTFDALAGDDATRRTINNARWRRTVAAYQRVLTREHP
FT                   DVQIAEERRRRIHIALDAPAV"
FT   gene            496241..497434
FT                   /locus_tag="Caci_0442"
FT   CDS_pept        496241..497434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_7062t hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69394"
FT                   /db_xref="GOA:C7PX43"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX43"
FT                   /inference="similar to AA sequence:KEGG:SGR_7062t"
FT                   /protein_id="ACU69394.1"
FT                   /translation="MGQDSQNSDSLGRRRAPALARWPLGRVAFATFCATLALALGVLAG
FT                   VLGWLGLLSRSSFRSSPGTALDVVKLVLGAVAGVGALVGLVIAYRRQLVAETADDRERT
FT                   RLFNERFNAAAEQLGSDRAGVRQAGIYSMEGLADDWPAGRQKCVDVLCALARRGHVLQP
FT                   PADAPIEDRLAWDDDRQFRHAIMRVVADHLRPAAAVPWRGGNFDFTGALVDGGDFEGIE
FT                   LTGGRLVFAGARFVAGAPLVLRGSRIDGGLLDVRGAVFDSGALDLSKASVGPQATVNFS
FT                   DVLFQDGYIDIRTTTIEGCCYLCRATMSGAEIELSESSLRGTIDFRDARLAGGVMRFDG
FT                   AVVAPERFRFAGARFEGATLDFSGAQVDGLLDFGTAASPTGVMLPPTPTVAPHSAPE"
FT   gene            497445..498017
FT                   /locus_tag="Caci_0443"
FT   CDS_pept        497445..498017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69395"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX44"
FT                   /inference="similar to AA sequence:KEGG:SAV_624"
FT                   /protein_id="ACU69395.1"
FT                   /translation="MSEIPNEPASANRPFTEFLRAHGAADMPHPGGTLLAHLIRVSDRL
FT                   AEWGVPLAVQVAGLCHATYGTDGFAPSLLDLADRAILVELIGEGAEALVYRYASCDRSA
FT                   TYPRLRGGEQPVFRDRFAGADCQPTGEELRAFLDITAANELDVFRHNAELADRHAPAFY
FT                   RLLESVRALMSPAAWDAVRGDLGDRAS"
FT   gene            498312..500072
FT                   /locus_tag="Caci_0444"
FT   CDS_pept        498312..500072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0444"
FT                   /product="Ricin B lectin"
FT                   /note="PFAM: Ricin B lectin; SMART: Ricin B lectin; KEGG:
FT                   sus:Acid_7414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69396"
FT                   /db_xref="GOA:C7PX45"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX45"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ACU69396.1"
FT                   /translation="MKISPRRLITALAALCLGIGAALGMIAAPAQAAASATSEQTFLTF
FT                   YGWWDNTPPGADIAYPQIHQTAGGTGTYADPITFATDSNEQPPGTIVYVPRVGKYFIME
FT                   DGCDECSSDWTGHGPNGGPNLRHLDLWLGGKGGNAFDAIECEDALTNYNSDGTPTMEPV
FT                   IVNPPSNETVSSSPIFNTSTGACYGGAKPTISVGQYKNVSTGNCMTDPNNSSSAGALLV
FT                   TAACDSTAASQRFTFDGTFLQINNLCADYSTSQISMQKCTAGPSQQWSYNTDLTFTDIQ
FT                   TGKKYINDSSGKVKSGSSSSSTKTWTYVPAGSGTTNDFSVAASPASASVTAGGTATATV
FT                   STAVTAGAAESVALSASGGPAGSTVSLSPTNVTSGGSSTLSVATTSTTAPGTYTITVTG
FT                   KAATGTHTATYTLTVNPVSGGGGCTAAQLLTNPGFESGASTGWTGSSTLGFNPITNSTS
FT                   GEPTHAGSWESWFNGNGSADTDTVAQSVTIPSGCTATLSYWLHIDTTESTSTAKPDTFS
FT                   VQLLNSSGTVLTTLATYSNLDKASGYTQHSSDVSAYAGQTVKLRFTGTETDKNGGTTSF
FT                   VLDDTALNAK"
FT   sig_peptide     498312..498410
FT                   /locus_tag="Caci_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 33"
FT   gene            500344..502587
FT                   /locus_tag="Caci_0445"
FT   CDS_pept        500344..502587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69397"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69397.1"
FT                   /translation="MRKHTSRAARAAALCAAAAAVATFTVPAQGAVGATPQATPVPSTT
FT                   SRVTLATGDTVELSPAGTRVLPGGPSKAFTTFTDTKGDTYIVPAEAVPFAGRVLDMSLF
FT                   DVTRLAAMAQGAQGSQIPVSLAFQAGVTPSAPAGVTLTAVSGQTATGYMTPASGAALAT
FT                   ALQKQIAADKTAGRTVGSGGLLGLTSMRVAGTGTPVTPNYPMRILQINALDTDGAPLDS
FT                   YVTLINTDNSQIMAVSEPVVGGVARIALPAGNYAAYMSDFSYDTSGYITGEALVAVNDF
FT                   AVPATGDVPALTLDARTATAPVSVTTQQSSTAQNLMQQMTRTPTTGPTVVLGSFFIFTG
FT                   GMPLTMTPQATAKVGKFTLDTVEDMAGPAGAGPDNYQYQYFLDFPSDHIDADQSHHPAD
FT                   RDLAAETENIDSDPALAGAERGVDAAPVLPYTGPGLQFGAAMPQKSTSYFTPGRWANGI
FT                   SGPWASGPGQPEGPSLWSGAKTYHAGQVSQHTWGAAPSAPAFGRYQESAAEVDCQVCVG
FT                   AGNMDLEFYDAGDSNPDTVGVDFDANPSATFYWNGQPLTPPSGPPGFSSPDIIVPNVGT
FT                   TPATVRAVLDTDRTSGEKQSTNTHTDVTFQYTGKTDSRSTLPDGNYCPAAIAAGQPSAP
FT                   CQIMPVMTIGYQYGALSRTNVSQSPVQSLVLDIGHHSFGGHGSLAPVVSAKVSVSFDSG
FT                   ATWQDVPTVGAFGHYAALWHNPAPGTPVAVRVTAADSIGGSISQTVTNPYTVG"
FT   sig_peptide     500344..500436
FT                   /locus_tag="Caci_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 31"
FT   gene            502620..503858
FT                   /locus_tag="Caci_0446"
FT   CDS_pept        502620..503858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0446"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: bac:BamMC406_0814 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69398"
FT                   /db_xref="GOA:C7PX47"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX47"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_0814"
FT                   /protein_id="ACU69398.1"
FT                   /translation="MKTRIRILTALAAGAAAALGLAAPAVAAPTHGGGGTKPSGGTSVA
FT                   VCAAATPGHASCFARLRTDVHGGSGVRGAAAGRSKPANAAPPTGLSPADLRAAYNLPST
FT                   GGAGQTVAIVDAGAEPNIESDLAVYRATYGLPACTTANGCFQVANQRGAASPLPPDQGW
FT                   GVEIALDVDMVSAACPQCHILLVEADDASNENLAASVDTAVALGATEVSNSYGGPEASD
FT                   SAQVASHYSHPGVAILASTGDSGYQPANAPAVYGSVIAVGGTTLTRAATSRGWSESAWS
FT                   GAGSGCSAWFAKPAWQQDANCPGRMTADVSADADPNTGPAIYCTDGCPGWGVVGGTSVS
FT                   SPFLAGVVALAGHPGRFPDASYLYAHASGLNDVVGGNNSVSGMDCGGDYQCNAVADYDG
FT                   PTGLGTPNGLAAF"
FT   sig_peptide     502620..502703
FT                   /locus_tag="Caci_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(503955..505037)
FT                   /locus_tag="Caci_0447"
FT   CDS_pept        complement(503955..505037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0447"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: stp:Strop_3846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69399"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX48"
FT                   /inference="similar to AA sequence:KEGG:Strop_3846"
FT                   /protein_id="ACU69399.1"
FT                   /translation="MRHSIIRSLAVGAVAALALGACSSGTGGSAKGRKPYIGVILPDTT
FT                   SSARWATQDQPALAAAFKAKNVKYDIQNAQGNKTQFQAIADHMLKEGVNILMIVDLDAA
FT                   TGTAVLAKARQQGVPTIDYDRLTLGGGADYYVSFDNVDVGELQGQGLVACLGGTKKPVV
FT                   AEVNGSPTDNNATLFAQGYNSVLNPLYADGTFIKGPNQSTTDWKNDIAGQNFAKMLAEA
FT                   PNIGGVLVANDGMAQAVIGVLKQHHLNGRVQVTGQDATVAGLQSVLVGDQCMTIFKDSV
FT                   KEANAAAELATALATGGSASSANTMVADSVTGKLVASVMLTPEAIVKQNVGDVISAGAV
FT                   TKAQVCTPEFAEACTANGIK"
FT   sig_peptide     complement(504954..505037)
FT                   /locus_tag="Caci_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.240 at
FT                   residue 28"
FT   gene            complement(505599..506447)
FT                   /locus_tag="Caci_0448"
FT   CDS_pept        complement(505599..506447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0448"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: nca:Noca_0921 ABC transporter related;
FT                   TIGRFAM: phosphate ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69400"
FT                   /db_xref="GOA:C7PX49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX49"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACU69400.1"
FT                   /translation="MTDSDLSHAGAVAVDDRPDAAGPHLPGTLEARAVSAWFGDRKVLD
FT                   RVSLTMPGGQVTALIGPSGCGKSTFLRILNRMHELVASAALAGEVLLDGGDIYDPRVRL
FT                   TEARARIGMVFQKPNPFPGMSIYDNVTAGLKLTGTRRSRSEQDDIVESCLTRAGLWNEV
FT                   SDRLKQPGGALSGGQQQRLCIARSLAVRPEVLLMDEPCSALDPTSTNRIEETIRELASD
FT                   VTIVIVTHNMQQASRVSDRCAFFLASAGTPGRIVEHGQTRAMFSSPQDQRTSDYVNGRF
FT                   G"
FT   gene            complement(506478..507128)
FT                   /locus_tag="Caci_0449"
FT   CDS_pept        complement(506478..507128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0449"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: nca:Noca_0919 peptidase C60, sortase
FT                   A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69401"
FT                   /db_xref="GOA:C7PX50"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX50"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU69401.1"
FT                   /translation="MLRAGVPVAVLAIPSVGVDEVVGEGTGAAVLESGPGLRRDTVLPG
FT                   QAGTSVIMARASGYGGPFRYLDQLQPGDRVEVTTGQGVADYRVSDVRRRGDPEPARLHG
FT                   QLGRLTLVTASGAAYTPNGALYVDADLISDVQPTPPAPVPHPGAEESAMGEDRYARPDV
FT                   AAWTAVLAGATVLAFWAGPRWGRAKTWLVAVPVLLVVGLTLADRIALLLPNLT"
FT   gene            complement(507808..508311)
FT                   /locus_tag="Caci_0450"
FT   CDS_pept        complement(507808..508311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69402"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69402.1"
FT                   /translation="MSGTTDSPARVAALTVIIVTAWLHAGSSAMADTGATSGPALGGGD
FT                   ITVSTLMAPGSLVISVPLRQPALTSKLQPITVTDNRTEDPGWTVTVILTSHETAGLTWN
FT                   PDLLSAAPGESVILGPKTGPRPSLQQPRTLASTQPGASLGTALLSAALYPSGSGAATFT
FT                   LTAI"
FT   sig_peptide     complement(508216..508311)
FT                   /locus_tag="Caci_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.975 at
FT                   residue 32"
FT   gene            complement(508308..509465)
FT                   /locus_tag="Caci_0451"
FT   CDS_pept        complement(508308..509465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0451"
FT                   /product="protein of unknown function DUF916 cell surface
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF916 cell
FT                   surface putative; KEGG: saq:Sare_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69403"
FT                   /db_xref="GOA:C7PX52"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX52"
FT                   /inference="protein motif:PFAM:PF06030"
FT                   /protein_id="ACU69403.1"
FT                   /translation="MPRLRSLIKVLAATAVAGVLLTSPASAGTPPRTDPAPAPAPTAGA
FT                   ATFGIQPATATARDKTRDSFTYQATPGAKKTDYVAVSNYSTSPLTLRIYATDAYNTADG
FT                   GFTVLPLATKPRDVGLWVSFPTTGVTLAAKSSKILPFTLTVPADAKPGDHVGGIMLSLT
FT                   TQAADAKGGQIAVESRVGTRLQVRVPGTLKAQLTVSHISTSYHASSNPFGGGTMTVSYT
FT                   VANTGNVRLSGTQKVHVTSLFGGSKPSLPLANVKELLPGDQERVTATVKSVLPSFSSTA
FT                   HISVVPTPVVGDIDPVLAAVDESASVATIPWPMILLLLALGAFGGVWVWRRRVRVRVRK
FT                   QQAAKAKAKAAKTAPAKKTAVPATAAATATAGAASKAESGKAEDV"
FT   sig_peptide     complement(509382..509465)
FT                   /locus_tag="Caci_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(509613..511190)
FT                   /locus_tag="Caci_0452"
FT   CDS_pept        complement(509613..511190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0452"
FT                   /product="NHL repeat-containing protein"
FT                   /note="KEGG: sus:Acid_6846 NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69404"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX53"
FT                   /inference="similar to AA sequence:KEGG:Acid_6846"
FT                   /protein_id="ACU69404.1"
FT                   /translation="MFSNRFARYAATAVAAATAVGVMTVLSAATASAAASGTITFSPGS
FT                   GADTSVFNVETSGVCPANDTYIDATISGGGFPANAVAINKEPVSVLTATQTGYEIAISN
FT                   NLRQLATNYAVTKLDPNASGQTPYTIDVQCIPALGNTVGADFAGQLTFTSETAWSSASS
FT                   TPTTTTLGLAPTSPVSFGSQVTLTATVNPAAAGSVTFFDGATALNATPVAVANGTASYQ
FT                   TSSLAVGAHTITAAFTSTDANFANSTSAASTYTVGQAGPVATTTSLVSTPGSAQVAGGN
FT                   VDLTASVQPATAAGSVTFMDGATSLGTVAVSNGSAVFNTTALALGSHSLTASFVPTNTT
FT                   AYGSSASPAVPFTVTKYVPPTATETITTTVDAGSLNISVPTGQVSLPDPALNSNGTLFT
FT                   TSGSLETVTVTDNRAGNPGWTASGLATAFAQTGGSVQISAENLGWTPGTPTGSAGQTLT
FT                   TGPSVAPANGVAASDNGALGLSQSRTLVSAASGAGLGTAKIGATLALNVPTTTTAGTYQ
FT                   STLTLTVI"
FT   sig_peptide     complement(511089..511190)
FT                   /locus_tag="Caci_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.386 at
FT                   residue 34"
FT   gene            complement(511249..512247)
FT                   /locus_tag="Caci_0453"
FT   CDS_pept        complement(511249..512247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0920 ABC-type phosphate transport
FT                   system periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69405"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69405.1"
FT                   /translation="MNQKTKKLAVIGAVGLFVLGAAGSAQADPSGAPQFRQLAGVGSDT
FT                   TTPVMNALSNDLTVGGTKVIGSYDATGSTTIATQAGTTCSKIARPNGSGAGRTALLASL
FT                   AAKDGCLQFSRSSSLTLTATGGAQLTYVPFALDGVTYAITGTDTLIPRNLDLATLQSIY
FT                   TCDPTVVGTAPNFSITAMLPQAGSGTRSFWEGKMGITDADVVAGKYACITDKSNGQPIE
FT                   EQDGRVLTDKAIIPYSIASYDAEESQTIQDVRGAAVLGAVGGVAAQQINSSFPVTREVY
FT                   NVIPTADTATAPWSTTFVGSSSLVCADSSTITKFGFTVAPDCGSTTNVTAP"
FT   sig_peptide     complement(512164..512247)
FT                   /locus_tag="Caci_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(512244..515093)
FT                   /locus_tag="Caci_0454"
FT   CDS_pept        complement(512244..515093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69406"
FT                   /db_xref="GOA:C7PX55"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69406.1"
FT                   /translation="MRTLTISRVVSGAFAVCVAVSGLLSGPTSHAAAAAAPQPTPKTNA
FT                   TQTASSPLTKTGTGAFSGMAVTVDKSQDLINEAIGISWTGAPTTLPRNNNTNFGADYLQ
FT                   IMQCWGDNPAGPDASQCEFGGTTLGGPTTRRLNNPQIPDPLLPPAVANDPNQEYEDFVP
FT                   APTAAPTSPYAPPAPVKDPSQIATSFDSSNTNEIPYARTYANGTGHVYFQLDTVRESPA
FT                   LGCGQPVADPAAPGGARIEPCWLVVVPRGTLEADGKTTVDGTNIVLQTSPLSPTNWANR
FT                   IVFPLTFQPAASACAIGANEVQIGGDEMLAEAIKSWEPGLCAHNPKAPFSFSQIGGDAA
FT                   RLQLASPSPGFQFLSKPVTSTPGTPLPSMLYAPAAISGLTISFYIQSQAVVPPPGQPPN
FT                   PPAAQNGVQLTQLNLNARLVAKLVTQSYRWGVDSSIDTPQGAASDLAKQNPRDLTQDPE
FT                   FLTLNPQFKGLSFAGGIPSIVVPFGNADAYTELWTWLKSDPAASEFLSGVADNTGKYGQ
FT                   PGYSGMVLNPNYLRTQFPIEDFPTTDPYCRPTVYQDPSHAGTRNQQSALCGLALHPYPV
FT                   TMHDGVLNATKGSLGLRVSWSPNSANVGSWGPTPPQPDGQVAILVLADAPTAARYGLPA
FT                   ARLCDDRAGVPDPLLPPGQQPSADLDAHCVAPTTDSLLKGVAAAQPSPGAPTMLVPNPI
FT                   PIDLGAYPLTTLTYAATAPSKLTKADGAHYADLLDYIASAGQIQGLDPGDLPPGYAPLP
FT                   AALAAQTAAAAKLLRTAAGVPEAAPIGSAPSSSATSRPAAIVTPHAPSTPPPPRVPVQH
FT                   PPLPKPTGPGPAVVVRGTMPASDLALSAGSTPAVPIGRIRFAVLICLLAAGASVLVGPG
FT                   LLRVARQAAAEGAVDGEPDSSGESDEPGEPDEPDSPGEPADSPEPADPEALDAPDVPAP
FT                   ESPETNPSQDPSPSKGTGQ"
FT   sig_peptide     complement(514989..515093)
FT                   /locus_tag="Caci_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.456 at
FT                   residue 35"
FT   gene            complement(515090..516802)
FT                   /locus_tag="Caci_0455"
FT   CDS_pept        complement(515090..516802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0455"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="KEGG: nca:Noca_0917 phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69407"
FT                   /db_xref="GOA:C7PX56"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX56"
FT                   /inference="similar to AA sequence:KEGG:Noca_0917"
FT                   /protein_id="ACU69407.1"
FT                   /translation="MNRHHPRRRRSPRGRLLLLSAALGLSAAQLLSPPTAGATQYAPIA
FT                   GAGSTWAENAVNQWTSDVAQYGMQVSYTGSGSSDGRNQFKADPATVDFAISDIPYGSVD
FT                   NGTLDTLPDKPFAYMPVVAGGTAFMYHLDIGGHRVTNLRLDDQTIAKIFTGGITTWNDP
FT                   AIAKTNPGLTLPARQIIPVVRTDGSGTTAQLTGWMAAKYPGLWDSFCSAAGRVVSPHCG
FT                   STSFFPPAPAGSAFISQSLDSGVAGYVAQPTSEGAITYTEYSYALQSGFPVAKMLNAAG
FT                   YYTLPTASNVAVSLTQAQIDNDASDPTKYLTENLANVYGYSDPRTYPLSSYSYMIVPLS
FT                   TAPPFNTAKGVTLSAFDYYLLCQGQSTMAPLGYSPLPINLVQAGFNQIRKIPGAVVQNI
FT                   VISSCNNPTFSSSGVNTLVASAPDPPSCDKNGATQCAADGVTAVPGGGSSGGSHGGSSG
FT                   GGSGGSGGSSGGSGGGGGTSGGGTAGGVASGPSNGNPSAHPSSTSNVITVPTTPSSPPV
FT                   SLDGADAVAVPVSVGTSLGDSVGAYLAAAAATLLLTTVFGPPLVSRLRKGRRS"
FT   sig_peptide     complement(516689..516802)
FT                   /locus_tag="Caci_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.559 at
FT                   residue 38"
FT   gene            complement(516799..518133)
FT                   /locus_tag="Caci_0456"
FT   CDS_pept        complement(516799..518133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0456"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0916
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69408"
FT                   /db_xref="GOA:C7PX57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX57"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACU69408.1"
FT                   /translation="MTATDMAAADIAAADMTGLTEEPEDAGTTVPPEPAADDAGPPERR
FT                   RRVRRLKRDALFALLGAAAAAVSLTILISTWFAPFSGPLGFVVLSYPLFLACYAVLVWT
FT                   DESGPILRDRLMAVVTHSIAILVAGVLVLIVGFPIWGGLKSLTHLNFYTQDLRVAGPVQ
FT                   PITIGGLQHAVIGTAEQITITLAITVPLGIACAVFMNESPGRLANLVRTVAAAATALPS
FT                   IVAGLFVFALLILELGLPKSGLAAALALSVMTLPIIIRASDVVLRLVPGHLKEASYALG
FT                   ASRWRTALRVTLPTARSGLATAVILGAARGIGETSPVLLTAGYTQYTNYDPRKGPQTSL
FT                   PLATFKLVTSGQPNYVTRGYGAAALLMLLVLVLFVAARAVGGRGAGQLSRRQRRRRAAT
FT                   SRRVQERFLARRAAREQADPATAAAASATPAATTADRPEPMEHSS"
FT   gene            complement(518135..519256)
FT                   /locus_tag="Caci_0457"
FT   CDS_pept        complement(518135..519256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0457"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0915
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69409"
FT                   /db_xref="GOA:C7PX58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX58"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACU69409.1"
FT                   /translation="MTEQFIPPAGHAQAASAAAGAAGATTAAAANALTHVVDLPPTAGA
FT                   EPPRAVRLKARGGDRVFLTVLAGSGILVLTVIAVIGGFLGSRASQALHAAGGGFLTTAA
FT                   WSPGNGTGRASSFGVAGILTGTVLIGLVAIVIAVPLAFGVALYISEYAPPRLRPFFTSL
FT                   IDLMAAVPSVVYGLWGFLFLEHRAVGVAHWLATYLGWIPGFQVTGARVHDPLAPLTVYT
FT                   ASTFIAGTVVGLMITPIVSSMMRESFSQAPLGEREGAYALGATRWGVIRTVVLPFGRGG
FT                   VIGGAMLGLGRALGETIAVYMIISLVFRIQPHILQAGASSVAALIAAHYGTATPFELSA
FT                   LMAAGLVLFLVTLVINLAASAIIARSRSGRDSG"
FT   sig_peptide     complement(519167..519256)
FT                   /locus_tag="Caci_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.788 at
FT                   residue 30"
FT   gene            complement(519253..519645)
FT                   /locus_tag="Caci_0458"
FT   CDS_pept        complement(519253..519645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69410"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69410.1"
FT                   /translation="MAHTRFHVAPVPGAVGGPASAALPAWRLVGGNNRVLGRAPGCFVD
FT                   FETGYAAVLFLRERIADAVPVLGVAADTGGRTWRLEIGEVVVARSSRTYLRGRENLYNL
FT                   AHFLDSVPLAELPAPTRDERGRVCLA"
FT   sig_peptide     complement(519580..519645)
FT                   /locus_tag="Caci_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.785 at
FT                   residue 22"
FT   gene            520055..521302
FT                   /locus_tag="Caci_0459"
FT   CDS_pept        520055..521302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0459"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: mmi:MMAR_0696
FT                   lipoprotein, LpqK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69411"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX60"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU69411.1"
FT                   /translation="MRTALLCAALLMSAAPLVAVPAHADAGAGARRGPGECAASPAPVS
FT                   GPAGDRARAVADAVAKVRHDLKLRSVITRVTQDGRDVWTGALGPSMTGVPARTDMRFRA
FT                   GSVGIAFMGVMLMQLVDEKRVSLADPISRWLPEVPHADQITLGMLGDSTSGIQDYVKNP
FT                   AFVAELLAHPFKQWTPQELLALANPQTPLYAPGKNFSYSHANYVLLGAALERITHTRLD
FT                   RLLQQRIYPRFGLHATANSFTPDIPAPALHAFTTARGPFEESSFWNPSWTTAPGAVITM
FT                   DVCDLARAGQGVGVGTTLTRQGHQTFLNPGTVGLGTPQPYLPGGDCPAAICIPQTAAAH
FT                   YGLGALVVNGWVFQNPSFTGYAALMAYLPSQHLTIAVSVTTSADTDPDIVNAGKNVAVA
FT                   ISQALVPSNPLTFGPF"
FT   sig_peptide     520055..520129
FT                   /locus_tag="Caci_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 25"
FT   gene            complement(521339..524392)
FT                   /locus_tag="Caci_0460"
FT   CDS_pept        complement(521339..524392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0460"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; Fibronectin type
FT                   III domain protein; type 3a cellulose-binding domain
FT                   protein; SMART: Fibronectin type III domain protein; KEGG:
FT                   tfu:Tfu_2176 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69412"
FT                   /db_xref="GOA:C7PX61"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX61"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACU69412.1"
FT                   /translation="MRLRTPRFRITGPTATLLAGLLVANVLTLAIPTAAHAGTPSATGE
FT                   FDYAEALQDSMLFYESQRSGPLPADNRVSWRGPSDLTDGADHGLDLTGGYHDAGDEVKF
FT                   GLPEAYSMTALAWGAIDDKSGYQKSGQWQYLERDLRWGDDYIIKAHPSPHVFYGQVGDG
FT                   SSDHSFWGPAEVNPEPRPSYAVTESCPGSDLVGQASAAMAASSIVFQTDDPSYSAKLLA
FT                   QAKSLYEFADDYRGKYDACITGASSFYTSFSGYWDELVWGAIWLYKATGDTAYLTKAET
FT                   YFANLNKANQTTTPEYAWTISWDDSSYASYILLAEITGQQQYIDDAERNLDWFTTGYNG
FT                   QHVSMSPGGEAQVDVWGTARYSANEAYLALDFENWLKSQSLDTARQATYHDFAVRQMNY
FT                   ILGDNPNKESYEVGFTNGGTNTAWPQQIHNRPAHDSWDQSMSDPPNTRHLDYGLLVGGP
FT                   TSGDGFTDSRQNYQQTEGALDYNALFSGALAELTTEYGGTPRANFPPTETPDGPEELMQ
FT                   ASPNQTGSNFIEIKAEVVNKSGWPARHLTNGSFRYYFTLDAGETASQLQLTSPYSQCNA
FT                   PGPITQYSGSTYYVTISCAGDDVAPAGQSQFHREVQFRITFPAAHDYTKDWSYQDLVGM
FT                   ATNSTPVNTSHIELYDGSTKVWGTAPGSGTPVTPPGTPGTPTASAITATGATLAWAAST
FT                   PGTNAVAGYDVYSVSGATSTKVASSTTTSAPLTGLTPGTAYTFDVVARDSAGNQSPASP
FT                   TVAVTTTSSSATPPSAPTALTVTATGSTSVGLSWTAAKAGTSAIASYTVYKTGSPATAV
FT                   ATVAAPAITATVSGLTPSTVYQFYVVATDVNGLSSAASSSVSATTTAGTPPPPSSVSVQ
FT                   YETSVTTATTQSFQPLLNVVNNGTSAVPLSSVTIRYWFTSDGGSSTFATNCWYAVIGCA
FT                   KVTQSVSSVTATTGADHYVQVGFTTAAGSLAPGASTGQVQSAINKSDWSNFTQTNDYSF
FT                   NAADTAWTANTNVTVYVNGTLVWGTEPH"
FT   sig_peptide     complement(524279..524392)
FT                   /locus_tag="Caci_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 38"
FT   gene            524639..525700
FT                   /locus_tag="Caci_0461"
FT   CDS_pept        524639..525700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0461"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: sco:SCO4754 transcriptional regulator; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69413"
FT                   /db_xref="GOA:C7PX62"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX62"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69413.1"
FT                   /translation="MAPRRSRNGVDLTAPTTASTTTTTIAAVAEEVGVSVATVSKVLNG
FT                   RSDVAAQTRAKVEESLERHQYRRRAKKKQTGTGQVDLVFHELDSAWAMEIIRGVEAVTE
FT                   PDGVDVVLSQLGGAHHPPQHWLDAVLARRPLGVLFVLCSPTKVQQERLRRQDIPFVVVD
FT                   TDSATTASVPTVGSNNWNGGLVATRHLLELGHRRIGIISGPKDVLCSRARLAGFRAAHE
FT                   EADVEVDPDLVRYGTFYLDAGYEHGMALLDRPDRPTAVFAGSDMQALGVLRAARQLGID
FT                   VPRGLSVIGYDNLEVAAWTDPALTTIDQPIRDMAGTATRMVLDLAHGQDPSSSRIDLVT
FT                   ALVVRESTAPPAG"
FT   sig_peptide     524639..524728
FT                   /locus_tag="Caci_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.718) with cleavage site probability 0.610 at
FT                   residue 30"
FT   gene            complement(525818..526831)
FT                   /locus_tag="Caci_0462"
FT   CDS_pept        complement(525818..526831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0462"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: tfu:Tfu_1213 xylanase; PFAM: glycoside
FT                   hydrolase family 11; SMART: cellulose-binding family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69414"
FT                   /db_xref="GOA:C7PX63"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX63"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ACU69414.1"
FT                   /translation="MPGNSRLPGARRSRRLRMFIGVVLALFLGAMLPSVPASAATSICS
FT                   NQTGTNSGYYYQMWSSGQGSACISLNSGNSYSSTWSGIGDFVAGVGWNPGDKSTKSFTG
FT                   SLNANGGTSLVSLYGWSTSPLVEYYVMENYVGSPPTAGTYMGQVTSDGGTFNIYEHQQV
FT                   NQPSIQGTATFEQYLAIRTSPVSSGTITMSNYINAWSSHGMNLGTLNYQILATEAWGGG
FT                   SGSSNVSVSSGGGGGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSNWTVT
FT                   MNMASPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTISPNGQWTWPSVSCSSS"
FT   sig_peptide     complement(526712..526831)
FT                   /locus_tag="Caci_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 40"
FT   gene            527220..527909
FT                   /locus_tag="Caci_0463"
FT   CDS_pept        527220..527909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69415"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69415.1"
FT                   /translation="MPELIPRLMAPFLPEETRYRLRQHKLDIEAAEKAARILPLPGVTI
FT                   TVLHSTTGARSWRETTLVPTSTPPHMTAWWFTKGSLAWDGNLLTVTGDNDTSPHWPTAQ
FT                   GGVQPEFSADNVAQARHRPVTSGECPAAVVEIASISLRGQRPRRLYFLDEESRHLTMTP
FT                   ARGFTEDQLTTFAHHAGLTYRTYALTTGGKTTPDAMCEALFPRSARRRRVISEHSPSVE
FT                   WQWQGWP"
FT   gene            528026..529117
FT                   /locus_tag="Caci_0464"
FT   CDS_pept        528026..529117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69416"
FT                   /db_xref="GOA:C7PX65"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69416.1"
FT                   /translation="MASRLFDGALINDEPILKAQLKRTWRMLLMVVSASMAVVGLVFVV
FT                   LRNHFGASSDIHNVVLEVGVNLALFGCTTLLVTVIASQQLEHQILGELNTRLNAHVKNV
FT                   GDTMNEVQSEFRKTIETFLPLFGNGRDLGLDNIFLTRTDALIDIESHLRDELKSAAVES
FT                   SRTGGPDDRDGPRARLWFVGTSLKGILEASALGFDGAGILSWAASLAAQDLLDLRVLLT
FT                   HPTFARVRARQEHRAGTAIPEEISEALEFLHAHQVNAACIRMTQASPTVFAIATRERML
FT                   LNPYPYGAEAHRSFSIIVKRVHQEPNDHDSLHRDIFEQYEQRHFVRPWDDGLPVEQGAK
FT                   EDPFVIPEATFNPLRPDGGDPAA"
FT   gene            529167..529403
FT                   /locus_tag="Caci_0465"
FT   CDS_pept        529167..529403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69417.1"
FT                   /translation="MASDQWESDQPNVVLRGGPLDGETLTVKKLRDGIEREVDGWIYAY
FT                   VPTSDPDDEHPACTVFIYVGERPAVWLAGGLAG"
FT   gene            529713..529970
FT                   /locus_tag="Caci_0466"
FT   CDS_pept        529713..529970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69418"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX67"
FT                   /inference="similar to AA sequence:KEGG:SCO3733"
FT                   /protein_id="ACU69418.1"
FT                   /translation="MRFTIAGCSFHLQASDVEQAMSGIKGEPISGACVRIGRRWYPVKQ
FT                   VGAVITGQDRRDFSGAEVTHALERLGYTCRPTPPDAPAQA"
FT   gene            complement(530033..531388)
FT                   /locus_tag="Caci_0467"
FT   CDS_pept        complement(530033..531388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0467"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ace:Acel_1594 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69419"
FT                   /db_xref="GOA:C7PX68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX68"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69419.1"
FT                   /translation="MNLRTRLAVAGGSIVAGALVLVSVVLYPAVDTSLRGQIDKALATA
FT                   AAQAPDVAAYIKSQNAPPDGQTPAAPLFPPISMGIGTTKLQIIPSDVVRIGPSAQFIDV
FT                   SAHDVSVALGGTGPYFQDATYNGVAYRVYTMPFPDSRGSLVRTAIPESDPAPTLHELAW
FT                   LLAASTVAAGLLAALAARLAARRVLRPVGRLTETVELIRATGDLTIPIPAASRDEIGRL
FT                   GAAFSAMTSALDESVGAQRRLVADASHELRTPLTSLTVNLELLAENPSDAQAPLLAAEA
FT                   LGQAGELKALVNDLVDLARFGQAAFHTEDVRLDLVAERVAARAARRAPRIDFELRCAPT
FT                   WVHGDPDALERAFANLVDNAVKWSPAGGRVRISVVKGVVEIADDGPGIPDSDLDFVFDR
FT                   FYRSPAARAHPGSGLGLAIVRQVAETHGGTARAVRCSTGALLRLTLPVSGEA"
FT   sig_peptide     complement(531317..531388)
FT                   /locus_tag="Caci_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.409 at
FT                   residue 24"
FT   gene            complement(531385..532056)
FT                   /locus_tag="Caci_0468"
FT   CDS_pept        complement(531385..532056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0468"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: cur:cur_0545 two-component system response
FT                   regulator MprA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69420"
FT                   /db_xref="GOA:C7PX69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX69"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69420.1"
FT                   /translation="MRILVVDDDPAVRRSLEHALRRDGYDVVSVADGTSALAEHVAFRP
FT                   DAVVLDILMPEPNGLEVCRALRSAGDDTPILMLTARDLVTDRVAGLDAGADDYLAKPFA
FT                   LEELRARLRALLRRSGAQSEVLTFADVRLDLSGWRVERGGRRLELTKTELSLLELFLRN
FT                   PQHVLSRTQIFESVWGYDFGPQSNALWVYISYLRGKLEADGGARLIQTVRGLGYVLREE
FT                   P"
FT   gene            complement(532141..532827)
FT                   /locus_tag="Caci_0469"
FT   CDS_pept        complement(532141..532827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpl:lp_0373 cell surface protein precursor
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69421.1"
FT                   /translation="MVKRKRVVAVVVAIAALGATGTASAATSGNTPAPSPTKSGAPAVA
FT                   GNDTSVDKSAGKSDGKSDGKSADAGKDEFAALAAKLGVTTDRLNAAMVAAKMSLASTNG
FT                   GTPQAFYAAIAANLGLPVARVQDALGTEIFRKGPEGGKPSKHGVPGPSPFTTDSAAAFV
FT                   AHELGVDQKKAKTALAAVVALDDARGGVDPTSKAFGDIAASLGVSSSRLATALTDLKMS
FT                   IGGTKG"
FT   sig_peptide     complement(532750..532827)
FT                   /locus_tag="Caci_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            complement(532923..533627)
FT                   /locus_tag="Caci_0470"
FT   CDS_pept        complement(532923..533627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0470"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: fra:Francci3_2444 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69422"
FT                   /db_xref="GOA:C7PX71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX71"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69422.1"
FT                   /translation="MRVLVVEDVRRLADDIGEGLRDQGMAVDIAYDGLTASEKCASTDY
FT                   DVVVLDRDLPGLHGDVLCRQIAESANPALVLMLTAAGSPGERVQGLRLGADDYLPKPFH
FT                   FPELVLRVQALARRRPAARPRVLRAAGIELDPTLRTATRLGRPLRLSPKEFEVLAALLA
FT                   AAPAPMSAEHLLEKVWDENADPFTRTVSVTVGRLRRKLGAPDVVVTIAGAGYGIGVSGD
FT                   EDGSSGAVLREL"
FT   gene            complement(533624..534736)
FT                   /locus_tag="Caci_0471"
FT   CDS_pept        complement(533624..534736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0471"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   fra:Francci3_2445 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69423"
FT                   /db_xref="GOA:C7PX72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX72"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69423.1"
FT                   /translation="MRLTLLYAALFLASGIVLLAVALYLVFRNPILVTFDPTPPSLPSP
FT                   MPGRSDVLRVFRPATGTVSPTWATVRAAAAQSAGVLAAMAAVSTLLGWIVAGRVLSPLR
FT                   TMAFRTRRISEQNLHERLALTGPRDEMTELATTIDGLLGRLEAAFEAQRRFIANASHEL
FT                   RTPLAMMRTSLDVAVAKPGRPREVDVLGGKLREGLDAADRLLEGLLLLARTQNVERMET
FT                   SAVSLPDLLDAALHARRATIEDKRLLVEQKVEPVLYRGNDTLLASLVDNLVDNAIRHNE
FT                   PGGWLRAQVTVPRGEHDRTRIIVENGGPLLTRAEVDLLGQPFQRLGSQRTSQPGTGLGL
FT                   SIIAAIAEVHHGRLLLQARDEGGLRAEVEL"
FT   sig_peptide     complement(534677..534736)
FT                   /locus_tag="Caci_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.427 at
FT                   residue 20"
FT   gene            534855..536432
FT                   /locus_tag="Caci_0472"
FT   CDS_pept        534855..536432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0472"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; TAP domain
FT                   protein; KEGG: sco:SCO7650 secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69424"
FT                   /db_xref="GOA:C7PX73"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX73"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69424.1"
FT                   /translation="MKLSKRNGVAALGLALGVAGVGLSGTASATPDAASQASAISAITW
FT                   QACPQYSDDVLGAVGIQPKDRAAFRDMWARTDCGTVSVPQDYRHPEGQHVTIAFTRLKA
FT                   KDQAHRQGILFMNPGGPGGSGYLMPEQVALQNPSDAQLNDQYDLIGFDPRGIGYSTSED
FT                   CAGFLNGPPPQSGQLTKAQVKQAYDASAKTNAECSSSDPAFLGQLTTANAARDLDQLRR
FT                   ALHESQASYFGVSWGTQLGAVYRSMFPATIHRMWLDSVVSPRAYDLAYRMDGAAQSVEQ
FT                   DFGLFATWLAQHDDVYGLGTTAQSVTARVLALRKQGDAHPWQFSDLSEPLDGGFIASLA
FT                   SSQNTDWEQAAAVLKSMTAAVSGQPAPPGVKAVANGHGPLPPPPSGAPQAFNPTAQQAY
FT                   LCNEDDSSRAFEPLWDEYQRNLQRDPVTGDLTALRPTCAGWNLPVQHFTLRYSPGSLQM
FT                   SGHEYETLTPYPWVWQMQQAIGGTVFTVDDFRHGSLALVPECASHLIAYFETGKADSGS
FT                   CPGLQPSA"
FT   sig_peptide     534855..534944
FT                   /locus_tag="Caci_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 30"
FT   gene            536641..538062
FT                   /locus_tag="Caci_0473"
FT   CDS_pept        536641..538062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69425"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX74"
FT                   /inference="similar to AA sequence:KEGG:SAV_1931"
FT                   /protein_id="ACU69425.1"
FT                   /translation="MAESRRGVVTGRPYLTPEERVKRGRSARRDAPRSSHGEWEPAPDR
FT                   RPVIDQLEAQASTSVADLVPIRYGRMIESPFRFYRGAASIMAADLASTPRSEMRAQLCG
FT                   DAHLLNFRLLGSPERRLVFDINDFDETLRGPWEWDVKRLAASLAIAGRENGFDDHQREI
FT                   VVRTMAGGYREAMRAFAGMTSLDVWYAHGSTERIRELYTDQLDAQRRKNFRRMLEKAKG
FT                   RDSLQAAEKLTTTVDGRPRIVADPPLVVPLADLLPDLERGEVEAWIRDLVRRYSRSLRS
FT                   DLRMLLDQYRVVDMARKVVGVGSVGTRCWIVLLAGSDEQDPLFLQIKEANRSVLADYAG
FT                   ESPYAHQGHRVVAGQRLMQAVGDILLGWKRGEDAHGGSHDFYVRQLRDWKGILESRTMV
FT                   PHSMRIFGELCGATLARAHARSSDRIAIASYLGKGDGFDRALARFAEVYADQNERDHQA
FT                   LVEAVDRGRIRAQAA"
FT   gene            complement(538153..539637)
FT                   /locus_tag="Caci_0474"
FT   CDS_pept        complement(538153..539637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0474"
FT                   /product="glycoside hydrolase family 11"
FT                   /note="PFAM: glycoside hydrolase family 11; Ig family
FT                   protein; cellulose-binding family II; SMART:
FT                   cellulose-binding family II; Dystroglycan- type cadherin
FT                   domain protein; KEGG: sde:Sde_3061 xylanase/chitin
FT                   deacetylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69426"
FT                   /db_xref="GOA:C7PX75"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX75"
FT                   /inference="protein motif:PFAM:PF00457"
FT                   /protein_id="ACU69426.1"
FT                   /translation="MLAGVMALLPGTAGAATTICSSQTNTVSGYWYSFWTEGSGSACMT
FT                   FGSAGNYSTSWSNAGNFVAGLGWSTGGRKTVSYSGSFNPSGNGYLSLYGWTTNPLVEYY
FT                   ITDSWGSYRPTGTYKGTVTSDGGTYDIYETTRYNEPSIIGTATFNQYWAVRQSKRVGGT
FT                   ITTGNFFDAWASHGMNMGQYNYMILATEGYQSSGNSNITIGGSVTNTVTVTNPGSQSTT
FT                   AGSPASVQVHASDSASGQTLAYTASGLPPGLSINSGSGLISGTPTTPGSYQVTVTGTDT
FT                   TGAKGSATFTWTVGSETGTLVTVTSPGNQTGSVGTAISPIQIQATDSAGQALTYSATGL
FT                   PAGLSISSSGVISGTPTAAGTSDVTVTASDSSGSGSATFTWSISGGGTTTGVCHATYAR
FT                   TSEWPGGFTANVTIANTGTTAVNGWTLGWSFPGDQKITNAWSATATQSGSNVTATNVAY
FT                   NGSIAPGGTTSFGFQGTYGSNDSSPTAFTLNGTACS"
FT   sig_peptide     complement(539590..539637)
FT                   /locus_tag="Caci_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.447 at
FT                   residue 16"
FT   gene            540297..541307
FT                   /locus_tag="Caci_0475"
FT   CDS_pept        540297..541307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0475"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; SMART:
FT                   cellulose-binding family II; KEGG: sco:SCO2291 secreted
FT                   acetylxylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69427"
FT                   /db_xref="GOA:C7PX76"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX76"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACU69427.1"
FT                   /translation="MRIRPRSWRRSLTSGLAAAALALAGALTVGVGAPVAHAATCGGYV
FT                   GLSFDDGPSNDHTPAILNALKQNGLRATMFNEGQYAAAYPAQVQAEINAGMWVGNHSYT
FT                   HPHLIQESQAQIDSEVSRTQQAIAAAGGGTPTLFRPPYGETNSTLRAVEAKYGLTEIIW
FT                   DIDSQDWNGASVSAIVAANGRLTNGQVILMHEWPANTLAAIPQIAQVLASHNLCPGMIS
FT                   PQTGRAVAPTGGSGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSTWTVTM
FT                   NMVSPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTITPNGQWTWPSVSCSTT"
FT   sig_peptide     540297..540413
FT                   /locus_tag="Caci_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 39"
FT   gene            541555..542346
FT                   /locus_tag="Caci_0476"
FT   CDS_pept        541555..542346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69428"
FT                   /db_xref="GOA:C7PX77"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX77"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6463"
FT                   /protein_id="ACU69428.1"
FT                   /translation="MSSPDTVIAALRSEYDLLAQQVAAFSDDDLAGPSAASEWDISEVL
FT                   SHLGSGAEINRATLQAALDGTAPGGREFNESVWDRWNAMSGRERADGFVAANRELTELY
FT                   ESLDAETRENLRIDMGFLPAPIDVATAGRMRLNELAMHSWDIRVASDVNATLAPQAVRE
FT                   LLHGEPDLTAWTSKPEHLDGESLVLHVTTSEPESDFALNLTTPVSTSFEVADKYDGTLT
FT                   LPAEAWLRLKVGRLAPQHTPTGIVTTGAADLDLLRKVFPGY"
FT   gene            542651..543949
FT                   /locus_tag="Caci_0477"
FT   CDS_pept        542651..543949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0477"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cms:CMS_0868 putative solute-binding transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX78"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69429.1"
FT                   /translation="MTTRMRSAIAVFLGLGTMLAATGCAGSSGGGGGGSSDGKVTVTVW
FT                   ENATNGPDGLQYFQSAAKQYQALHPNVTISFQTIQNEALDGKLQTALNSNSAPDVFFQV
FT                   GGGKMRAQVAAGELQPLNLTDADKTDVGAAALSGSTLDGKVYMMPVDTQPEGIYYSKNL
FT                   FQQAGITTTPTTIDELEADVAKLKAINVAPIAVGAKDAWPAAHWYYNFALRECSQSVMA
FT                   STAKSLKFTDPCWTTAGNALATFLKTNPFPAGFLTTAAQQGAGSSAGLLANHKAAMELM
FT                   GSWDPGVIASLTPDQKPLPDLGWFPFPAVAGGQGDPSAIMGGNSAYSLSKKAPKEAFGF
FT                   LEFMLTKDQQEAYSKAFQSIPVNPASQDVVTTSYNISALQAFNKAAYSMQYLDTQFGLN
FT                   VGNALNTAVVNLMAGRGSAAEIVTQANAAAAKG"
FT   sig_peptide     542651..542728
FT                   /locus_tag="Caci_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.335 at
FT                   residue 26"
FT   gene            complement(544071..545078)
FT                   /locus_tag="Caci_0478"
FT   CDS_pept        complement(544071..545078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0478"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bsu:BSU07300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69430"
FT                   /db_xref="GOA:C7PX79"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX79"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69430.1"
FT                   /translation="MKVSIIMATYDKRDYLEYTLASLAGQTHSDFELVLCDDGTEGGVA
FT                   DLIAPYRDRFAIVPLVQANAGRAAARNTALARASGDLVVFSDDDRILPPEFLAAHVSAH
FT                   SAGGEEDLAVIGWKKRGVTVWIPRMLPVDESDLTTLARRVGGVEPLASPLRTIEPGDVA
FT                   VSYPVAVSRMELGDEPDNYHAIVDKYGDELADFRFGWVLATTANLSVPRALLDKIGGFD
FT                   DGFQGWGVEDTDLSYRLWQAGTRFRIERAAVNHHQVHPIGTGNALLDNRRRRAALMANV
FT                   EFFCRKHQTLEAYLFKRRWEHAMTLDEANRLLAEVEAGVGHSVREELLRLYAAA"
FT   gene            complement(545134..546588)
FT                   /locus_tag="Caci_0479"
FT   CDS_pept        complement(545134..546588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0479"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: amr:AM1_E0096
FT                   cytochrome P450 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69431"
FT                   /db_xref="GOA:C7PX80"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX80"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU69431.1"
FT                   /translation="MTEIAERPPVPVPVPVPGPEPARLLGRRLNRQRYFKDPVGYTCAV
FT                   YHRFGPVSGLTHGDRQHFFAFGAEQNRTVLLDDGTFHTAFEYATPPMIKAARRGIGLLN
FT                   MNGPPHQAARRLVAPAFRASAVRGYGEAVALITRAEVDSWSQGDRFDLSVRMRELTLRI
FT                   VCLVLFGVDIAEDARPLGRLVQRMLALRYFAPSIRYFPFNVPGAPLARLLGVIRDLDDA
FT                   LDGIVATRRDGGGRDLLSGLMEARAEDGGPALSADELIGHLTTFIVAGHETTSNTLSWA
FT                   FAILDQHPDIADALTGEVGALPEDVESRLAEIDKLPLLDAVVKEVLRLMPPGPNTSRVA
FT                   VAPTELGGFEIPPGSQVVTSKFVTHRDESLFPDPLRFHPDRWATQGPVSVYQYLPFGVG
FT                   PHVCVGAAFATLEMKIILAEVLRRWSPRVADGADLSRDVGLMMAPKNGVSVILRPPGTP
FT                   RAGGRVVGDIHQMVRLTDRDIDRLGW"
FT   gene            complement(546640..547785)
FT                   /locus_tag="Caci_0480"
FT   CDS_pept        complement(546640..547785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69432"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX81"
FT                   /inference="similar to AA sequence:KEGG:SGR_588"
FT                   /protein_id="ACU69432.1"
FT                   /translation="MIRDGALVLSAAVMTHPDREAEVRRFVERHPELELRIAVDPEPER
FT                   GHSLGTALLAWSMVEPGATHHLVLQDDVVLCEGFVDLMVAAVRTHPDAAVSMFAEWGAR
FT                   AGTLVRLALLRGQGYAAVADPYIPTQALVLPAAQAADFAEKGRTETEPDDIALLNHLRR
FT                   TGTRGVVVAPNLVQHQDRPSLTGNTFQGPRLSACFVPDPPAGLLAALEPTVAGADLDFL
FT                   PHVSWMRLIGEWFYCGPDEEAVWTGWPLAERLPPELDAAWLRSQYDAHLRQSDRREEIR
FT                   KTLSDTVLFEVWLACLALGLVSGVTPAGVVARAADPLWQAALATVLPGAFRRYLPAPVL
FT                   DRLGPYAAELFGLAIHEGATVAAGGEQDTVHAIAHRGARWP"
FT   gene            complement(547782..549041)
FT                   /locus_tag="Caci_0481"
FT   CDS_pept        complement(547782..549041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0481"
FT                   /product="glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   lxx:Lxx06832 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69433"
FT                   /db_xref="GOA:C7PX82"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX82"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACU69433.1"
FT                   /translation="MTLFESPRLRVLFVAFSRSSLGHIVRSTTAAARFAADGHDVAVAC
FT                   HEEVRHIPEKAGLAWLPIEEIGPAPAWRGMDDPEQLRAFVRTRLASPEYVSASLEDELR
FT                   VIDLFRPDVVIADMRNTAGVAASMRGVTAFTLHNLRLFQHPMHVVLPEVLVTLDQLGVE
FT                   QAHARHVLGSTVLVPDIAEIDGLSDVPRDTAALICSLTDEIRHLGPLLSPELLSVAARA
FT                   SESESGPGPRATENRRRLLHVTLGGSGVGDQQIRRVVEAVAGLGLDIGVTLGAESLQDQ
FT                   VTALEDELAAVAGDSAVTVTGFRHDVVERVAAADAAVVHGGHGSIIEALVCGTPLVFLP
FT                   GSLEQRENARKIRELGLGVVLAPDDDAAAVRAKVVKALSLKETPGPRRFARALVAADGA
FT                   GRLVDYVTSSQAIRTAVAAP"
FT   gene            complement(549102..550478)
FT                   /locus_tag="Caci_0482"
FT   CDS_pept        complement(549102..550478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0482"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lxx:Lxx06835 major facilitator superfamily H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69434"
FT                   /db_xref="GOA:C7PX83"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX83"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69434.1"
FT                   /translation="MERGARVDGDSVPAESAGSGAAAPAERRAPEPKPEPEPEPADKRS
FT                   VLRDHDFRALLASKSASTVASAVTWVVLPLYVYTVSRSSLLTAVASAMNVIPYVLFGIV
FT                   AGALVDRSSPRRVMIVVELGNAAIMLTVPALHAGHVLSIAVLCAVGFTSATAFVWFDVA
FT                   SSTLVPSVVGKTAVFHANGFLWSVATLVQAVAAPTGFFLLNRWGIGWTFAALSLFYALS
FT                   ALFLAMVRMPSAASGGVAAGAPASAGGPGRAMLEGLQFIVREPTIRLLTIIGMGSGISA
FT                   GAVYGMIVVFANRALHLGTDDYRISWILAASSAGALLASFAAPRLRGLPPIPSVAGLLV
FT                   VDTVLMAGYALSADWQMALGAILLWNLAHTTLMIVSISLRQVLAPPRLQGRVNAAGKML
FT                   AWGSVPLGSALCGALTGWIGSRQASLLLVAPIAASLVLAAAMVVRRPAVTDPSKASESP
FT                   "
FT   gene            complement(550499..550663)
FT                   /locus_tag="Caci_0483"
FT   CDS_pept        complement(550499..550663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69435"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69435.1"
FT                   /translation="MSTSMFRPARRTRFPVHVQTGGAQAVEDDDEGLDSLYRLMPIPRS
FT                   VQPRVGITS"
FT   gene            complement(550952..552922)
FT                   /locus_tag="Caci_0484"
FT   CDS_pept        complement(550952..552922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0484"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; WD40 domain protein beta Propeller;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69436"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX85"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69436.1"
FT                   /translation="MPEFRKSVTTIAVAAGSLSAVLGMSSAAQADSRSAAAAVSAVAPL
FT                   PGTGLPAVSNGPIYIQGPSGGGFMPVGGGNPVVCDAYASVMAWSPDGSRIACLEAYSAG
FT                   VLRIRNPDDNRVVSAGSVTDYAKPDSPLAKISSLTWFNHGREVVLAQNGSLISVRVDGS
FT                   QPRNPDNSYAPTAMLPGQTGITDVTANAAGTVLAFTQGTSTGASVIVYDTTKPAASALR
FT                   PLAQVSYASQLALSPDGRYLAYVPYTPGQNAPSQIWLYDLKSPASASNPRQVTSDSAVS
FT                   ASNPTWAPDGTRLAFTATSASLAHSVKSFPVADPSSQRVEVPTLTYQSFLWRPLTHKPV
FT                   ERLAGGDRVGTAVATSQSEWEGFGGASTGRRTAKSVTLSRSDLFADALGGAGFAAHQQG
FT                   PLLLTDPKHMDQATMTELRRVLGPGSGPNGPTVYLLGGDSALSPDVQKALVAANYHVER
FT                   IGGANRFDTAVKIAQRDSGTKPSKVLVATGIDYPDALAAGAAAGANANAVVVLTNDKKM
FT                   PPETAAYLNSVAGATVYGVGGQAVAALGNRPQTALKGTDRVATSLLVARNLFDTPGSVG
FT                   FATSMNWPDSLAGGALQGTVGGPLILVAPTTGLSADEQQWLTQSATAINSVQIYGGRAA
FT                   VPAIEAQVGTDIGGVGGFVVK"
FT   sig_peptide     complement(552830..552922)
FT                   /locus_tag="Caci_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 31"
FT   gene            complement(553873..556104)
FT                   /locus_tag="Caci_0485"
FT   CDS_pept        complement(553873..556104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: paa:Paes_2382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69437"
FT                   /db_xref="GOA:C7PX86"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69437.1"
FT                   /translation="MRDFTVLSDREFEELVADLLQARFGTHVERFPPGRDGGVDLRWRS
FT                   GAETVIGQCKHYARSGYSALLRELRRETKKVAKRKPDDYWVVTSVDLTSHRKDEIHGLF
FT                   QPWMRSSANVLGPLDLDGMLTEFTAVERRHVKLLFSTGEQLTALVHSGIVNRTQALLKR
FT                   IERARPAYAVTDAHRRAAELLEKHRVCVLVGPPGIGKTSLGMMLVAQAIGDGCQPVEVS
FT                   EDIDDAFAMLRAGEKQIFFYDDFLGELSYGERWGRKNEQKRIGHFIDHVAQSSSALLVM
FT                   TSREYILRDAGRMLETVRRVAAEPFVLRLAEIPPPDSGRVLYNHLWHAGLPDTARHDLA
FT                   GSGWTRIAGHHGFNPRVVEWCVQPEFVGDGGRYVSRVVDALDNPETIWETVFNGLPEFD
FT                   RLVLYVLSTLHGRFSTVEWASTVLDALCRETGLRFTGDDLRRALDVLEGTFTRIELVTH
FT                   WSSGEQEAVREVRFMNPSIRAFVLGRIAADVFACRAVLRTATDLNALELLWFGDEQGLM
FT                   DGLRLWPSRLSPQVRAEFVAAAQRLTDRSQRYYRAILFWNCMPHEWLPDRAWLTRAMEA
FT                   HIVELAADDEEDTIDPFTYNVVLRDLAGTDVGMRLHACVDAKTDVDRFENYLDDWDRLA
FT                   EHIRIHRRSCDLAGSAKVLESYEGFVDGELERMRETSGGPDIENLLQMASIAGILGLPG
FT                   LMQRLRDAVQLVRTSDGDGYPQQVAESIQVSWGTDLVQDFDRLLRPEHS"
FT   gene            complement(556566..557876)
FT                   /locus_tag="Caci_0486"
FT   CDS_pept        complement(556566..557876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69438"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX87"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1081"
FT                   /protein_id="ACU69438.1"
FT                   /translation="MAGPDVPTDRVDHNRLRRLLGAPELAWLVDRVVERLAAGTTAADG
FT                   AVALTDPSPEQRRAVERLLGRPPGRGRTLTIRLGDVEAVLRDAEISPDGLAAAVTALRG
FT                   PIPVRHETAAAERTAWDSAHEPLEHLVAVRPDLAPWLRHVRATGLLKRHAPTSGTALDL
FT                   AGQAARVLAALPHPGTVRPILAAGAVGDAHALDDGRPLTALVLSAIRSLSGLAAADTTH
FT                   AEGRRAAWAGVGVATDHLSSRVLVLNVPPPPGDDSTLSRLLRLMATDGEPVTLTLRQLR
FT                   ALPAGHADLAGQTVSVCENPAVISAAADALGAACPPLLCLEGTPSVAAISLLRWILGRG
FT                   ARVRYHGDFDSGGIRIAVQVFALAARAGVPAVPWRYDSAAYLDAVALGLGSPLSAPVSP
FT                   DAPWDPDLRHHLETNAVRVEEEHVVDMLLGDLACGDC"
FT   gene            complement(557882..562102)
FT                   /locus_tag="Caci_0487"
FT   CDS_pept        complement(557882..562102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69439"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX88"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1082"
FT                   /protein_id="ACU69439.1"
FT                   /translation="MTTMTADPTDLPCPSRDRWQPLRAGLVDVFYYDAEEFRFYDGRLL
FT                   LRGNNGTGKSKVLALTLPFLLDGELTPSRVEPDGDRAKRMEWNLLLGGKHPNDERLGYT
FT                   WLEFGRLDENGVPQYRTVGCGLKAVKGRGIADHWFFVTDERVGPGLPLRNEHRVSYSRK
FT                   ALEEKIGAHAVFTTAKAYRRAVDEALFGLGAERYEALVNLLIQLRQPQLSKKPDEKLLS
FT                   KALTEALPPLADGLVGEIAEAFRGLQDERDALAALIEAHGAANAFLAHYRRYAQVAAKR
FT                   IAAGVRQSHSRYEQLGRDLGAATAAREQAHAAFTTAEGELTELDERQTLLTAQKDAYNR
FT                   DPAMGTAREIDRLAKAAETLAAVARTRAEDRHRAVRDADSWMHRSEQARQRAQSDAADV
FT                   DGRHREADAAGQAAGIDHGTLRSVIAAASAQADPPAPPIPSREASEDSIAAVEAAVAVA
FT                   RRSSDALIRDRQQAISGLRNLHQASETAARALAAARAAAERAAQRATASAEHAAASSGA
FT                   VAARGESLVAAWESWNSHCVETVLPDRDAAGSELELWVRTLDGPNPFARRAEEAGRVHA
FT                   AHLNRRVADVDGRRTRAEAERSALAAEIARLEQGGHNAPPAPRTRAADARSDRPGAPLW
FT                   KVVDYQDHVTAADRAGLEAALEASGLLDAWLAPDGRLLDDVTGDVVLAPTAAAPDVGLA
FT                   AVLRPAIDTADPQAAALEETAVAAVLAAIGGVPVGAAEPGHHTWISPDGRFRVGVLRGA
FT                   WRKESAHYIGERARETARRARLAELAGQTARLAAEIAALTGEARTVTARLDALAAELRE
FT                   QPSDAALREANTLAAAHADAAREAVAARDEALAAVEPAAEAAAEAVAATLTFAEDTRLP
FT                   AEAAALEAVAEALADYRHSLSGLWPAVTAAARAAAEAAMAEHERRVATARLAEADEAGL
FT                   AARHDAEAAAEEHRALVATSGAAVEELYRRLEAVRVELAAASAAATAVRARREQALKDR
FT                   ERAEGRRLQLESDIAEVAGLRDEAITVLRRFTATGLLAAALPDLEHPDPAEAWVPAPAV
FT                   TLARAIDAALAAVDEADGAWERVQARVVREQQELSGALARHGHQVGMTLQDGLMVVDVL
FT                   FAGRTQDIPALTSALDAEVAQRTRLLSAKERELLENHLVGEVAGALQELITEAEATVQA
FT                   MNDDLEARPTSTGMALRLVWRTAKGAPEGLEAIRTRLLRKAVDAWSPADRAAVGDFLAR
FT                   RITDDRAANPADTWHDQLTRAFDYRAWHEFGIQRRTDGAWTSASGPASGGERVLAASVP
FT                   LFAAASSHYSSGHPHAPRLIALDEAFAGVDDDSRAKCLGLLAAFDLDVVMTSEREWACY
FT                   PTVPGIGIAQLARAEGVDAVLVTPWRWDGRDRLRLTRPEPYLPPQRARDTPVPTDFEPS
FT                   LFDD"
FT   gene            complement(562099..563382)
FT                   /locus_tag="Caci_0488"
FT   CDS_pept        complement(562099..563382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69440"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX89"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1083"
FT                   /protein_id="ACU69440.1"
FT                   /translation="MSAVDTAAGQPDPAAFGHTVSDETVTGQTSPHQPSDHHVERRRAA
FT                   RALLASPLLTARDDDFRLVRKHAAELAGWFADQAGWRLTVDAETARLFKKPAALDDATR
FT                   PAHAPKSKVPFTRRRYVLLCLALAVLERSESQTTLGRLAEGVLTGAADPALTEAGITFA
FT                   MERREERADLVAVVRLLLAWGVLTRVQGDEDAFVADSGNDVLYDLDRRVTGGLLATSRS
FT                   ASTVTATAFEQRLTTLAAEPIPDTDDLRLRSLRHAMTRRLLDDPVVYYADLTEPERAYL
FT                   AGQRVAITRRITDLTGLIPEMRAEGIAMVDPDDALTDVRMPEQGTDGHVTLLIATKLAT
FT                   DGMAPTVPELIRFVQAQARLHVSYWRKTAAEPAAAADLAEQAVAKLEALNLVIRVPDDH
FT                   GDVRIHPRSALMRFTMTDPTIKKAGARA"
FT   gene            complement(563379..565001)
FT                   /locus_tag="Caci_0489"
FT   CDS_pept        complement(563379..565001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69441"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX90"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1084"
FT                   /protein_id="ACU69441.1"
FT                   /translation="MADVTDAPAPQPFAYLGTPNAPLYTGILDVFALAKQRFTVHLRPE
FT                   DVLADWPGARAGDRADAVRPAAEHLVQALDRLVEWGNLRSDADTGRVTTVEDFNRARRI
FT                   YQLTRHGQAALAAIEHYEQTLGQRGRLQTVALADIAEQLSALAVHAEAAEAPDQATVGL
FT                   LLFALTERFTGLADNAEAFMSSLRRTVDFSDGDGDEEAFLAYKDRLIEYIDKFIADLAN
FT                   RGAQIAGLIERIETAGIARILDAAACREAVDALPDVDRADVADAPDVYTAAVQAVTRDW
FT                   ENRWRGLREWFVSSGSRRPSQARLLRNAAVSGITNLVNTVAALNERRGGRSDRSADLRA
FT                   LARFFAQAPDDAAAHRLWRAAFALSPARHLTVDADTEDAWEQAEYPPGTPWAAAASLQI
FT                   SPRLRETGSYERRGAPNRAVDREAGRRQLAERAEREAAEIAEARRLLATDGPVLLSELA
FT                   GDAGLDPRAFRLFLSVLGDALAARRPGIATTTATSGDGTMEIRLKLVDAGQIVTIPTED
FT                   GVLSGPEHVVEIIDLTARPAAVR"
FT   gene            complement(565426..566430)
FT                   /pseudo
FT                   /locus_tag="Caci_0490"
FT   gene            complement(566465..567587)
FT                   /pseudo
FT                   /locus_tag="Caci_0491"
FT   gene            568223..569434
FT                   /locus_tag="Caci_0492"
FT   CDS_pept        568223..569434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69442"
FT                   /db_xref="GOA:C7PX91"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69442.1"
FT                   /translation="MPHFFFSYSRKDAPDEYLYRFYDDLCREISVRSHFTIESAGFIDK
FT                   NQPVGGEWEDSIGVALGTCDVFVPVYSPSLFGSSNCGQEWHAFGTRQSRAGKLAPHIVP
FT                   VWWVPTPGELPTIADRIQDTRSQFGAEYQKYGLRYLMQLKENESLYRDFLVKFTMMVLA
FT                   AGENPPELMRDLSLAGAPNAFALKPETTGGRARPRSGLKAGGIKSVRFVVAAGSRDEMR
FT                   TIRAAVDAYGAGSLDWQPYHPEHPDPIVLHAQGVAIAHRMVSSFKAAMDDDLFELLERC
FT                   QASREPVVLIVDPWVVELDAYKDLLARLDTARFGTTAVVVPWESGATIESNLRDILTVH
FT                   LGNWMYAGERFFRDDIRSMGEFEANLGEVLVDMWSRIVKWSDAVRRVDESGPASRPILT
FT                   GPGS"
FT   gene            569440..572580
FT                   /locus_tag="Caci_0493"
FT   CDS_pept        569440..572580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5724 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69443"
FT                   /db_xref="GOA:C7PX92"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69443.1"
FT                   /translation="MKGSIITFYSYKGGTGRSMALANAAWILASNGLRVLVVDWDLEAP
FT                   GLHRYFHPFLSDRDLRTSMGLIDLVWEFVAAALDSEAQDEPGWHEDFARISPYAMSIDF
FT                   DFPGRGTVDLVPAGKQDASYSALVSSFDWGNFYERLGGGGYLEALKRDMRLHYDYVLID
FT                   SRTGLSDTAGICTVHLPDILVNCFSLSTQAIDGAAAVAGSVHRQRENRQVRIFPVPMRV
FT                   EDGEQDKLDASRDFARERFGRFLFHVSDPERYWGEVEVPYKSFYAYEEILATFGDRPQQ
FT                   ENSVLAATERIVGYLSDGQVTALSSSLSESERRVWLTRFQRNGPKLSRTELDVRLPGPP
FT                   LKIFISYAHDSHEHFEEVRELWFLLRANGTDAQLGSPDNERRWNGPVPTATEIRTADLI
FT                   IVAVSPLYRRSTGDDGQTSGDESGAGVEARLIRDEVQGGYSVQRIIPVVLPSAAVTEVP
FT                   AYLADSPVRPVIVEQLTADGIRPLLRQVARFKRVDHKRADFNPSWRENLPKPEPDLEQA
FT                   ALQLARSVASGWEVSAAATLSRPPLATRWSGSQRRGSFDDLVNIFLTSSRGRLLVLGSA
FT                   GSGKTTTAVRLLLDLLARRTDEPIPILLAVATWRPDVEHINTWIIRRLQEDYTVGGIAE
FT                   RLVTTGMILPILDGLDELPVTQRALALDALSTLRINQPFVATCRTGDYRQVAAELGQML
FT                   ANTVVVELEPITSNDIRAYLAVDLPDSDRRWQPVFAHLREFPGGLLAQSMSNPFMLDLM
FT                   RDAYRRPNTDPAELLNNRLFPTTQAIEHRLFGTFIGRAYAPRPSTRPESTYDASSADRW
FT                   LSFLARSLHEQHTRDLSWWHLHRVLPPGGLRTLLALAAGFFGALMLGLAGLRFDVLPDI
FT                   AAIPGWVKGALAGTGLGLFVALVAREPVQLSKPSPRRAEPSPRRRQLGRLVGISADLNQ
FT                   ASSPAAALLIERRTVSTVGLLMVLVIGISELVSGIPRALVEPIVATAVGLIMVRFSTSS
FT                   WGWYSVTRWWLALRGVLPLRVMRFLGDAHARGVLRQQGVAYQFRDVALLEWFAGDHI"
FT   gene            complement(572571..573023)
FT                   /locus_tag="Caci_0494"
FT   CDS_pept        complement(572571..573023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_1675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69444"
FT                   /db_xref="GOA:C7PX93"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69444.1"
FT                   /translation="MATDSGAARQESSYALGLANGSYDWYRQAAIHARQRHRISAIGSQ
FT                   VAAAAIPVSAVIAPHNATVPAILGAVIVVVTSLRSTFNWQENYLRFNGAREAVEAERRR
FT                   YHTTSAPYGDPTSRDQILAAMISKIEQEEMAGWVKVVSERTQTGHI"
FT   gene            complement(573548..574078)
FT                   /locus_tag="Caci_0495"
FT   CDS_pept        complement(573548..574078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69445"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69445.1"
FT                   /translation="MSTSPGMFGPVSAKGRTGQISFDGRAITITRGGILARGLSGSGTT
FT                   TVPIEQVTGVDFKPTGANHGRITILVAGTVAPRQNSTRSSTDPMTVDFTLHSNDFRRVR
FT                   DAIDTALRNRTAMTTSGWTMPPPPPPPGWAPPTMPAQEPSLADQIGNLARLKEHGHLSE
FT                   EEFAVAKAKLLGL"
FT   gene            574640..575116
FT                   /locus_tag="Caci_0496"
FT   CDS_pept        574640..575116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0496"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   sma:SAV_2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69446"
FT                   /db_xref="GOA:C7PX95"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX95"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ACU69446.1"
FT                   /translation="MTVESGIREAGRLCVEPGLSDAMRAVAAFHTAFDLPRQPVPSTDV
FT                   STELAQLRVDLLVEEVGEFADATSKRDLTAMADALGDIIYVAYGAAVTYGIDLDAVLME
FT                   IHRSNMSKLGSDGRPVLRQDGKVLKSSSYRPPDVARVLAEQSELTVVSEAIDHP"
FT   gene            575177..576604
FT                   /locus_tag="Caci_0497"
FT   CDS_pept        575177..576604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0497"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sus:Acid_6274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69447"
FT                   /db_xref="GOA:C7PX96"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR031053"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX96"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACU69447.1"
FT                   /translation="MAAEGAITESSSWTNTSVLLFVGDDDPLAAVTALAKKIINEAEDC
FT                   GLQGPPFDPFALAELLGLSLRARADIADAHISADTIGVRSTPDAPLGHFVQAKRSLAIE
FT                   YNPTRPRGRLRYSVAHEIAHALFPDVADVVRHRTGSGGVAGYGGDDSWQLELLCNVVAA
FT                   ELLMPDQAVAGLIDIDPDIDFIMEYRRRFDVSTEALLRRLVGLTGRGLALVAASRSQDD
FT                   ASASLIVEYVVGSAQFSPRVHRGATVSSAGAFGKCVAVSQTARGVETLETVPLRVQAVG
FT                   VPPYPGFSLPRVLALVEPVVPIGKESGGLRYRSGDVTNFSAGDRPVVIAHVVNDSAHAW
FT                   SRRGVAAALSTRFPAAARAFQAWTVAAPTNLELGRVHAVDVTTGQSLVTIASMVVQRGY
FT                   GAGFSTRLDYQALDTALAAVAKFALTKGADVHLPRIGAGQAGGRWDLIAQAIERNLVGA
FT                   GLEVVVYTLPQRPRGKT"
FT   gene            576658..578310
FT                   /locus_tag="Caci_0498"
FT   CDS_pept        576658..578310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0498"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sus:Acid_6275 adenylosuccinate synthetase;
FT                   PFAM: adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69448"
FT                   /db_xref="GOA:C7PX97"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX97"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ACU69448.1"
FT                   /translation="MKTRPRLVVISGPVGSGKSTLARRLVSRYGAFDIRTQDLMRAHAV
FT                   AYDKELPLERRALQEYGEQLDIDTGGGWVAEGVAKLLDQRDEPIDGHGLIVVDSVRAHH
FT                   QVERLREAYGARVTHIHLNAPESVLGERYAERGDASGLVELDSYTEVAQNKTESAVGQL
FT                   ESEADITIDTQRNLPGDVETRAAAALGLYASRTDKLVDVLIGAQYGSEGKGNIAFYLAP
FT                   EYDVLVRVGGPNAGHKVPLPTPYTHRLLPSGSRANLAACIVIGPGATLSLEVLMREIAE
FT                   SGVEVDRLSIDPQCMIIENADLDAEAQLVGKIGSTGKGGGAAAARRIMGRHYDEASETP
FT                   VRLARDVQELVPYVRPTGEILDDAFARGHRVLLEGTQGTGLSLYHGSYPHVTSRDTTTA
FT                   GTLAEAGIGIHRVRRVIIVARTYPIRVKNPDEGTSGPMSQELSWEEIARRSGIPEEELV
FT                   KQEKGSVSNNQRRVAEFDWQMLRRASEINGATDVALTFTDYLDIGNRDARRYEQLSPKT
FT                   IDFIEEVERVAGVPVSLLGTRFDIRSVIDRRQW"
FT   gene            578304..579032
FT                   /locus_tag="Caci_0499"
FT   CDS_pept        578304..579032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69449"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX98"
FT                   /inference="similar to AA sequence:KEGG:Acid_6276"
FT                   /protein_id="ACU69449.1"
FT                   /translation="MVSTAWAFTTMTSERRLSNVQRDELINKYPVLYHMAEEGTWPSIQ
FT                   KRGLLSTQALVDLYNPEPAVKNSILGAVRRSSIALDNPVLGRTIIRDQRPLKFLDKCLL
FT                   PGTSPQQFLDVLNGRVFFWLARHRLETLLSARLYRDKQQTVLHVDTGRLMERYGDEVEL
FT                   APYNTGSMHIPNAPRRGKDVFVAVDDYPYDDWRVQRGSKGDAVVELTVPYAVPDISDMT
FT                   LRVESWSGGDVVDVIYSAPD"
FT   gene            complement(579523..580476)
FT                   /locus_tag="Caci_0500"
FT   CDS_pept        complement(579523..580476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69450"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX99"
FT                   /inference="similar to AA sequence:KEGG:SGR_3293"
FT                   /protein_id="ACU69450.1"
FT                   /translation="MKMVAWLAQHARPGVSWDRLALQAFDEDMPVPSEGIRRAFTRQID
FT                   KTRLPGGIALDSAPGTDRETWAVEAAETVTATGATMFRPLARIARIDSAVQSLLAAHAP
FT                   WPPQEYADLDRRTDTDRTPAEITQMAVAAIIDPENYLPGSTIADVLAALLPEGQLSPMA
FT                   SFLEFSDLDATELTAAEWLGKNMAGSILEELRAAIAAADIAELRQAYRAAQACTRRTGE
FT                   LLNSVEAEIGAGTLGDACRAWVSAAAFGLPRIMLLVTARDRKPHEFAISAALLLWTNRM
FT                   VSRLRSAFPGGFTALDEPLRQMVEGLSLAVLTGEDA"
FT   gene            580835..580924
FT                   /pseudo
FT                   /locus_tag="Caci_0501"
FT   gene            581111..581245
FT                   /pseudo
FT                   /locus_tag="Caci_0502"
FT   gene            581627..581882
FT                   /pseudo
FT                   /locus_tag="Caci_0503"
FT   gene            complement(581927..582034)
FT                   /locus_tag="Caci_0504"
FT   CDS_pept        complement(581927..582034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69451"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69451.1"
FT                   /translation="MLLSPLARYLVVAGVDAAATTVTVKGVDYFFDLAQ"
FT   gene            complement(582089..586327)
FT                   /locus_tag="Caci_0505"
FT   CDS_pept        complement(582089..586327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0505"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; PKD domain containing protein; SMART:
FT                   PKD domain containing protein; Parallel beta- helix repeat;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69452"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA1"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69452.1"
FT                   /translation="MRARRVTLAALSALGVSVGVASAPAHAAAPTTIYVDNGSAACSDT
FT                   GSGTQDQPFCTINAAAKSAAPDDTVLIEPGTGHYSEPMMNIQTSGTPGHPITYQAAQGT
FT                   FTMGNVNSPGQYDAAYGLRFDQTVHDIVIQGFHFGGGLWVDEESARFQVRNNFFDGSGL
FT                   AMYDGEAMEVTGNTFTNAPLSVEGAMGGISEPTPTLVDHNTVVGGSIWADMGSTTVTHN
FT                   TVSGSSTFGILAGTNKSSSMWDAQVTIAGNLVYGNAGGGISAANWGATITGNTIADNGG
FT                   NQVEIHSPTPIPYTPPSPPQTHVENNIIATGTTLPHSAAATASQIGITVDQAAWATTFV
FT                   DRNVVSLAQGRPYEIGTTIVPDGAHLAALGHGGTAEINAAPLLNADGTLRAGSPAVDSA
FT                   DSAAAGEQATDLAGNTRHDDSGVCDTGAGSRSYDDRGAFEFQGTTSPAVACAAPTAPVP
FT                   AAPAPTVDSVDFPATGGYFGVGRAGYFHVADHSGARNPIQFSVDGGVAQQLLADASGSL
FT                   MIPYTATTAGPHWIDVQVVGASPSLTTRYTFTVPATDTVVAPTAYFTVAGDRANPKSVT
FT                   VNAIKSLHGTTPIQSFTYHFGDGTSTGPTSATSATHIYSTADKFPITVTVQDTDSLSNS
FT                   MQATYDASTGQTSTPKPSPNTIHVNNAAGANCSDAAGSGSASKPFCTIAAAAALTNPGD
FT                   TVLVSAGTYASGVDITRSGTPGDPITYTTSGTVDLVSPSNAAYMGTAFTLSGVHDVTVH
FT                   GFVMDTKGSNGVLVGNSQNVEISGNTINDDGVFGASTYEGVQFTNVTDSAIVDNTVNAG
FT                   DIQGIVVDSGSLRAAIQGNTVRATRNVVYYTMIQDAAPNSTVVGNRVSNPESRDIAISS
FT                   GADGTVVAGNMATCSNVGISVDANNVAVTANTVMQTAGRELAVGGNGNVTGTSIRDNVF
FT                   AIPDNTFDCGSPNDGSIGMYGVDIYAGSTAGTTLDHNDVWFPLYGPGYQWGDTEYAVTT
FT                   PAQLAAFTTATGQSAHDTVAWPMLDANGAPRPGSPTIDAADSSATGYPDKDLLGNPRVD
FT                   DSTTPNTGLGPIAYGDMGAVEYQPQAPGGGTPTPTPTPTPPPTPTPAPVPNPGTGQPTV
FT                   QRLGGGTRYATGLMVSQHQWAAGKASAVVLARGDAAPDALAGVPFAAHVHGPLLLTDPS
FT                   ALDSETRSEIDRVLGGPHSGKTVYILGGAGAVAPSIEKGLRDAGYKVVRYGGDSRFSTA
FT                   LQIASAFGPTDHVIVATGRNFPDALSAGSLGAAEGAPIVLSDDTVLDAATAAFVARHPA
FT                   IDPVGVQAQHAVAGLAAGRTVDRSLAGSDRYVTATDVATRVAQILGHTPATVGVASGTA
FT                   FPDALTGGAFIANAGGALVLTDPTRLTASTGALLTGWHGGLSTIEVFGGPLAVSGPTYD
FT                   AIVKTVGARS"
FT   sig_peptide     complement(586244..586327)
FT                   /locus_tag="Caci_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            586579..587925
FT                   /locus_tag="Caci_0506"
FT   CDS_pept        586579..587925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0506"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; SMART: PKD domain containing protein;
FT                   KEGG: ace:Acel_1461 cell wall binding repeat 2- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69453"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA2"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69453.1"
FT                   /translation="MSRSIGFGLALVAVLGTGLGPIAPVHADPAASPAKLSHVSPLFQP
FT                   SLTVTAQNDHGLIAVTMPAAGGQYSLSMGDGTTLRGADNQPEIYYTYQASGRYLVQLAD
FT                   TDAGGSTGTAAVWVDVTVATAPPLAHAVARISGGDRYATAIAVSRTAWTGGSAKAVVLA
FT                   RGDKYPDALSGVPLAAHVGGPLLLTDPTVLDTATRAEIDRVLGGPASGRTVYILGGTAA
FT                   ISPGVEKGLVSAGYHVVRYSGADRAGTALAVAQQAFTSAPGALIATDTDFADALAAGPL
FT                   AAALGEPILLTGQWTISDGAWNWLQQHPRVGTVGEPALAVISERAMHGWGNIRANDGFQ
FT                   GPDRYTTALAVAHAMIDQTSGSLPPGRSTGVCFASGETFPDALSGGALCALQNRPMLLL
FT                   PATGGEGDVLAALDHWNGALSQAELFGGPAALSQTAEDQVAQALSFTEN"
FT   sig_peptide     586579..586662
FT                   /locus_tag="Caci_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            587952..589754
FT                   /locus_tag="Caci_0507"
FT   CDS_pept        587952..589754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0507"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69454"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA3"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69454.1"
FT                   /translation="MTRIRLAAPLILSSAALISALMPPLTASAAGTASTPCAPAPVTGT
FT                   PTGPLTAAVQSDDFPSLSGGLPPTHGPNQPGVFHLSGSGGVSPIVCFQYSVPETGVSNA
FT                   TISADASGRANLTLALPYAGLASVTVSAVDAAGNVSAPVTYSFNVLSAVPTKLSAQIEI
FT                   GGSSDGTVTGVVTASGPNPVLNYHVDFGDGTTVNQASPAFRHVYRSTWWYQIVVTVTDS
FT                   SGATTTATALNVRTTVPSTMQRVSGTTRYDTSTAVSRRLWADAADDQTDRLAAHTVVLA
FT                   SGATFPDALAGIPLASYKQGPLLLTEPQQLTDTTRQEIHRVLPKGGTVYVLGGQNAVSP
FT                   DVAATLSGDGYHVIRYGGKTRYETALIIAKQGLDNPAHVVIATGTDYPDALAAGPAATG
FT                   RLSSGGKPAAILLSDGATFNDAATAAYIRSKLVRYQTGMPNVTAIGWSSTLAGLAMIGV
FT                   PDYIIDSTIKPGTPAKSGGDSWGTDIGTLYFIAGADRYTTAEGVAIEDTGPDCCAPDDP
FT                   FVGYASGNGFADALTGGAALATLHGRLFLTAPNYVPTATTAIFPGPPDQVKGTTYTGTV
FT                   FGGTQAVSQGVEDRLAQVLEAKEQ"
FT   sig_peptide     587952..588041
FT                   /locus_tag="Caci_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 30"
FT   gene            complement(590521..590901)
FT                   /pseudo
FT                   /locus_tag="Caci_0508"
FT   gene            591312..593135
FT                   /locus_tag="Caci_0509"
FT   CDS_pept        591312..593135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0509"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: fal:FRAAL6687
FT                   putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69455"
FT                   /db_xref="GOA:C7PXA4"
FT                   /db_xref="InterPro:IPR003032"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69455.1"
FT                   /translation="MADRLRYQLPARPTTTLRWVFFVLAVVSLVFGYVGLHAYILQQKP
FT                   HPQYSHAPGDLIYFDIELFLVQSTPIAAGGPYPFLLAVARFSAPLVSAYTIVEIALGLS
FT                   AHRIHGVRMRRYRGHAVVCGSSRTATVLAERLRRDRRRVVTIEPGTDDRRRADVVIGDP
FT                   ALPARLREAGVERAAVVYSCLDDSHRNVEVAGTIERIRAHTDRPGRADRPGHVGRPGRR
FT                   GPVRVHAMVKDLDLCLALKARHWSTAGGDGPYVDFYNPDELAAQDVVRSDDRLFTHDPP
FT                   RVAIAGTGAFGRAVLVELGRQWLVRRKQSSASLQVKVIGEQALKEVAAVAARYSFLDEV
FT                   CMVQTRTGTPAEFLTELTRLDTPRLHRLYLCQEDEGQALGTALAAVAHLSSALEVIVVR
FT                   LDRMSGMARAFDHGTGAGALFDGLDGRLRIVDVAQVGGDPAVIGFDLAEALARTSHQRY
FT                   LLERLASGKPLGSAPAMTPWETLDEDLRAASRALAGDVGRKAAALGGLLVPRSASGQDF
FT                   AFQPGEIEALARREHDRWQAERTGRGWRYGPRRDPVAKRHPDLNSWAQLPESERERDRE
FT                   VVRAMPSVLAEVGLAIVRVGPSEFTAEELAA"
FT   gene            complement(593159..593641)
FT                   /locus_tag="Caci_0510"
FT   CDS_pept        complement(593159..593641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69456"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA5"
FT                   /inference="similar to AA sequence:KEGG:nfa54480"
FT                   /protein_id="ACU69456.1"
FT                   /translation="MRLGITGHLDLTVSTERAVVAALRRHLLACGVPGELIGVSCMARG
FT                   ADSLFAQALIELGGRLEVIIPSVDYRQSQVTPDHEPVFSAMLDRAAAVHQMPAARAAAE
FT                   AYAEANRLLLASIDELVAVWDGGLDGPVGGTMDVVLTALACGIPVTVIWPEGAERG"
FT   gene            593867..594040
FT                   /locus_tag="Caci_0511"
FT   CDS_pept        593867..594040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69457"
FT                   /db_xref="InterPro:IPR026334"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69457.1"
FT                   /translation="MLHPKNDAKPGQATAVTDSRDTPLGRVSESAASTLFRIVRACDEP
FT                   LTPPVAAFDASL"
FT   gene            594069..596516
FT                   /locus_tag="Caci_0512"
FT   CDS_pept        594069..596516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0512"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_2654 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69458"
FT                   /db_xref="GOA:C7PXA7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="InterPro:IPR026337"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69458.1"
FT                   /translation="MSEQIVFPFRQFILKVHSRCDLACNHCYMYEGADQSWQARPKVMS
FT                   LETAERIGGRIADHARRHGVDSVRLILHGGEPLLAGTEQLEGIILRLRKVLDGITADIR
FT                   VHTNAVRLDARFLDLFVKHDVRVGVSLDGDRLANDRHRLYSDGRTSHPQVRAALALLRR
FT                   PEYEHLYSGILCTVDIANDAIAVYEALLAEKPPRIGLLLPHATWDIPPPRPLDPGTGAP
FT                   SATAYADWLITIFDRWRADGRPMGIRIFDSVSSTLHGGPPLSEALGLAPSDLVVIETDG
FT                   EIEQLDSLKVAFDGAPKTGLTVADDDLDLALAHPGMRARQSGLAGLSEQCRSCEVVESC
FT                   GGGLFPHRYQSDSGFDNPSVYCEDLKKLILHIAQSDRRRADHGRDSVTRHRIADAQLAE
FT                   LASGFGDAAAVTALMDVQASIARGLLATVAEQLAMRESPARTAWNALIELDRAQPTALA
FT                   AVLAQPYFRTWAHRVLSAGVRDHDAHRLSALTLAVAVHAGSELELTLHAEQGAIHLPWL
FT                   GTLRVPGPSSYVRVATTAPNRLLIGTGPDRFAVTLDDETPAGLWEPIRTLHSEGFAILL
FT                   DDGDPERDCYGWPATSRLSAADHDRWQQSFDAAWRLILADHPGYAPGLAAGLSTVTPLR
FT                   PAPAGRAKSATARQAPGAVGAALPDAPELLALLLLHEFQHVKLGAVLDAYDLYDESDRR
FT                   RYYAPWRDDARPIEGLLQGTYAHLAVTDFWRVQRLRAVGEAAETAEVNFARWRLHTAEA
FT                   IEVLAASGSLTELGQQFTDSMRATVAPWLDEPVSSQAGQAARSSAERHLAAYLRRAGHA
FT                   SDV"
FT   gene            596509..597360
FT                   /locus_tag="Caci_0513"
FT   CDS_pept        596509..597360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0513"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   saq:Sare_2653 aminoglycoside N(3')- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69459"
FT                   /db_xref="GOA:C7PXA8"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA8"
FT                   /inference="protein motif:PRIAM:2.3.1.81"
FT                   /protein_id="ACU69459.1"
FT                   /translation="MSDSLEATHHAPIVRSRQQPCSRQQLAEDLVRLGLQSGTDALINS
FT                   SLRAIGPVDGGAATVLAALRAVLGPRATVVVPSQTPANSATSSAHREAVAGMTAVEIAG
FT                   YRERFPPFDPARTPSAGMGAFAEHVRLQPGACRSGHPTSSFAALGPAAERITALHPLHS
FT                   HLGPESPLGALAESGAQVLLLGVGFAKCTAFHLAEYRVRPETRTYSSKLADLSRPGGGG
FT                   RWIEYRAIRLDASDFDRLGADLAASRSWVRNGTVGAAPSACFPLASAVRFAEQWLSEHR
FT                   PG"
FT   gene            597481..598845
FT                   /locus_tag="Caci_0514"
FT   CDS_pept        597481..598845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69460"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA9"
FT                   /inference="similar to AA sequence:KEGG:SGR_5767"
FT                   /protein_id="ACU69460.1"
FT                   /translation="MSPSGPGEAESPRYSEYGSCFFLSYAHTPRVFDDGPDLNYWVRQF
FT                   FRDLCNELVSCDPTTWHRPTGPPGFMDDAIPEGALWRRVLARELATCRVFVPLYHRSYF
FT                   SSVNCGKEWAVFRARQMAQLAQTGVPNEAILPVVWKPPRSEDLPEFASALQMSRLSVSD
FT                   AYFERGLYELIRLDRDREYTNVVLRFAEWLDETARTCAPPLGPLADYELVRPLFPTDDS
FT                   GKGADRRFRITVAAPDEKSAPPGRSRDYYGPQPEDWRPYYPDSTVPLARRAEDVARGLG
FT                   YTPVVSALTRHSPEMRPRPRNPAAGAGAIPDAPGVLLVDPWIAHTPDSGSVAEVDRCHK
FT                   DWIRVLVPWSGTDRQTAEQAATLRSLLEGVMPWSMEEWHRTASAATRELASVADFGHAM
FT                   PDVMERAWRRYLRAVRPAGSGGREFPSRPRLRDGPDADADADGDAGASTDDGTED"
FT   gene            598868..602812
FT                   /locus_tag="Caci_0515"
FT   CDS_pept        598868..602812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0515"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: sgr:SGR_5768 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69461"
FT                   /db_xref="GOA:C7PXB0"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB0"
FT                   /inference="similar to AA sequence:KEGG:SGR_5768"
FT                   /protein_id="ACU69461.1"
FT                   /translation="MPEREGRVLTFYSYKGGCGRTMALANTAWILAANGRRVAVIDWDL
FT                   ESPGLHRYFPAPVLDPTALNGNLGVIDMVRDFEWAASRDEVPDPAQWYMDNARIRDLAI
FT                   SLRWPFPGGGCIHFVSAGLQNRAYSAAVGSLDWDRFYADLGGGRLFDAMRRDMIENYDY
FT                   TLIDSRTGFSDVADICTIHLPDVLVDCFTLNNQSIEGAAKVARSVHEHNRRRAIRILPV
FT                   PMRVDDGEKEKADAGRAAARARFEGFPQVDDPADAVRYWGAVEIPYRPFYAYEETLAVF
FT                   GDSPGLTTSLLAAYERLTGELTGGTVTSLPPIDDTRRISILDIVTRRRETVPEEVTVAY
FT                   IAEDRMWADWTAGVLRRSGVGASVRVLTPGIVTLPADGQRRRVLAIASTDFAGSGHALA
FT                   AARTLAGPEQLTAVLVSEPRADDRLGGLPSVDLHGLPEGPATARLLRALGKTDAEAVVS
FT                   GVTGEQTGGARFPAATPRVWSAPGRNATFTGRDAMLEKLRDGIVGSSSAVILPLALHGL
FT                   GGVGKTQLALEYAHRFKADYDLVWWIEAEQPDFIDTSLADLAIRLGLRGGDNVPEAAEA
FT                   AREALRRGTPYNRWLVVYDNALEPEVLTPYLPDLPGDGTGHILITSRIQSWSRVANSLE
FT                   VDVFTPEESVRHLTRAVPGLAQADAAAIAELVDNLPLAVESAASWLATTGTPVATYLES
FT                   LAEETTRVLSLGRPETYPVSLAVTWNLALQRLREREPAATRLLELAAFMNPDGIAMDLV
FT                   QSDEMVIALHPFNEFVTERMVIGNVVREIVVLSLIKVDPNTNALRMHRLVQEAVKATLD
FT                   DGSAQETIHEVHRILAGARPQFGDTDNPENWPRYQIIWPHLSPSRAIDCEEEPVRQLLI
FT                   DRVRFLWKTGDYAHALDFGRTLEKRWAERIEDYGSESTAGLALNRQFLNLRCQLATVLR
FT                   LRGEFRWAYDLDVEVLAEQQRVLPPRHPHTLLTAIGLAADLRGLGRFDDALEMDKATYA
FT                   DHKQAFWEDHPRALLSAHNLAVSYRLVGDFAQARAIDQDTLNRRKAVLGDRHPAALFSA
FT                   AHLARDLRETGHFEVSVELLRSTLADYRDVVGENAPETLRTAKSLAVSLRKADHLEEAL
FT                   ALSRDTYEHYLADYAPHNPDVLACAVNLAADFAATGDARSAVKIMDETLRAYRENLGRD
FT                   HPYTLVSLNNLGAFTRQAGIPDRARRHIKAAHGGFDAWLGPEHPYTLAAAANLTNSMVD
FT                   AGELEEAETMELAAAGIFEATLGADHPDTLAVSANRVATLKAMAREAEANTLRAGVMAA
FT                   LERTLGAEHGITRALAEGRRLDFDLEPQPT"
FT   gene            complement(602879..603754)
FT                   /locus_tag="Caci_0516"
FT   CDS_pept        complement(602879..603754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0516"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sgr:SGR_5769 putative alpha/beta hydrolase fold protein
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69462"
FT                   /db_xref="GOA:C7PXB1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69462.1"
FT                   /translation="MTRIVQAQDGRKLAVEEWGAPDGAAVFLMHGTPGSRFGPRPRESV
FT                   LYRLGVRLIAYDRPGYGESDRLGARAVAHAAGDVAAIADALGLDRFAVLGRSGGGPHAL
FT                   ACACLLGDRVRCAAVLVGLAPRDAGGLDWYAGMTASNVAAYQTAESGARAIAARFEAQA
FT                   ALIRRDPAAHLPYRDRELSRSDQEVMADIGIRTMMLSNFAEAVKRSGVGWIDDALSFVA
FT                   AWGFDPARINVPVLLWHGARDVHAPVRHTIWLAERITDSHPVIVDDAAHFGALSAMPRV
FT                   LSWLVDGKRP"
FT   gene            complement(603838..604080)
FT                   /locus_tag="Caci_0517"
FT   CDS_pept        complement(603838..604080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69463"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69463.1"
FT                   /translation="MGPVHKLIPTSEPPHRTLMTCADEASGRRSASLPADGIVVILGSD
FT                   YRSRPPSHSVGSEPSGLTVGGSVGTSPQNGIPSVC"
FT   gene            604116..604932
FT                   /pseudo
FT                   /locus_tag="Caci_0518"
FT   gene            complement(604946..605989)
FT                   /locus_tag="Caci_0519"
FT   CDS_pept        complement(604946..605989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0519"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_3414 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69464"
FT                   /db_xref="GOA:C7PXB3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69464.1"
FT                   /translation="MVAALRLWRCRDDHKTIEILLLRHQLTILQRRLAAAGRRLRPDWA
FT                   DRAIIALLLGLVPKARRAGPCLFVTPDTILRWHRDLLRRRWAKKSRPKNDRRATHQNIK
FT                   TLIPRLARQNPAWGYRRIHGELAGLGIAIAASTVWEILKDAGVDPAPRRGSVTWASFLR
FT                   SQAEGIIAADFFTADLLDGTKVYVLTIIEHASRRIRVLGSTLHPTGQWTAQMARNLVMD
FT                   LDDAAATVKFLIRDRGTNFTEAFDTVLADAGIRTVLCNVQTPRMNAIMESWVGSVRRGL
FT                   LSRTLIWNHEHLRQILHHYELRHNTHRPHMSLSAAAPLKPLPPNITDLDALRVRRTRRA
FT                   GGVINEY"
FT   gene            606266..607355
FT                   /pseudo
FT                   /locus_tag="Caci_0520"
FT   gene            complement(607757..608035)
FT                   /locus_tag="Caci_0521"
FT   CDS_pept        complement(607757..608035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69465"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69465.1"
FT                   /translation="MLQAVQSTADGMRVSTLLNSLFGWVPCPDDPWQQVIGIQHDLIKI
FT                   GHDRGPGAIDILVALTAVQHRLTVLHLDNDFAAIAKVRPDIQVQQLE"
FT   gene            complement(608150..608386)
FT                   /locus_tag="Caci_0522"
FT   CDS_pept        complement(608150..608386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69466.1"
FT                   /translation="MTKKLFDADEAILAEAQRQLGTATGKDTVNLALATVAGLKAKERD
FT                   AALDYLREHFNELFDLSAVDPKKLTFPQPPAAA"
FT   gene            608676..609691
FT                   /pseudo
FT                   /locus_tag="Caci_0523"
FT   gene            610077..610766
FT                   /locus_tag="Caci_0524"
FT   CDS_pept        610077..610766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69467.1"
FT                   /translation="MRDRDTLGRMFLPEFRYAHYVSKDVENGEAMKLRRSVAVLVAACG
FT                   FSLASIAGAAAQVATPSTTPVALSHVLRGEEQLSLQQLLDIASHKVRGTYPNATLMLAD
FT                   GASPTGSTRNMDEVTDWRLIYNTNDAGSPVKSLELYATLEGEISHPVLRDQPWGGTVSI
FT                   PNQVGISPDLAYSILMDAGHNDPYQYVSLVKPLIANPHLQYHFSNIRGGCDGYAVNVDD
FT                   YAVNPIC"
FT   gene            complement(611024..611197)
FT                   /locus_tag="Caci_0525"
FT   CDS_pept        complement(611024..611197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC0254 Na+/H+-exchanging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69468"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69468.1"
FT                   /translation="MTSQQTYALLFDIAVILAPAHALGGLARRFGQPAVIGEISLGIPL
FT                   GPTVVPAAVGRH"
FT   gene            complement(611375..612217)
FT                   /locus_tag="Caci_0526"
FT   CDS_pept        complement(611375..612217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0526"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sen:SACE_3708 abhydrolase, alpha/beta hydrolase fold
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69469"
FT                   /db_xref="GOA:C7PXB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69469.1"
FT                   /translation="MASGIRHVVVDADGVDIPVTLRGNGPLVLLLPGATGLQTGYAVLI
FT                   KLLSADHTVAVYDRRGHGRSKEKEPSTAPLSIEQHAMDAAVLIDALGEGPVHAVGSSAG
FT                   AVIGLDLLARYPDRVRSLIAHEPSLLPLIDDGPRWRTWYDDLVAIDREVGTRHAFDYFF
FT                   AHLASNGRGEQAPVAIPSSQLPEWSLYFQRELTEIVSYEPDLEQVALDRDAFVPVLGAD
FT                   SRERWHGRVVLELAARVGVPAVEVAGGHLAPVYEPAAFHRLIQDNVTLHEKLRASQLS"
FT   gene            complement(612222..613028)
FT                   /locus_tag="Caci_0527"
FT   CDS_pept        complement(612222..613028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0527"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: npu:Npun_F0780
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69470"
FT                   /db_xref="GOA:C7PXB9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB9"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ACU69470.1"
FT                   /translation="MTGAHSDKVGGGTVGGPRPAEPELRLFLFHHAGGSSSVFEGWESR
FT                   FPAGWDVRALDAPGRGAARSAKPCTTVEELAGYFRDHLSLSFDRPFSFFGHSMGAMVAY
FT                   ELARRLQAEGGPQPNWVGLSACRAPGQPAARGQHGLSNEDLRAWLAAAGGTDQLVLHHP
FT                   LIWKMLEPLLRADLRVVDSWQPTVDAVPLRGALSVFGAQDDRVLAHEKLIGWQPFTEHY
FT                   VASRLFRGGHFYLQRQADLIIRWIVADISGSRRVCATPWTSPAKTR"
FT   gene            complement(613035..613835)
FT                   /locus_tag="Caci_0528"
FT   CDS_pept        complement(613035..613835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0528"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU69471.1"
FT                   /translation="MNGAPDWITADADTERPSIARFYDYLLGGTHHLEVDRELGRKAIR
FT                   AAPGLILLMRENRKFLRRAVKCALDAGIDQFLDIGSGIPARGSIHETARKAGSRARVAY
FT                   VDIDPVAVSEGKAILAGDPEGVSVLGDVFEPAAILENPEVRALIDLDRPVVLLILNVIH
FT                   FFPDSKVLPVLETYRHRLVSGSMLGLSVAMDGTTGAEAIDELYRQEYEGFTLRSREQIE
FT                   ALFGDFELLEPGVVYPPEWRPEDPGRTVVNPERYSSLVGVARKR"
FT   gene            complement(613832..614464)
FT                   /locus_tag="Caci_0529"
FT   CDS_pept        complement(613832..614464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0529"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mab:MAB_4054c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69472"
FT                   /db_xref="GOA:C7PXC1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACU69472.1"
FT                   /translation="MSKVYEKINHQMAGWIHRQPIFFVASAPLAASGRVNVSPKGLMGT
FT                   LVVLDPHSIAYLDYTGTGAETIAHLRENGRITVMFCAFEGRPKIVRLYGRGRYTVPGEP
FT                   EFDKLRELFEKTTTAGQRSIIIVDIDRITDSCGWSVPLMDYREDRAVLDLHNERRDDAY
FT                   FEKYWQTTNADSIDGLPALRSEPEPEPGLAPEPESEYLVVSASGSNE"
FT   gene            complement(614461..615936)
FT                   /locus_tag="Caci_0530"
FT   CDS_pept        complement(614461..615936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0530"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: tryptophan halogenase; monooxygenase FAD-
FT                   binding; FAD dependent oxidoreductase; KEGG: fal:FRAAL4634
FT                   putative halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69473"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC2"
FT                   /inference="protein motif:PFAM:PF04820"
FT                   /protein_id="ACU69473.1"
FT                   /translation="MTEQNTVKTANDVDNPDNAEKTRVLVIGGGPGGSTAATLLARQGI
FT                   EVTLLESAIFPRYHIGESILPSVLPVLDLLGVREEVDNHGFVRKDGAYFEWGPENWDLN
FT                   FDHLSGASRHSYQVIRSEFDHMLLKNAQAKGVDVREGVKVTEILFHGDRPVAARWSASD
FT                   NSGAAGTIAFDFLVDASGRAGVMATKYLKNRRYHEAFKNVAVWSYWRDVKPLEVGPKGA
FT                   IAVCSVPYGWFWAIPLHDGTTSIGLVAKRTTFSDERERLGSIEAVYADAMTQAPRILEM
FT                   TQGANKIEGYKVEQDYSYVSERKSGPGYVLVGDAAAFLDPLLSTGVHLSTFSALLAAAS
FT                   VSAVLDGELAEQEAVDFYERAYHQAYERLLVVVSFFYNSYNRQTQFFEADKLTRRERHM
FT                   LNLYESFLHIVTGIEDLDDSIDGGEALEEVAQQIATQKKIDAGHNEAMNSLPDSPRQAV
FT                   GGLYLELEPRLRIRRTSEAPAGPEPVREARAGL"
FT   gene            complement(615936..616739)
FT                   /locus_tag="Caci_0531"
FT   CDS_pept        complement(615936..616739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0531"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   hch:HCH_01667 phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69474"
FT                   /db_xref="GOA:C7PXC3"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC3"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACU69474.1"
FT                   /translation="MTAARDPLGVDRADREHRHGDRAVARRPHPADALLRSVRRPRITS
FT                   FGRRIDVWVAAIRPDVDPDPDMPVLRAFLPEGELRRLSAIRHDAARVEYAAGRLLVRSV
FT                   LAERLRTPPTRLRIGEEPGGRPRLEPGPGGSPADDFNLSHSGGRLALSVSRNLRVGVDI
FT                   ERVDRTRPLEALARRYYTADEHALLNTYAGADAYAECWYRIWTTKEAHAKARGAGVRGM
FT                   TDPLDGHGTRWRRYPIPVAPGFAGSVVALHPSYLSVPHRLLGSDD"
FT   gene            complement(616736..617584)
FT                   /locus_tag="Caci_0532"
FT   CDS_pept        complement(616736..617584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0532"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   sgr:SGR_5183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69475"
FT                   /db_xref="GOA:C7PXC4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC4"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACU69475.1"
FT                   /translation="MANKTESAGTDRGLAVLRARDLELRDAIDAVVLSWAAEAGAARTA
FT                   YPPLLRTSDLAALDYWVNFPHLALLAVGADAGREKELAAADHSVIAPELLAPAEYALPS
FT                   AACYSAYLDLSGTRLDGAHKITTVATCFRRENHFEGLRRLLSFTMREVVCVGNREAVLE
FT                   HASSFKKRVGEFARRLGLPLEVQAATDPFFEKDAARTLMQQLFPVKEEFVFGGGLAIAS
FT                   VNFHRNFFGERCDIRLADGSPAFTSCVAFGLERWLAALTERFGRDDPALPERIAEAARW
FT                   T"
FT   gene            complement(617574..617858)
FT                   /locus_tag="Caci_0533"
FT   CDS_pept        complement(617574..617858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69476"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69476.1"
FT                   /translation="MSELTDTTASPVPSVPQEPAKDLVVEYLLAKRPELGTIDPDYDLI
FT                   DNRVLDSLGFVNFLYVLEEQTGREIALEEVSPEDFRTLRRIRARFFDGE"
FT   gene            complement(617855..618796)
FT                   /locus_tag="Caci_0534"
FT   CDS_pept        complement(617855..618796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69477"
FT                   /db_xref="GOA:C7PXC6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC6"
FT                   /inference="similar to AA sequence:KEGG:Sden_1069"
FT                   /protein_id="ACU69477.1"
FT                   /translation="MTDSLTTTTSNAHAYLAALPDILGGDERFKTVLDRLTVMSERDYY
FT                   DPYKLFVWPESIPEDGYWMTPELMSVHGTEAGASLEQAQLRALSKWESVTFYSLNVHGI
FT                   RELLTSIVARIHMPGFEVASEYFHHIIGEENDHMWFFAKFCLLYAGKVYPDRSLSFAGP
FT                   GIPEADTFLLFARLLIFEELVDVFNQRMGEDQRLAPTIRKINSVHHQDESRHIAFGRQI
FT                   VALLHRDLRTRLDTAQLAELERYLKAYMRASVESLCNPAAFRDAGIPEPFAVRRAVIED
FT                   PAFQEHAARILKRSTSHMVSEGIFTDERTVAA"
FT   gene            complement(618793..619875)
FT                   /locus_tag="Caci_0535"
FT   CDS_pept        complement(618793..619875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3280 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69478"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69478.1"
FT                   /translation="MTAAAPEAGVREADRWLDALERTYLVPEDHRVGYFDRVAALDMLR
FT                   CGEEVLEELVKAGLPTLGESGAEWFDRFDLFNLALASGSQISVPEKAIKYALRWMHRGP
FT                   RTWTERLDWTFVVDLSCPLDTCGADPEWSHAQMLPEAVGGELYDWKVEPEGARMVGDQL
FT                   RYSGPGPLRFSGNVSTSGELMELRSPVLRKIIEDFFAVGYRWVRLPEPLQWEYQRLLDA
FT                   GVSPCISASLFLAREFEAAGYPAITRRGWLLGMLDLSHSWVEVTDDDGVVKPIDPIFTW
FT                   LTEYADKPHPDLAAASIGSRMNRLLPAAMAADGLMATHRCGGRDVTPRRKTMIRRRLST
FT                   DGPAGSAGAAGTASTAGVSL"
FT   gene            complement(619872..620138)
FT                   /locus_tag="Caci_0536"
FT   CDS_pept        complement(619872..620138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0536"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: tte:TTE1471 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69479"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC8"
FT                   /inference="similar to AA sequence:KEGG:TTE1471"
FT                   /protein_id="ACU69479.1"
FT                   /translation="MQLYEQTVVRVQEIIGDMSPAKPETAGPELILIDDLGYDSIHFLE
FT                   LALALEAEFNLFEFDEEQAVGMITVGDVAHLIAKIVVAAEDPT"
FT   gene            complement(620305..621366)
FT                   /locus_tag="Caci_0537"
FT   CDS_pept        complement(620305..621366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_3331 ribonucleotide-diphosphate
FT                   reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69480"
FT                   /db_xref="GOA:C7PXC9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69480.1"
FT                   /translation="MSGGASTGTDGGSAQEGTAGSDTEGHAHDAHDEVGPPGRDGLRSL
FT                   PGSADLYNRWESRQWSVAGLDLARDRRRFAELRPFARREILSALAELEIGESCVTRTLS
FT                   ALADHAPDEADRLYLCTQMADEARHVRFFQSYLSDVAGIAAEQLEPHGAMGGESGFGVV
FT                   YDPLLTRHTAAVRTRPDDRRVWHVAVVSYHLLAEGLLAVAGLRALRALAKSCELTALSE
FT                   GLANVVRDEARHVTFGLAATRRGAQSGYADAIGEAYLDGLGAATRVLVNPARRAASPVL
FT                   PTALRAYAGNLAAEWSAANARMCRHVEVVGLAALDTSANLCWSSGLDAAFAEYRERWGA
FT                   HHPVARARQLGLV"
FT   gene            complement(621366..623102)
FT                   /locus_tag="Caci_0538"
FT   CDS_pept        complement(621366..623102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0538"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_3010 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69481"
FT                   /db_xref="GOA:C7PXD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69481.1"
FT                   /translation="MLLNWLLMPNTETGLCILGRDGDWRRHSYADIAAAVRRAIWLLRD
FT                   RDVCAEDRVAIVLADPLHFVTAFMAALAVGAVPVPLAPPTALREADRYVAHVAETLRVA
FT                   RPDLVCTGAGHRAEVLAALAAAGCPAGVVDIADAAHVPADSGDPYRRKPSDSALLQFTS
FT                   GSSGTPKGVRVSWANLTANIAAIRSWMRWEDDDVFASWLPLHHDMGLVGALITSFAAGT
FT                   DLWLMTPRQFVRTPARWLECFGVHGATITTSPSFGYAHVAARVRAGELDGMDFSRWRVA
FT                   ILGAERIDPAAVADFQALVGRRGFDTSSLMGAYGLAEGTLLATGVPARAGSRLVKVVDW
FT                   ALTAGSPVAISQEGRLGRDAVQGAGWLASCGRAADGVAVTVVDDAGDEVPDGTFGEIRL
FT                   SGDSLAAGYLTRDGSVPFSARGSAADAPGADPVLDTGDAGFLLDGELYVVGRIGDALRV
FT                   HGHGVYAEDVEAELSRLGGEQGPAAYAAVFGTIGTRDLAAVFVEGDPPRTWSAKAEQRI
FT                   RTAASTDLPVLIFQGSKGSIARTSSGKPRRRHLWLRLLDGGVPDGWRLVHGEWPWPAGE
FT                   QS"
FT   gene            complement(623267..624508)
FT                   /locus_tag="Caci_0539"
FT   CDS_pept        complement(623267..624508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0539"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kpe:KPK_1427 transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69482"
FT                   /db_xref="GOA:C7PXD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69482.1"
FT                   /translation="MASSEQGKHVTQVQPPPVRRLWSAVFFGYLALGATLQELPGYMTS
FT                   KFGDGPTIIGVAVGIAYLGTAVTRPFAGRAGDAGLARNVSVAGGAITTLAALGQLTAPS
FT                   ALVLIIFRLLMGIGEGALFSGCLPWVLTGIAADRRGRIAGWFGLSMWGGLALGPLAAVG
FT                   VNHLGGSTATWWTIFGLPLVSSVLIASTRPQPAVSPRREIRPQGWRDIVPIGVSVPGIV
FT                   LGLAAYGYGTLNALLVLYLTHDHIGGQGIGLTVFAVAFLATRAAGSPLTDQYGGIRVAR
FT                   VTLVVEIAGLCVLAASSSQGGALAGCVVTGIGLGVIYPSTSKITLGRTGPLQAGVSMGT
FT                   MTSFWDLGIMAAGPISGAVAAHLGYREGFGVAAAVTVAALVLTVLGLHTDSPAEAPTSV
FT                   PRSVPAGAQVRPRA"
FT   gene            624618..625493
FT                   /locus_tag="Caci_0540"
FT   CDS_pept        624618..625493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sen:SACE_1630 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69483"
FT                   /db_xref="GOA:C7PXD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69483.1"
FT                   /translation="MLDVNRLRLLRELSHRGTIAAVAEALSFTPSAVSQQLSTLEREAG
FT                   VALLARTGRRVTLTPAGQNLVEHTESVLEHLARAEAELARVRAGLAGPVRIGSYPSAAR
FT                   TLFPAVLTLLARSHPMLEPQITELDPAEVPSALRAGDVDMALVHEYDFVPATSDPGLNS
FT                   EALFTEPLYLAAPEQGTIADHRDSSWIVSPAGTMCRSSTERACQAAGFSPRVRHEIDDF
FT                   ATAMVLAALGQGVTLVPHLAALAPPEGLTLTRQSMSRRTRIAYRAGTAGHPAVAAVTSA
FT                   LREAVPTDLS"
FT   gene            complement(625663..625867)
FT                   /pseudo
FT                   /locus_tag="Caci_0541"
FT   gene            complement(626030..626230)
FT                   /pseudo
FT                   /locus_tag="Caci_0542"
FT   gene            626344..627466
FT                   /pseudo
FT                   /locus_tag="Caci_0543"
FT   gene            628016..629106
FT                   /pseudo
FT                   /locus_tag="Caci_0544"
FT   gene            629138..629290
FT                   /pseudo
FT                   /locus_tag="Caci_0545"
FT   gene            630102..631304
FT                   /locus_tag="Caci_0546"
FT   CDS_pept        630102..631304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0546"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afe:Lferr_0188 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69484"
FT                   /db_xref="GOA:C7PXD3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD3"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU69484.1"
FT                   /translation="MTLRTSPPHPGLAGGPVYLDYNATTPVDPRVADAMVPHLTYLFGN
FT                   PSSSHAYGAGPRTAMQRARGQVAAVIGARSEGEIVFTGSGSEADLLALRGAVLAAGGPR
FT                   PHVITQVTEHPAVLETCSALERLHGAQVTVLPVDGYGMLEPSTLAAALERPTALVSVMA
FT                   ANNETGALQPIAELAALAHARGALFHCDAAQAVGKIALDVRALGVDLLTIVGHKMYAPK
FT                   GVAALYVREGVRLEPVVYGGGQERALRSGTESVALAVALGAAAELVVEDLAHNEPARVA
FT                   ALRDELHRLLTAGWPGRVRLNGPDAARLPNTLNVSIDGVRGYEMLASVPDVAASTGSAC
FT                   HSGDHTTPSAVLTAMGFDEDRALGSVRLSLGRWSTRREVEKAARALIGHKLPNRDEAPP
FT                   R"
FT   gene            631695..633119
FT                   /locus_tag="Caci_0547"
FT   CDS_pept        631695..633119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0547"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="KEGG: tfu:Tfu_0795 hypothetical protein; TIGRFAM:
FT                   MiaB-like tRNA modifying enzyme YliG; RNA modification
FT                   enzyme, MiaB family; PFAM: Protein of unknown function
FT                   UPF0004; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69485"
FT                   /db_xref="GOA:C7PXD4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD4"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACU69485.1"
FT                   /translation="MAASRGTVSLVTLGCGRNEVDSEELAARLESAGWELADPDSVPGE
FT                   SDIIVVNTCGFIESAKKTSLETLVAASNAEAKVVAVGCVAERYGKRLAEALPEVDAVLS
FT                   FDDYPDISQRLDDVVRGKKHESHTPRDRRRLLPIAPVDRANNSSVVAPGHGIVRQDSEA
FT                   GLGGSIFLRKRLGGGGPLGDGVVAPLKLASGCDRRCSFCAIPSFRGAFISRTPDDIVAE
FT                   AEWLADAGVRELILVSENSTSYGKDFGDLQALEKLLPRLTSLVSRVRISYLQPAELRPT
FT                   LIEAIGGIPGVASYFDLSFQHASGPVLRRMRRFGDRERFLELLDKIRVIAPEAGMRSNF
FT                   IVGFPGETEDDYGEVERFVSEARLDAVGVFGYSDEEGTEALGLPDKVEQSQIADRVARL
FT                   TVISRKAMDDRAAERVGSEIEVIVKHPGRGWAAHQAPAVDGFVTLTGSSSEAGDVLRAR
FT                   VTGQDGANLIAEALAK"
FT   gene            633147..634406
FT                   /locus_tag="Caci_0548"
FT   CDS_pept        633147..634406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_2123 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69486"
FT                   /db_xref="GOA:C7PXD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69486.1"
FT                   /translation="MTAQAIVSDQRQSNYRQVFAIREFRYVFTAHSASMLGSVVTDVSL
FT                   SVLVLERTGSPFLAALTFALGFMPYAFAGTLLAGIGDRYPARLLLVTCNCVSAATVAVM
FT                   AMPFTPIWALIVLRFAASTIQPIFTSARAASLPEFLKGDRYTLGRSILRIVNQSTQIIG
FT                   YATGGLLLLVIQPRQALWIDAASFAVSAVLLRVGTVGRPARITDRKAQGTLIRESLSGA
FT                   RAVVRQPRIRALLFLWWTAPALAGIPEGLAAPYVRQIHAASVSVGLLMASAAVGTIGGE
FT                   VAIGTLVGPARRMRLVVPLASCSLLPLAVFVLRPDVIVAIALMGLTGVADAYMLGLDQW
FT                   FLEAVPDELRAQAFSIMFAGIMLTQGLTISIGGLAAEFAAPSLVIAISAAVGTVVIALV
FT                   CRSVLRTAPSPSSEESISVG"
FT   gene            634396..635424
FT                   /locus_tag="Caci_0549"
FT   CDS_pept        634396..635424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0549"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="KEGG: msm:MSMEG_1852 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69487"
FT                   /db_xref="GOA:C7PXD6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD6"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACU69487.1"
FT                   /translation="MSVDVEQPSGEVTRRLTQYAHGGGCACKIPPGELESVVAQLAAAE
FT                   PAKSPYELLVGLETGDDAAVVRLTGDTAIISTADFFTPVVDDAYDWGRIAATNALSDVY
FT                   AMGGTPVTAVNLLSWPRDVLPLELVAEVLRGCLDVTRAAGCHLAGGHSVDDPEPKYGMA
FT                   VTGVADARRLLRNDAATPGLPLTLTKPLGIGVLNSRHKATGEVFPQAVDAMTTLNADAA
FT                   TAALAAGATCATDVTGFGLLGHLYKLVRASGVTAVIDPGAVPYLEGARRAALDGFVSGG
FT                   TRRNLAWVNEHVAWGSGVDEVERLLLADAQTSGGLLIVGEVPGFPVIGELVLAGPRSLV
FT                   IG"
FT   gene            635461..636594
FT                   /locus_tag="Caci_0550"
FT   CDS_pept        635461..636594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0550"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dac:Daci_4506
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69488"
FT                   /db_xref="GOA:C7PXD7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69488.1"
FT                   /translation="MMFDRELLDTIVNEVVAPAAAEVDTNAAFPREGVDALARAGVLGL
FT                   TVPKQFGGAGEGLRSAVNVIRTLSSACGSTAMVVAMHYSGTAVLASQERADVLQDIGDG
FT                   RHLTTLAFSEVGSRSHFWAPLSTAKADGDDVLLDARKSWVTSASQADSYVWSSRPMAAD
FT                   GPMSLWFVPSDTPGLSIPRAFDGMGLRGNDSSPVTADGVRVSQTSLLGDDGKGFDLAMA
FT                   AALPVFLVLNAAAGIGLMDALLAEAVKHLSATRLDHLNQSLAQQSPARLTLARMRIEAD
FT                   RTRCLLDETLSALEQERPDAQLFLLEVKAATDESAALVADLAMKVCGGAAFRKELGIER
FT                   RFRDSRAARVMAPTTDVLEDFVGRALCGLPLFDGPAA"
FT   gene            636591..637448
FT                   /locus_tag="Caci_0551"
FT   CDS_pept        636591..637448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69489"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD8"
FT                   /inference="similar to AA sequence:KEGG:Daci_4507"
FT                   /protein_id="ACU69489.1"
FT                   /translation="MSNRVLLGAVAYDSKVVTIWDGFRQWFRDRDLDFDYVLYSHYERQ
FT                   IEDLVEGHIDVAWHSPLAWVRTVRLARARSVGVRAVVMRDSDRDLVSAVLVRADSDLAS
FT                   LDDLRGRSVATGAIDSPQAHLLPLSMLREAGLRPDVDFKVSRFDVRVGLHGDHVGGERD
FT                   AAVALRSGLVDAACMLDANTLLFSREGTLPAGSVRVLAKTEPFDHCTMAVGPGADKSTV
FT                   DRFTALLLGMAYDDPTVRPLFDLEGLKQWLPARTDRYSALERAVDELGFLDAEGKLCAD
FT                   DYRP"
FT   gene            637426..638598
FT                   /locus_tag="Caci_0552"
FT   CDS_pept        637426..638598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69490"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD9"
FT                   /inference="similar to AA sequence:KEGG:Daci_4508"
FT                   /protein_id="ACU69490.1"
FT                   /translation="MLTIIDLEGLGLDAGAHLVLNRALTGLPAGGRLAVVGGNQMLGVQ
FT                   LGAWCRSEGHGFDPADPPVVIKGTADDARARATQRAGSPSHVDERADAAWGLAARGALV
FT                   EPGGPLLSVDWVDRDLVWADVAPRLYSRAAAEQWDPATAIDWASHADVPDEVEDAVVQI
FT                   MTYLIENEQAALMLPARLLARLHPHFREVMQLFAVQIADEARHVEVFTRRALLSRDELG
FT                   VSGAGGRASLQTLLDEPDFTLASFLLSVLGEGSFLDLLRFLNVHAPDPITATMTSLVGR
FT                   DEARHVAFGVAHTAHAAKADARFLGRLRMAVERRHTALIDTAGLNKQVFDALVVLAAGS
FT                   WETSAIAKGWRAVEELQKRMEDGRRHRLSLIGFPDDEAAELAALHTRNFM"
FT   gene            638631..638957
FT                   /locus_tag="Caci_0553"
FT   CDS_pept        638631..638957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0553"
FT                   /product="selenocysteine synthase"
FT                   /note="KEGG: kra:Krad_1608 selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69491"
FT                   /db_xref="GOA:C7PXE0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE0"
FT                   /inference="similar to AA sequence:KEGG:Krad_1608"
FT                   /protein_id="ACU69491.1"
FT                   /translation="MSDVRRDIPRTDVVLADPRLAAARARLGVDAVKAAVRGAQQKARD
FT                   GEIAAEAVVEVAVASLPSSATTLRPILNATGVVLHTNLGRAPLAPAAVEACDGQKLGHQ
FT                   ADLG"
FT   gene            638979..640052
FT                   /locus_tag="Caci_0554"
FT   CDS_pept        638979..640052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0554"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_0474 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69492"
FT                   /db_xref="GOA:C7PXE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69492.1"
FT                   /translation="MAVGLLYRIFVSVLSWLALLARSQASKNAEILVLRQEVSVLRRTN
FT                   PKSRISWTARAVLAALSKLLPKTLRGHRIVTPGTLLRWHRRLVANKWRQPKAPGRPPIS
FT                   DGLVQLIVTMAQENRTWGAVRIQGELRRLGHRVAAATIRKVLRARRIPPPKHRDDSWRT
FT                   FLRTQADTLLATDFFHIDCAVTLARVYVAFVIEYSTRRVHLLGITRYPTAAWAIQLARD
FT                   FTADLETTGRRFTHLVRDRDAKFTAAFDAVLSAAGITAVTTMPQTPKMNAIAERFVGTV
FT                   RRDCTDRILVAGERHLRVILNGYIAHYNAGRSHQGAGMSLRAPDDDPNVIPFPAQIDQI
FT                   RRKRILGGLINEYEPAA"
FT   gene            640094..640312
FT                   /pseudo
FT                   /locus_tag="Caci_0555"
FT   gene            640461..640973
FT                   /locus_tag="Caci_0556"
FT   CDS_pept        640461..640973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69493.1"
FT                   /translation="MADDHLISEDETRRIAEAFVAGASWLGKPAWGKTGTGLLGAWHAP
FT                   GWYPEDEERDFGGQEGSWSWAVKTVDPSGQKQVLSHEKVLEGVRGLVFGETDDPLDQLA
FT                   IRKLKQWFTEPAAERHKLTLDDALSSRVCQQALFGRKVFPVGDEVSWSDKKPDWFEDQR
FT                   PTAEDAS"
FT   gene            complement(641107..641179)
FT                   /locus_tag="Caci_R0005"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(641107..641179)
FT                   /locus_tag="Caci_R0005"
FT                   /product="tRNA-Arg"
FT   gene            641502..642491
FT                   /locus_tag="Caci_0557"
FT   CDS_pept        641502..642491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0557"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase catalytic region;
FT                   glutamine synthetase beta-Grasp; KEGG: sgr:SGR_5302
FT                   putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69494"
FT                   /db_xref="GOA:C7PXE3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE3"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ACU69494.1"
FT                   /translation="MGVPTAGLRAKTRVLADGAVPGVWGFDGSSTGQAEGRSSDRVLRP
FT                   VFTCADPVRGGDAVLVLCEVENIDFSPHSSNTRAEARGVAERFAEQEAWFGIEQEYTLF
FT                   RGGRPLGFPEGGGFPAPQGPYYCGVGGGAVFGRELVERHLDYCLAAGLTIAGINAEVMP
FT                   GQWEFQVGPAGPVEVADHMWVARYLLLRVAEEFGVSVSFDAKPEKGDWNGAGAHTNFST
FT                   KAMRESYDPIITACEALGEGDKPAEHVRAYGSGIEDRLTGQHETAPWSEYSYGVSNRGA
FT                   SVRIPWQVEVDKKGYIEDRRPNANVDPYVVTRLIVDTCCSALEKAGQV"
FT   gene            642722..644797
FT                   /locus_tag="Caci_0558"
FT   CDS_pept        642722..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69495"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE4"
FT                   /inference="similar to AA sequence:KEGG:SCO6025"
FT                   /protein_id="ACU69495.1"
FT                   /translation="MPNLSRRELGLLGMGALALGAFGADHAVTAAEADLVAYPARLAGR
FT                   VAFLHVVAHPDDDLYFLNPDIADSVRTGGEVTTVVLTSAEAGGGASFAAARQHGLRSAY
FT                   ARMAGAEDDAPWRRSVLVTRGGEAELCELEADARVRLVFLDISMGSYTGSTPEDENHTP
FT                   LAALFQGTLTTRPVLQPSETSITAGVYTRDQLVGTLTDLMDHFLPTVVRTMDPDPERRG
FT                   IGPKERAWLTDSGVHTDNEDHTAAAWFTYAAYADHRARRGPSAVRLDSYVGYGNARWRH
FT                   NLGGSSAREKLRLLGVYGWADRRKCGDPVGCGDRTVGGDAARPGWSQSTNLRHVGTTDW
FT                   LRTGPDGRLRAFAVVGGHAVVWSETAPGSGKFSPGKAVNADQSTVSSLTPHLAVSVGLD
FT                   RRAQLVGLRAATDPDRGTWTQEVVVSGERPDGSFTPWTALGAPTGAQTKDAHAVGCPTA
FT                   IVDGRGMLHVFVRNADMTVSWRRRDLVTPGATWTDWRDIGGRRVRDGLTTALTPEGDIE
FT                   LHAVGRTLWTWRIGAGATGEPQRTHSALPPMGDPPTVHALQGGGALLAARAADTGVLTV
FT                   LSRPSGGAWRPCAGKLGGQGGFGVVAIQPHGGGVFLAQRGRRGVVEVVWQAQVGTAGGV
FT                   RRWLGGPGPILRPSLTVDAHGRVVAAAIGPEGALYTARINAGDVPRTLTWQSTALA"
FT   sig_peptide     642722..642805
FT                   /locus_tag="Caci_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.631 at
FT                   residue 28"
FT   gene            complement(644814..645221)
FT                   /locus_tag="Caci_0559"
FT   CDS_pept        complement(644814..645221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0559"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ava:Ava_0978
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69496"
FT                   /db_xref="GOA:C7PXE5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69496.1"
FT                   /translation="MDALHPRLLVTRFAEMFGFYEAVLPEMLGAKLMKGSAGGPYANWD
FT                   VEDQAVLILFDRAAMAALAGTRDLPASAAPAQDHTMFVCRVEDVDAGAELCVRHGATLV
FT                   VGPTDRPEWGPTMRTAHVRDPEGNLIELQSY"
FT   gene            645280..645768
FT                   /locus_tag="Caci_0560"
FT   CDS_pept        645280..645768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0560"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: fre:Franean1_3989 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69497"
FT                   /db_xref="GOA:C7PXE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69497.1"
FT                   /translation="MDDLQTAPPSLTSLTTYLLSRTGKIARGRLAERFSERGLRLWHHA
FT                   VLAALADFGPHVQRDLAARLAIDPSDMAKIIDELAGRGTVERARDAADRRRITVTLTDA
FT                   GRTLLAELDAEADVVQSEVLEPLTKDEREQLHALLGKVFEENNSRRAVDSARPVRRQG"
FT   gene            645797..646144
FT                   /locus_tag="Caci_0561"
FT   CDS_pept        645797..646144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0561"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: kra:Krad_2755 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69498"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE7"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACU69498.1"
FT                   /translation="MAQYAILLFDTAGAGDYTPEQQQASQRHAEDLIESGVLSSAYALD
FT                   SVETATSVRGDAVTDGPFIDAKEVVAGFYVVEAPDLDAALELAKRNPAVQWGRGGIEVR
FT                   PVVGSLPPSTR"
FT   gene            646141..647436
FT                   /locus_tag="Caci_0562"
FT   CDS_pept        646141..647436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0562"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: saq:Sare_0956 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69499"
FT                   /db_xref="GOA:C7PXE8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69499.1"
FT                   /translation="MTDADDVARAVADAHRREWAFVLAATVRVAQDFDLAEECVQEAYA
FT                   AALSAWRRDGVPAKPAAWLTTTAKRRAMDAIRRERTLRSKLPLLIELEGREGQEDQEAR
FT                   EGQQHHQDQADPEATVPDERLRLIFTCCHPALAQEAQLALTLRLVCGLSTPDTARMLLV
FT                   SESTMAARITRAKKKISAARIPFRVPRAAELPDRLGAVLGVVHLLFTAGHTAPSGPDLL
FT                   RTELTDRALFLARTLRDLMPDEPEVRGLLALFLVTDTRRATRTDADGRLLRLEEQDRSQ
FT                   WDGEALAEAHELIVAGLRGGRAGRYLLQAAIASLYAQAPTYEETDWSQLVVLYDRLLAV
FT                   WPSPTVALNRTVPLSMAQGPEKAFDAVAELEKDDRLARYPYLPAIKADLWRRLGRDAEA
FT                   TKAYRQALELTDNEAERAFLAGRAGETGPPVR"
FT   gene            complement(647618..647857)
FT                   /locus_tag="Caci_0563"
FT   CDS_pept        complement(647618..647857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69500"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69500.1"
FT                   /translation="MRTTQESENWAVEFIRTDGENQSLSVEDGFSTRGDAEYYGQCTWS
FT                   SPGGRGIEQVRVRQLPRGPWMPVAPASVCGGIRL"
FT   gene            648081..649745
FT                   /locus_tag="Caci_0564"
FT   CDS_pept        648081..649745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69501"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69501.1"
FT                   /translation="MSRKPRSLKQIQVQLSEQLRASDHSWADIGREFQRRFHVNARVAL
FT                   RQARGWTQPEAAERWNRRWPEDPKTFKNFSYWEAWPSSTGYAPSLEVLDRMAQLYECSV
FT                   ADLLSDLDDYGAKKRPLFSQIREPGPGGSMSLPPPRQAPQSYALAAAVQNPDVRFDPYF
FT                   GAPPPKPLRDDVGTNPGELLSSMSSAAEISSLIEPPDGGNSLSRRSALLNLSSLFAVAA
FT                   AAPLAGEAVLPTPAGRVDPAMVENTGLIVGGLRQQNAALGPSATLQTGLAVRAMMEAVV
FT                   KDAPPGLTGQAWVVYGDLAHLLGWMMFNMGQDEAARFYYDDARKAAYQADDYELAANIL
FT                   AAQAHLSMSAGDHQTAIDHAQAAEEAAKRSPSRRAKAYAADMTARVYASAGQGARSLAA
FT                   LERERRQMQRIDWAEPAAERWGFYGPAFYWARESECHLLLGHPVEAADAGALAQQRFNP
FT                   AYLHNNAMALARRAQAQVQFGDVPAACKALAEAARMATLAGSVRLTTEMTRARKQLAPY
FT                   NGEAVVQALDVRLDHYAKQRGAVDNGGRPANSMEEVL"
FT   gene            649879..650730
FT                   /locus_tag="Caci_0565"
FT   CDS_pept        649879..650730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0565"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   sen:SACE_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69502"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF1"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU69502.1"
FT                   /translation="MSEPTPAHDGHDVDAIFDDLPSNIDTDVFSVARLYDFLLGGKHNF
FT                   APDRDFGRQLLAIEPNGRMILQQNRLFLARAIRVMLDDGVRQFLDLGSGIPTQNYVHEL
FT                   AHAVDPAARVVYIDNDPPAVSHSNYILRGDDNAGAVLADMTDAERVLGDPTVKSLIDFD
FT                   KPVGLTALAAWHFVDDHDDPAGVLEKYRRMLAPGSYLALTHATIDGATGDLVRDVQSQY
FT                   QAVMKNPSPRTRDQIAGFFEGFRILEPGIVNLPAWRPDKAEDAVGAENVWFYGALGKLT
FT                   AA"
FT   gene            complement(650697..652721)
FT                   /locus_tag="Caci_0566"
FT   CDS_pept        complement(650697..652721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0566"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   afw:Anae109_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69503"
FT                   /db_xref="GOA:C7PXF2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF2"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACU69503.1"
FT                   /translation="MDSPWIFTAFRAPADPGAAPDALQEIRHLRARILFDEGRRPAFRS
FT                   RAGDHADDQPQDHGAWHFAARRARDGAHGPPLGYVRLLTPVTASLYQSREFLGSTHYEE
FT                   VLSTEGLNPAAVFEHSRLVVEHRARKLGLGLHLNALAVAAAHELGAAAMIGTSGTADGQ
FT                   DRFHARFGFHPVPGTRRYVEKYTEDVVILLHRTEEGAGEHTALVDEYRLLFRYDLMEDA
FT                   GLAEPSVPLARSAQSSLSSLSSLSSRSAAKAEPSFTVPDRGPVWRDAPPRRLTAIGPSD
FT                   PHRWKPVLFEPAQPDARAAMTSLLNTGAVREVLDTVDAQLEELIRARDPGRVFDADALA
FT                   DARSDQLEGARPWAYGTWAWYPWSGRLVHVLPREEFRLVRTDRNRGKIDRPEQRRLLDK
FT                   RIGVIGLSVGNSAALTLAQEGVAGAFKLADFDTLSVSNLNRLRAGLHQIGVNKAVLAAR
FT                   QMFEIDPYLDIEIFPAGLTEDTVREFFLGGHGPIDLLVEECDTPWVKLAAREAARDLGV
FT                   PVVMDANDRGLLDIERFDREPHRPLLHGLLGALTPDDCLDLTFAERVDLILAMVDADRV
FT                   SPALAASIPEIGRTLSSWPQLASGVALGGALVTEAARRILLGSPCPSGRFYVDLEELIR
FT                   ADKNVVGATDSPGGTASGDPGPDPDPDPAQAAVSLPSAP"
FT   gene            652838..653857
FT                   /locus_tag="Caci_0567"
FT   CDS_pept        652838..653857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0567"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: fre:Franean1_5756 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69504"
FT                   /db_xref="GOA:C7PXF3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF3"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69504.1"
FT                   /translation="MTTRAAVVQGVGGCVPPRSVDNNELSSRLETSDAWIRERLGIGRR
FT                   YVADGVSTVDLAVEAGARALEMADAGAGLGPLDVVLLATTTPDRLCPASAPEVASRLGY
FT                   TGIAAFDVNAVCAGFVHALATGNALIRGHMADRVLVIGADTFTTLVDPADRLTASIFGD
FT                   GAGALVLRAGTPDEPGALRAFDLGSDGSQVATVEVPGGGARDRLGMPVANQRPYLVMDG
FT                   PAVFRRAVQEMTASSLRVLAKAKWDAGSVRRFVPHQANIRIIRGVAERLGIGAERVVAN
FT                   IEDVGNTVAASIPLALADAHDSGRLGAGERVLMTSIGAGLAWGSAVLTWPELQGKARL"
FT   gene            complement(654056..655348)
FT                   /locus_tag="Caci_0568"
FT   CDS_pept        complement(654056..655348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0568"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   sgr:SGR_3807 putative NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69505"
FT                   /db_xref="GOA:C7PYU9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYU9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU69505.1"
FT                   /translation="MSAYEAADNAFGDEGYPPPGNSAWFGGAPGVPALPGDGAPANGHE
FT                   FAPAAGFGTAPGGFGAAIGTAFADAGFGAMPTGGGDFGGANGAGFGGANGSGSGGASGT
FT                   GSGGANGASYGGANGGGYGAGDGFGGTNGSGSGSGGANGAGFGASHSSGTGSGSTSGRT
FT                   ALPDYPASSPNAVAYTDPGFGRQDFSAPPATRHAADPTSSSALLPALAHPGPPRPGPAG
FT                   DVLRLVAVTAGLGQPSTARILADRLAEAARARLGERGRQVLVEVLELRDLALDIAGAMV
FT                   AGFPGAKLRAALDAVEGADGLIAVSPIYTASYSGLFKSFFDVLDKDALTGKPTLIAATG
FT                   GTARHSLALDHALRPMFAYLRAFMVPTAVFAASEDWASTGENSLNERISRAGTELGDLM
FT                   AGTPAAGRRRRDEFEDVVPFEQRMAALRSGI"
FT   gene            complement(655345..656469)
FT                   /locus_tag="Caci_0569"
FT   CDS_pept        complement(655345..656469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0569"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sco:SCO3296 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69506"
FT                   /db_xref="GOA:C7PYV0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69506.1"
FT                   /translation="MSQMQFGVFTVGDVTPDPTTGRAPTEHERIKAMVTIAEHAEQAGL
FT                   DVFATGEHHNPPFVPSSPTTLLGWIAGRTSKLLLSTATTLITTNDPVKIAEDYAMLQHL
FT                   ADGRVDLTLGRGNTGPVYPWFGKDIRDGIDLALENYALLRRLWDEDVVDWSGRFRTPLQ
FT                   NFTAAPRPLDGVAPFVWHGSIRSPEIAEQAAYYGDGFFHNNIFWPKEHTQRMVALYRRR
FT                   FAHYGHGTEEQAIVGLGGQVFMRKNSQDAVREFRPYFDNAPVYGHGPSLEEFTAETPLT
FT                   VGSPEQVVERTLSFRAYAGDYQRQLFLLDHAGLPLKTVLEQIDLLGAEVVPVLRKEFAI
FT                   GRPAGVPDAPTHASLTARHDERSALSDTKEAIAP"
FT   gene            complement(656558..657637)
FT                   /locus_tag="Caci_0570"
FT   CDS_pept        complement(656558..657637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4408 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69507"
FT                   /db_xref="GOA:C7PYV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69507.1"
FT                   /translation="MAQVKDPTPVKDHAVRLVRFQRIEIDATRLVLSGIALALPVAIGA
FT                   ATDRLADGLTAVLGALLVSAAGHEGGWRARCVDLGASAAVGALVVWLGALIGAHGNLAS
FT                   VWIVAMAFGAAMAGGIGTLEARIAANATVFTVIGAHLGTGPESPGHIVLYVALGMAAAA
FT                   ALTLGTHALGRALSPLRRRELEGPPGPEWPFRRSVPKWRAGLRTWHGWQYAVRLVTSIA
FT                   VAEVVSQFRPGAHTYWIALTVTLVVLRDEAAAPMRALERGLGTTIGVLVGGGLIGVLPT
FT                   WGIVALIGVIGAVRPYLKLANYTAYAAVMTPLITMLNELGNDISWAVLRERVLDTLIGC
FT                   AIGLCVGYLPWRMWANRQR"
FT   gene            657708..658031
FT                   /locus_tag="Caci_0571"
FT   CDS_pept        657708..658031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0571"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   sma:SAV_7285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69508"
FT                   /db_xref="GOA:C7PYV2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV2"
FT                   /inference="protein motif:PFAM:PF05336"
FT                   /protein_id="ACU69508.1"
FT                   /translation="MRGVLVRVAIHTRLKPEGVTGYEQAHDDIPPEIPELLRAGGCTAW
FT                   TIWRNGVDLFHLVECEDWEALRAFLADKDDDRAWQARVGVFRDFSLVGGDQPLPMIFEL
FT                   PEG"
FT   gene            658034..658873
FT                   /locus_tag="Caci_0572"
FT   CDS_pept        658034..658873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0572"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sma:SAV_7286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69509"
FT                   /db_xref="GOA:C7PYV3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV3"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU69509.1"
FT                   /translation="MRIIDAHHHLWDLAVRDQPWTAELPALRRSFLLSDLEPLAAAAGV
FT                   SATVLVQTIHAADETPEMLALAETSDLVAGVVGWTDVAAPDFGERLSELRSGVGGRRLV
FT                   GIRHQVQELPDGGWLTRPDTRRGLRQLASNGLAFDLIVRADQIPACVAAARALPDLRFV
FT                   LDHLGKPNIASGEREPWASDIRALAELPNVACKLSGMVTEADAERWTVADLRPYSDLVL
FT                   EAFGPERLMFGSDWPVSTLAAGYPQVVETAMQLTSELSEAEREAVFGGTATEVYGLG"
FT   gene            complement(658881..659699)
FT                   /locus_tag="Caci_0573"
FT   CDS_pept        complement(658881..659699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0573"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   stp:Strop_2137 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69510"
FT                   /db_xref="GOA:C7PYV4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV4"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU69510.1"
FT                   /translation="MRAHHRVASRNARFQQWQTLLTNRQKRQRAGRFLVQGVRPLTLAA
FT                   EQGWRIEELLVDDDRRLSRWAEDFLDAAHTADADVIALPADMLAELGEKDQEAAPELLA
FT                   VVAMPPDDLIRIQITDTFLGVAFDRPAQPGNLGTLIRSADAFGADGVVVTGHAADVYDP
FT                   RTVRASTGSLFGLPTVRTQSHREVLEWLSETGVTVVGTDEDGDTDIEDYDFCAPTLFVV
FT                   GNEAVGMSTGWREACDRVLSIPMRGTASSLNAANAATVVLYEAARQRRQK"
FT   gene            659717..660592
FT                   /locus_tag="Caci_0574"
FT   CDS_pept        659717..660592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0574"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   bph:Bphy_2889 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69511"
FT                   /db_xref="GOA:C7PYV5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69511.1"
FT                   /translation="MAEPEDPSTSPQNSQPSQASPTYDDAERVLWADAGSGYEAVYAAL
FT                   CAHTIPALLDGAGVQDGSALLDVGTGTGTLVRAAVARGARVTAVDAEPSMLALARGKAP
FT                   EAEFLLAVVPDLPFEPDTFDAVVGNFVLDHFGRPKVAMRALRAIAKPGGRVAFTLWPAE
FT                   RSAGRSVFSRTGAMTEGWIPRQMPPLVLADDYPRTEEGLAGLFREIGLADVTTTVIDWE
FT                   HLTTAEEWWISMGSGVGPSGRTYQAQTPEVRAAFHENYLRVAAEMTDAEGTMRLPYRAL
FT                   LAVGTVVDSE"
FT   gene            complement(660744..661550)
FT                   /locus_tag="Caci_0575"
FT   CDS_pept        complement(660744..661550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0575"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   NADP oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   oan:Oant_3760 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69512"
FT                   /db_xref="GOA:C7PYV6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV6"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACU69512.1"
FT                   /translation="MTTKVAFLGLGAMGAPMAARVIGAGYEVVVWNRTAARTEPLVALG
FT                   AGAAADPAGAVAGAEFVITMLSDPAAVTAVAEAIAGALRPDAVLVEMSTIGPDGTERIR
FT                   GLIPASVGLVDAPVMGSVDRAADGTLAVLAGGTPQDLARVADLLKLFGNVTECGGPGTG
FT                   SARKLVLISGIVAGVAVVGETLALAEKLGLPDPRAVLEASPLGGLVARAFATGVDFSAE
FT                   MAAKDLRLAGEVLDLPVIAAAQRALEAVPDPDADLGEAVRALNAKR"
FT   sig_peptide     complement(661479..661550)
FT                   /locus_tag="Caci_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.567 at
FT                   residue 24"
FT   gene            complement(661606..662358)
FT                   /locus_tag="Caci_0576"
FT   CDS_pept        complement(661606..662358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1027 DivIVA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69513"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69513.1"
FT                   /translation="MSFNEYDGAPGGTGARRPERLSAEQIDAWEFPRAGLAHRGFDEEG
FT                   VLRFKRRVLGELQAAAQIETELRQRNDELTNQLRTTYAGSDPANGGAAAAPAAPSSFAP
FT                   EQRVTAAAVNAIAMAQRQAEEQIRAAEEYVRNVTEYARNQYTVTVNEGHRQGLLAAESA
FT                   FQRRSEQLSTSLHSLEQQLEFLKAFGVAFGVQVEGALEKAREEVHVMIKNIHQAFDALN
FT                   RNPPQSAGAPPVMGMAGLHAGSALPGTA"
FT   gene            complement(662355..663470)
FT                   /locus_tag="Caci_0577"
FT   CDS_pept        complement(662355..663470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0577"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: sen:SACE_7206 flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69514"
FT                   /db_xref="GOA:C7PYV8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69514.1"
FT                   /translation="MDPHLLRTSWAKVAQYGEQVPLFFYGHLFLSHPEVRAMFPPSMAA
FT                   QRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHRKFAVEPGHYPAVGASLLATLEQFLG
FT                   PDWTPAVAESWTEAYGIVAKVMTDAAAAASESTPPWWEAEIVAHEVVGGRRDIARVTIA
FT                   TRQPYAYTAGQSMTLETAMAPARWRFYTPANPPRQDGLIELHIKLVGAVSWQLVNIMGV
FT                   GDRLRLGPPVGYQLTLASTAPGTDLLLIAGSTGVAPLRAIVEELARTPDHGRHVTLFYG
FT                   ARIGSDLYDLPRLEQLAAHHGWLSVIPVVSDDHAWEGRHGLVGDIAAAYGNWPGHEVFI
FT                   VGSAGMCEHTAARLKEAGVIPGAIHLEESQP"
FT   gene            complement(663476..663859)
FT                   /locus_tag="Caci_0578"
FT   CDS_pept        complement(663476..663859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0578"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mgi:Mflv_3264 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69515"
FT                   /db_xref="GOA:C7PYV9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV9"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACU69515.1"
FT                   /translation="MSESQNQSQWERVGGEAAIKAVLDRFYEGVLDEPQLAGFFESVAV
FT                   DDIKPHMAEVLQVVLGGPGARTDIDLAGYLTEAHADLGVSLSDFELTGKVLLDTLEEFS
FT                   VPDDIVETIEGVLATVQPFVVAA"
FT   gene            complement(664125..665069)
FT                   /locus_tag="Caci_0579"
FT   CDS_pept        complement(664125..665069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0579"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sgr:SGR_3027
FT                   putative Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69516"
FT                   /db_xref="GOA:C7PYW0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69516.1"
FT                   /translation="MSSSLSDRRTDARFRADRNLSARMLSVMVLLAAVYGAAILLMIRF
FT                   MGRAWPLGLAVVVAFAVFQILTSGKVAMRTMGAREVSAEEEPELHALVDRLCALSGMKK
FT                   PTIAVAESRIPNACAVGRSKGGATLCVTRSLLDTLDPPELEGVIAHEMAHIEHGDAAVM
FT                   TVAAFVGVLAGLVARVGLRFIYIGGRARGLWHIIVAAIGLIALATATWFVSLVLTRSLS
FT                   RYREFAADRSAAQLTGNPSALASALAKVEAKVHGGGGIPQTDLRKAGALNAFYFAPVTS
FT                   AKTTAHHLLSTHPTTQARLDRLVKMSTEMSKNG"
FT   gene            complement(665201..666250)
FT                   /locus_tag="Caci_0580"
FT   CDS_pept        complement(665201..666250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_6654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69517"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW1"
FT                   /inference="similar to AA sequence:KEGG:SACE_6654"
FT                   /protein_id="ACU69517.1"
FT                   /translation="MTENWQQEPAPRLSTARDRAEAGPESIPVMPHGLKPVPMSRPGGP
FT                   RPDAPAPPYQPQSRWQEPQVYIANTYIDSPYTPPTPPPSQPPPTADPRIGNSRVGNPSD
FT                   GNSTMMVAVGTVQPAASRPPEVSTVEEAERILGYAVDSLDADPDLYSIGTVTDGAVCLI
FT                   PDDGRWSIFLADGGRRRYAGSFDNPEQAAIHFAGVLLIAAAERGALPKHAAGRAALPGR
FT                   STDPLAEMLAGPPITPLAGDPPTTLYSDQRLTILTPGTEVDRFGDQQGNTVYAARTRYP
FT                   HRSLPPDYIGRPYRVYRVRDPLRALTGTAIPWFGQPGGGMAYLLPRPIRDLLHEGALVE
FT                   IPSATLAPS"
FT   gene            complement(666299..667126)
FT                   /locus_tag="Caci_0581"
FT   CDS_pept        complement(666299..667126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0581"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7067 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69518"
FT                   /db_xref="GOA:C7PYW2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69518.1"
FT                   /translation="MELSYARRGSGEPLVLIHGIGHRWQAWEPVLDRLAEHHDVIAIDI
FT                   PGFGKSAPLKLAAGQHPTIGLAMERIAESFPGFGIERPHVAGNSLGGALALELARHGLA
FT                   ASATAFSPAGFWHTRWETAWALGNLSLTRAAAFAPEPVLRYIADHETTRALAFGMIFGK
FT                   PRRLDPALALADTLALRAGRSFRPVGREAKHYRYAGESDVPTTVAWGTKDRILLRRQFA
FT                   QAKQVLPKARFEDLPGCGHVPMNDDPERVSRLILETTGALPAGTREVVGPSDL"
FT   gene            complement(667233..668954)
FT                   /locus_tag="Caci_0582"
FT   CDS_pept        complement(667233..668954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0582"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   sma:SAV_3592 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69519"
FT                   /db_xref="GOA:C7PYW3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW3"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACU69519.1"
FT                   /translation="MTSLAPTRSSLPDDDSEEDYGGRRRGRSGSHRERGRVWWRPNLDP
FT                   RDDEQGELTLRERLVPSFAREPWWVTWGFPLLITLVGGFMRFWHLGLPKWVIFDETYYA
FT                   KDAWATIHFGHEIGWHDDGPGVGMANDDHAIIANPHIWRTLVANHQGNAVHPPVGKWMI
FT                   GAGEWLFGFTPFGWRFIPAVCGTLAILMTARIARRMFRSTLIGCLAGVLLAADGLEFVM
FT                   SRTALLDIFVMFWTLAAFGCFLVDRDKMRSRLVDWRESFPSTPLPDDVKAPPLGWRPWR
FT                   IAGAVCLGLDLGTKWSGLWIIPCFIAMSLLWDHAALRAVGIRRHWSGFLRRETWQTTLL
FT                   GLLVLATYAATWTGWFVTKDGNYRQWAAQNNAIHVPVLSALRSWWEYHWQTYHFHVNLD
FT                   SPHAYMSNPWSWLVMGRPTDYYYCSKGATGCPPLAADQHQQVLALGTPPLWWFASLALV
FT                   WCCWRWIARRDWRAGSILCGMLAAWAFWLNYQHRTIFTFYAVAFVPFMCLAAAYLLGVI
FT                   VGRSDALQYRRVWGAVVAGAITVYILVMFIYFYPILSAQTITYNQWLDRMWWPSWI"
FT   gene            669023..669910
FT                   /locus_tag="Caci_0583"
FT   CDS_pept        669023..669910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0583"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: sco:SCO3153
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69520"
FT                   /db_xref="GOA:C7PYW4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACU69520.1"
FT                   /translation="MTGTEPTPGLLVLAGTPIGQDEDASPRLAAELTAADVIATEDTRR
FT                   LKRLLRVLDLTPKARFVSYFEANESARTPDLLRDLLAGARVVVVTDAGMPSVSDPGYRL
FT                   VAAAVEAGVRVTAVPGPSAVLTALAVSGLPVDRFCFEGFLPRKGGGRSSRLTELSSEPR
FT                   TMVFFEAPHRLAASLADMAAALGTDRPAAVCRELTKTYEEIKRGTLADLAKWAADGEIR
FT                   GEITVVVGGALPGAGRDLSGAEIAELVFARETAGGLRRKEAIAEVAAELGLPKRDVFDA
FT                   VVAAKEAAEAADES"
FT   gene            complement(669986..670357)
FT                   /locus_tag="Caci_0584"
FT   CDS_pept        complement(669986..670357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0584"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   mav:MAV_3971 death-on-curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69521"
FT                   /db_xref="GOA:C7PYW5"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW5"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACU69521.1"
FT                   /translation="MRYLTTADLLAITTAALGPNTPIRDPGMIASAAHRPRTTAFGEDA
FT                   YPDLHTKAAAILHSILRNHPLVDGNKRLAWVACRTFLAVNGADFTPDEDAAVDFVMRAA
FT                   ASELGDVEAIAAVLREWTG"
FT   gene            complement(670354..670548)
FT                   /locus_tag="Caci_0585"
FT   CDS_pept        complement(670354..670548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69522"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69522.1"
FT                   /translation="MNTIPTGAEPAEEQRRDSGAGADGELVDELQDDPRDDLPDALVLE
FT                   TARRIIASDAAIIHRLGTI"
FT   gene            670631..672448
FT                   /locus_tag="Caci_0586"
FT   CDS_pept        670631..672448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0586"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: tfu:Tfu_0389 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69523"
FT                   /db_xref="GOA:C7PYW7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW7"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACU69523.1"
FT                   /translation="MPSTQRTILTAVAWPYANGPRHIGHVSGFGVPSDVFSRYQRMAGN
FT                   RVLMVSGTDEHGTPILVQADKEGVTARELADRYNRVIAEDLQSLGLAYDLFTRTTTRNH
FT                   YAVVQEIFKGLYDNGYIFPKTTMGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNC
FT                   GNQLDPDRLIDPRSRINGETPKFIETEQFFLDLPAFASVLGGWLQQQKTWRPNVLKFSL
FT                   NLLDDLQPRAISRDLDWGVPVPLEGWVDRPDKKLYVWFDAVVGYLSASVEWARRTGDPD
FT                   AWRAFWQTGPNGEAPDAYYFMGKDNIVFHSEIWPAMLLGYDGRGEKNGKPGSLGALNLP
FT                   HEVVSSEFLTMEGRKFSSSRAVVIYVRDFLSRYDADALRYYITAAGPETQDTDFTWSEF
FT                   LRRNNDELVAGWGNLVNRAISMAAKNLGQIPAAKDLTAEDEALLATSRGAFAVVGDLLD
FT                   RCRFKAALAEAMRLVAEANKYVSDHEPWKLAKTDPERMATVLHVTLQVVDDAKTLLTPF
FT                   LPFSSEKVFHLLGGEGTWSAMPELREVEDLDGGPGYPVLTGDYEQALARWESTPIEAGR
FT                   PLAPPTPIFKKLDPSIVDEELARLGGEAA"
FT   gene            672453..673439
FT                   /locus_tag="Caci_0587"
FT   CDS_pept        672453..673439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0587"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: sma:SAV_3589 deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69524"
FT                   /db_xref="GOA:C7PYW8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW8"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACU69524.1"
FT                   /translation="MADSETGLGGTEPGPADPAASEPGETKRKRKRKSRERDETPPPAP
FT                   EPLPAPVGDSHTHLDMQEPAAADIIAAADAVNVRRLVQVGVDVPSSRTAVELAAAFERV
FT                   HAAVALHPNEAPRLVLGDPDGWSGQHRAPGGAAALEEALAEIDKLAADEQVLGIGETGL
FT                   DYFRTGPEGAQAQQDSFRAHIAIAKRHGKALVIHDRDAHEDVLRILVEEGSPETVVFHC
FT                   YSGDAAMAKVCAERGYYMSFAGNLTYKANQALQEAFQVAPIDRVLVETDAPFLTPLPYR
FT                   GRPNAPYLVPYTVRAMAALRGMDSVTGLAELCQALDSNLRDAFQVRA"
FT   gene            673644..674771
FT                   /locus_tag="Caci_0588"
FT   CDS_pept        673644..674771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0588"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; protein of
FT                   unknown function DUF348; G5 domain protein; KEGG:
FT                   sma:SAV_3588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69525"
FT                   /db_xref="GOA:C7PYW9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW9"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU69525.1"
FT                   /translation="MSSRRSASRHSEGSKVKVRAVQGTVLLGLVGAAGAYVGFEKTVHL
FT                   TVDGQERTIHTFDGKVADVLKAQGISTDGHDQVAPAPGESLADGEQISVRYGRQLDVSV
FT                   DGKDQKIWSTATTVDEALGDLGLHGSNPALSVNRDQAIGRQGLSFQIKTQRHVNVLVDG
FT                   RSIPLDTTAQTVAQALSQAHVTLAGQDTASPAPDTFPTNGETITVDRVTGTQETKQVPI
FT                   AFSTTEQSDPSAYVGSRTTVSSGTQGVQEVVYAYLTVNGVKQAPKIVSKTVTKQPVNAV
FT                   VKVGTKPVPTTVAGADNLNWAGVAQCESGGNPKSVGGGGLYFGLYQFSVSTWAAMGGSG
FT                   LPSNATPAEQTYRAKLLYVRSGAGQWPVCGRKLFT"
FT   gene            674932..675852
FT                   /locus_tag="Caci_0589"
FT   CDS_pept        674932..675852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0589"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: sgr:SGR_4356 putative dimethyladenosine
FT                   transferase; TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69526"
FT                   /db_xref="GOA:C7PYX0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX0"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACU69526.1"
FT                   /translation="MSETPHSPPPTPEPDRLPARLLGPAEVRRLAEKLGVSPTKKLGQN
FT                   FVIDPNTIRRIVRAGDVTAEDVVVEVGPGLGSLTLGLLDVARRVVAVEIDPVLAAALPD
FT                   TLAEFAPGIAAGQAEFELVRADALRIAELPGSPPTALVANLPYNVAVPVLLHMLERFPS
FT                   IERTLIMVQSEVADRLAAEPGGRVYGVPSVKARWYADVKRAGAIGRSVFWPAPNVDSGL
FT                   VRLDRRAVPPSTKAGRRDVFAAVDAAFAQRRKTLRSALSGWAGSPAAAETALTAAGINP
FT                   SARGETLTVEEFARLAEHRPQREAA"
FT   gene            675849..676799
FT                   /locus_tag="Caci_0590"
FT   CDS_pept        675849..676799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0590"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: mjl:Mjls_4641 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69527"
FT                   /db_xref="GOA:C7PYX1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX1"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACU69527.1"
FT                   /translation="MSSAAYIPDEGPRPGETESVTVRVPAKVNLALSVGPLRSDGYHDL
FT                   ATVFHAVGLFDEVNAAAADTLAVTCEGEGQVEVPLDDTNLAWRAAELLARTVGRSPGVR
FT                   LHLTKGIPVAGGMAGGSADAAGALVACDALWGTGLSRDDLHVLAAQLGSDVPFALHGGT
FT                   AMGTGRGEQITPVLARGEFHWVFAFAHDGLSTPAVFHELDRLREAAGEEATAPGVEDEL
FT                   LRALRAGDSTLLGAALRNDLTRPATSLRPDLRATLQAGREAGALGTLLSGSGPTCAFLA
FT                   ADAVAAATVAAALEAAPSVRAVRRALGPAAGAHLL"
FT   gene            676873..679386
FT                   /locus_tag="Caci_0591"
FT   CDS_pept        676873..679386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0591"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: fal:FRAAL0578 putative serine/threonine
FT