(data stored in ACNUC4944 zone)

EMBL: CP001712

ID   CP001712; SV 1; circular; genomic DNA; STD; PRO; 3530383 BP.
AC   CP001712; AAOI01000000-AAOI01000007; CH902582;
PR   Project:PRJNA13461;
DT   13-SEP-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
DE   Robiginitalea biformata HTCC2501, complete genome.
KW   .
OS   Robiginitalea biformata HTCC2501
OC   Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
OC   Flavobacteriaceae; Robiginitalea.
RN   [1]
RP   1-3530383
RX   DOI; 10.1128/JB.01191-09.
RX   PUBMED; 19767438.
RA   Oh H.M., Giovannoni S.J., Lee K., Ferriera S., Johnson J., Cho J.C.;
RT   "Complete genome sequence of Robiginitalea biformata HTCC2501";
RL   J. Bacteriol. 191(22):7144-7145(2009).
RN   [2]
RP   1-3530383
RA   Giovannoni S.J., Cho J.-C., Ferriera S., Johnson J., Kravitz S.,
RA   Halpern A., Remington K., Beeson K., Tran B., Rogers Y.-H., Friedman R.,
RA   Venter J.C.;
RT   ;
RL   Submitted (22-FEB-2006) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RN   [3]
RP   1-3530383
RA   Oh H.-M., Lee K., Cho J.-C.;
RT   ;
RL   Submitted (19-AUG-2009) to the INSDC.
RL   Division of Biology and Ocean Sciences, Inha University, College of Natural
RL   Sciences Inha University, Incheon 402-751, Republic of Korea
DR   MD5; d1384a16ac31d9ebf5da76a2f021e358.
DR   BioSample; SAMN02603916.
DR   EnsemblGenomes-Gn; EBG00001000150.
DR   EnsemblGenomes-Gn; EBG00001000153.
DR   EnsemblGenomes-Gn; EBG00001000155.
DR   EnsemblGenomes-Gn; EBG00001000157.
DR   EnsemblGenomes-Gn; EBG00001000159.
DR   EnsemblGenomes-Gn; EBG00001000161.
DR   EnsemblGenomes-Gn; EBG00001000163.
DR   EnsemblGenomes-Gn; EBG00001000165.
DR   EnsemblGenomes-Gn; EBG00001000167.
DR   EnsemblGenomes-Gn; EBG00001000169.
DR   EnsemblGenomes-Gn; EBG00001000173.
DR   EnsemblGenomes-Gn; EBG00001000175.
DR   EnsemblGenomes-Gn; EBG00001000177.
DR   EnsemblGenomes-Gn; EBG00001000179.
DR   EnsemblGenomes-Gn; EBG00001000181.
DR   EnsemblGenomes-Gn; EBG00001000183.
DR   EnsemblGenomes-Gn; EBG00001000185.
DR   EnsemblGenomes-Gn; EBG00001000186.
DR   EnsemblGenomes-Gn; EBG00001000187.
DR   EnsemblGenomes-Gn; EBG00001000188.
DR   EnsemblGenomes-Gn; EBG00001000189.
DR   EnsemblGenomes-Gn; EBG00001000190.
DR   EnsemblGenomes-Gn; EBG00001000191.
DR   EnsemblGenomes-Gn; EBG00001000192.
DR   EnsemblGenomes-Gn; EBG00001000193.
DR   EnsemblGenomes-Gn; EBG00001000194.
DR   EnsemblGenomes-Gn; EBG00001000195.
DR   EnsemblGenomes-Gn; EBG00001000196.
DR   EnsemblGenomes-Gn; EBG00001000197.
DR   EnsemblGenomes-Gn; EBG00001000198.
DR   EnsemblGenomes-Gn; EBG00001000199.
DR   EnsemblGenomes-Gn; EBG00001000200.
DR   EnsemblGenomes-Gn; EBG00001000201.
DR   EnsemblGenomes-Gn; EBG00001000202.
DR   EnsemblGenomes-Gn; EBG00001000203.
DR   EnsemblGenomes-Gn; EBG00001000204.
DR   EnsemblGenomes-Gn; EBG00001000205.
DR   EnsemblGenomes-Gn; EBG00001000206.
DR   EnsemblGenomes-Gn; EBG00001000207.
DR   EnsemblGenomes-Gn; EBG00001000208.
DR   EnsemblGenomes-Gn; EBG00001000209.
DR   EnsemblGenomes-Gn; EBG00001000210.
DR   EnsemblGenomes-Gn; EBG00001000211.
DR   EnsemblGenomes-Gn; EBG00001000212.
DR   EnsemblGenomes-Gn; EBG00001000213.
DR   EnsemblGenomes-Gn; EBG00001000214.
DR   EnsemblGenomes-Gn; EBG00001000215.
DR   EnsemblGenomes-Gn; EBG00001000216.
DR   EnsemblGenomes-Gn; EBG00001000217.
DR   EnsemblGenomes-Gn; EBG00001000218.
DR   EnsemblGenomes-Gn; EBG00001000219.
DR   EnsemblGenomes-Gn; EBG00001000220.
DR   EnsemblGenomes-Gn; EBG00001000221.
DR   EnsemblGenomes-Gn; EBG00001000222.
DR   EnsemblGenomes-Gn; EBG00001000223.
DR   EnsemblGenomes-Gn; EBG00001000224.
DR   EnsemblGenomes-Gn; EBG00001000225.
DR   EnsemblGenomes-Gn; RB2501_5S01.
DR   EnsemblGenomes-Gn; RB2501_5S02.
DR   EnsemblGenomes-Gn; RB2501_LSU1.
DR   EnsemblGenomes-Gn; RB2501_LSU2.
DR   EnsemblGenomes-Gn; RB2501_h10000.
DR   EnsemblGenomes-Gn; RB2501_r00051.
DR   EnsemblGenomes-Gn; RB2501_r10172.
DR   EnsemblGenomes-Gn; RB2501_t00047.
DR   EnsemblGenomes-Gn; RB2501_t00049.
DR   EnsemblGenomes-Gn; RB2501_t01368.
DR   EnsemblGenomes-Gn; RB2501_t01370.
DR   EnsemblGenomes-Gn; RB2501_t02137.
DR   EnsemblGenomes-Gn; RB2501_t02139.
DR   EnsemblGenomes-Gn; RB2501_t02141.
DR   EnsemblGenomes-Gn; RB2501_t02143.
DR   EnsemblGenomes-Gn; RB2501_t02145.
DR   EnsemblGenomes-Gn; RB2501_t10132.
DR   EnsemblGenomes-Gn; RB2501_t10134.
DR   EnsemblGenomes-Gn; RB2501_t10136.
DR   EnsemblGenomes-Gn; RB2501_t10138.
DR   EnsemblGenomes-Gn; RB2501_t10140.
DR   EnsemblGenomes-Gn; RB2501_t10142.
DR   EnsemblGenomes-Gn; RB2501_t10144.
DR   EnsemblGenomes-Gn; RB2501_t10146.
DR   EnsemblGenomes-Gn; RB2501_t10148.
DR   EnsemblGenomes-Gn; RB2501_t10150.
DR   EnsemblGenomes-Gn; RB2501_t10152.
DR   EnsemblGenomes-Gn; RB2501_t10154.
DR   EnsemblGenomes-Gn; RB2501_t10156.
DR   EnsemblGenomes-Gn; RB2501_t10158.
DR   EnsemblGenomes-Gn; RB2501_t10160.
DR   EnsemblGenomes-Gn; RB2501_t10162.
DR   EnsemblGenomes-Gn; RB2501_t10164.
DR   EnsemblGenomes-Gn; RB2501_t10166.
DR   EnsemblGenomes-Gn; RB2501_t10168.
DR   EnsemblGenomes-Gn; RB2501_t10170.
DR   EnsemblGenomes-Gn; RB2501_t12734.
DR   EnsemblGenomes-Gn; RB2501_t12736.
DR   EnsemblGenomes-Gn; RB2501_t12738.
DR   EnsemblGenomes-Gn; RB2501_t12740.
DR   EnsemblGenomes-Gn; RB2501_t12742.
DR   EnsemblGenomes-Gn; RB2501_t16221.
DR   EnsemblGenomes-Gn; RB2501_t16223.
DR   EnsemblGenomes-Gn; RB2501_t16225.
DR   EnsemblGenomes-Gn; RB2501_t16227.
DR   EnsemblGenomes-Gn; RB2501_t16231.
DR   EnsemblGenomes-Tr; EBT00001523151.
DR   EnsemblGenomes-Tr; EBT00001523152.
DR   EnsemblGenomes-Tr; EBT00001523153.
DR   EnsemblGenomes-Tr; EBT00001523154.
DR   EnsemblGenomes-Tr; EBT00001523155.
DR   EnsemblGenomes-Tr; EBT00001523156.
DR   EnsemblGenomes-Tr; EBT00001523158.
DR   EnsemblGenomes-Tr; EBT00001523159.
DR   EnsemblGenomes-Tr; EBT00001523160.
DR   EnsemblGenomes-Tr; EBT00001523161.
DR   EnsemblGenomes-Tr; EBT00001523162.
DR   EnsemblGenomes-Tr; EBT00001523163.
DR   EnsemblGenomes-Tr; EBT00001523164.
DR   EnsemblGenomes-Tr; EBT00001523165.
DR   EnsemblGenomes-Tr; EBT00001523166.
DR   EnsemblGenomes-Tr; EBT00001523167.
DR   EnsemblGenomes-Tr; EBT00001523168.
DR   EnsemblGenomes-Tr; EBT00001523169.
DR   EnsemblGenomes-Tr; EBT00001523170.
DR   EnsemblGenomes-Tr; EBT00001523171.
DR   EnsemblGenomes-Tr; EBT00001523172.
DR   EnsemblGenomes-Tr; EBT00001523173.
DR   EnsemblGenomes-Tr; EBT00001523174.
DR   EnsemblGenomes-Tr; EBT00001523175.
DR   EnsemblGenomes-Tr; EBT00001523176.
DR   EnsemblGenomes-Tr; EBT00001523177.
DR   EnsemblGenomes-Tr; EBT00001523178.
DR   EnsemblGenomes-Tr; EBT00001523179.
DR   EnsemblGenomes-Tr; EBT00001523180.
DR   EnsemblGenomes-Tr; EBT00001523181.
DR   EnsemblGenomes-Tr; EBT00001523182.
DR   EnsemblGenomes-Tr; EBT00001523183.
DR   EnsemblGenomes-Tr; EBT00001523184.
DR   EnsemblGenomes-Tr; EBT00001523185.
DR   EnsemblGenomes-Tr; EBT00001523186.
DR   EnsemblGenomes-Tr; EBT00001523187.
DR   EnsemblGenomes-Tr; EBT00001523188.
DR   EnsemblGenomes-Tr; EBT00001523189.
DR   EnsemblGenomes-Tr; EBT00001523190.
DR   EnsemblGenomes-Tr; EBT00001523191.
DR   EnsemblGenomes-Tr; EBT00001523192.
DR   EnsemblGenomes-Tr; EBT00001523193.
DR   EnsemblGenomes-Tr; EBT00001523194.
DR   EnsemblGenomes-Tr; EBT00001523195.
DR   EnsemblGenomes-Tr; EBT00001523196.
DR   EnsemblGenomes-Tr; EBT00001523197.
DR   EnsemblGenomes-Tr; EBT00001523198.
DR   EnsemblGenomes-Tr; EBT00001523199.
DR   EnsemblGenomes-Tr; EBT00001523200.
DR   EnsemblGenomes-Tr; EBT00001523201.
DR   EnsemblGenomes-Tr; EBT00001523202.
DR   EnsemblGenomes-Tr; EBT00001523203.
DR   EnsemblGenomes-Tr; EBT00001523204.
DR   EnsemblGenomes-Tr; EBT00001523205.
DR   EnsemblGenomes-Tr; EBT00001523206.
DR   EnsemblGenomes-Tr; EBT00001523207.
DR   EnsemblGenomes-Tr; EBT00001523208.
DR   EnsemblGenomes-Tr; RB2501_5S01-1.
DR   EnsemblGenomes-Tr; RB2501_5S02-1.
DR   EnsemblGenomes-Tr; RB2501_LSU1-1.
DR   EnsemblGenomes-Tr; RB2501_LSU2-1.
DR   EnsemblGenomes-Tr; RB2501_h10000-1.
DR   EnsemblGenomes-Tr; RB2501_r00051-1.
DR   EnsemblGenomes-Tr; RB2501_r10172-1.
DR   EnsemblGenomes-Tr; RB2501_t00047-1.
DR   EnsemblGenomes-Tr; RB2501_t00049-1.
DR   EnsemblGenomes-Tr; RB2501_t01368-1.
DR   EnsemblGenomes-Tr; RB2501_t01370-1.
DR   EnsemblGenomes-Tr; RB2501_t02137-1.
DR   EnsemblGenomes-Tr; RB2501_t02139-1.
DR   EnsemblGenomes-Tr; RB2501_t02141-1.
DR   EnsemblGenomes-Tr; RB2501_t02143-1.
DR   EnsemblGenomes-Tr; RB2501_t02145-1.
DR   EnsemblGenomes-Tr; RB2501_t10132-1.
DR   EnsemblGenomes-Tr; RB2501_t10134-1.
DR   EnsemblGenomes-Tr; RB2501_t10136-1.
DR   EnsemblGenomes-Tr; RB2501_t10138-1.
DR   EnsemblGenomes-Tr; RB2501_t10140-1.
DR   EnsemblGenomes-Tr; RB2501_t10142-1.
DR   EnsemblGenomes-Tr; RB2501_t10144-1.
DR   EnsemblGenomes-Tr; RB2501_t10146-1.
DR   EnsemblGenomes-Tr; RB2501_t10148-1.
DR   EnsemblGenomes-Tr; RB2501_t10150-1.
DR   EnsemblGenomes-Tr; RB2501_t10152-1.
DR   EnsemblGenomes-Tr; RB2501_t10154-1.
DR   EnsemblGenomes-Tr; RB2501_t10156-1.
DR   EnsemblGenomes-Tr; RB2501_t10158-1.
DR   EnsemblGenomes-Tr; RB2501_t10160-1.
DR   EnsemblGenomes-Tr; RB2501_t10162-1.
DR   EnsemblGenomes-Tr; RB2501_t10164-1.
DR   EnsemblGenomes-Tr; RB2501_t10166-1.
DR   EnsemblGenomes-Tr; RB2501_t10168-1.
DR   EnsemblGenomes-Tr; RB2501_t10170-1.
DR   EnsemblGenomes-Tr; RB2501_t12734-1.
DR   EnsemblGenomes-Tr; RB2501_t12736-1.
DR   EnsemblGenomes-Tr; RB2501_t12738-1.
DR   EnsemblGenomes-Tr; RB2501_t12740-1.
DR   EnsemblGenomes-Tr; RB2501_t12742-1.
DR   EnsemblGenomes-Tr; RB2501_t16221-1.
DR   EnsemblGenomes-Tr; RB2501_t16223-1.
DR   EnsemblGenomes-Tr; RB2501_t16225-1.
DR   EnsemblGenomes-Tr; RB2501_t16227-1.
DR   EnsemblGenomes-Tr; RB2501_t16231-1.
DR   EuropePMC; PMC2772462; 19767438.
DR   EuropePMC; PMC3463246; 23066504.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00485; K_chan_RES.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01685; 6S-Flavo.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001712.
DR   SILVA-SSU; CP001712.
DR   StrainInfo; 370274; 1.
CC   On or before Sep 11, 2009 this sequence version replaced
CC   gi:88784720, gi:88784024, gi:88783511, gi:88783247, gi:88783013,
CC   gi:88782859, gi:88782850.
CC   Robiginitalea biformata HTCC2501 is available from ATCC or KCTC
CC   under the names of ATCC BAA-864 or KCTC 12146 respectively.
FH   Key             Location/Qualifiers
FT   source          1..3530383
FT                   /organism="Robiginitalea biformata HTCC2501"
FT                   /strain="HTCC2501"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:313596"
FT   gene            join(3530041..3530383,1..54)
FT                   /locus_tag="RB2501_03305"
FT   CDS_pept        join(3530041..3530382,1..54)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03305"
FT                   /db_xref="EnsemblGenomes-Tr:EAR14419"
FT                   /db_xref="GOA:A4CPU8"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A4CPU8"
FT                   /protein_id="EAR14419.2"
FT   gene            101..1423
FT                   /locus_tag="RB2501_03310"
FT   CDS_pept        101..1423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03310"
FT                   /product="trigger factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03310"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15890"
FT                   /db_xref="GOA:A4CG32"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG32"
FT                   /protein_id="EAR15890.2"
FT   gene            1691..2278
FT                   /locus_tag="RB2501_03315"
FT   CDS_pept        1691..2278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03315"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15891"
FT                   /db_xref="GOA:A4CG33"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG33"
FT                   /protein_id="EAR15891.1"
FT   gene            2360..3595
FT                   /locus_tag="RB2501_03320"
FT   CDS_pept        2360..3595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03320"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03320"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15892"
FT                   /db_xref="GOA:A4CG34"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG34"
FT                   /protein_id="EAR15892.1"
FT                   SFETINKLKAVS"
FT   gene            complement(3570..4112)
FT                   /locus_tag="RB2501_03325"
FT   CDS_pept        complement(3570..4112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03325"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15893"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG35"
FT                   /protein_id="EAR15893.1"
FT                   EVIEDRSGKPKKQLSAY"
FT   gene            complement(4371..4877)
FT                   /locus_tag="RB2501_03330"
FT   CDS_pept        complement(4371..4877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15894"
FT                   /db_xref="InterPro:IPR021958"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG36"
FT                   /protein_id="EAR15894.1"
FT                   LGRRF"
FT   gene            complement(4998..6128)
FT                   /locus_tag="RB2501_03335"
FT   CDS_pept        complement(4998..6128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03335"
FT                   /product="transcriptional regulator (AraC family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15895"
FT                   /db_xref="GOA:A4CG37"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG37"
FT                   /protein_id="EAR15895.1"
FT   gene            complement(6144..7673)
FT                   /locus_tag="RB2501_03340"
FT   CDS_pept        complement(6144..7673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03340"
FT                   /product="putative plant auxin-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15896"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG38"
FT                   /protein_id="EAR15896.1"
FT   gene            7734..8528
FT                   /locus_tag="RB2501_03345"
FT   CDS_pept        7734..8528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03345"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15897"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG39"
FT                   /protein_id="EAR15897.1"
FT   gene            8625..9335
FT                   /locus_tag="RB2501_03350"
FT   CDS_pept        8625..9335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15898"
FT                   /db_xref="GOA:A4CG40"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG40"
FT                   /protein_id="EAR15898.1"
FT                   VWWDRNRKKSRAEK"
FT   gene            complement(9344..12091)
FT                   /locus_tag="RB2501_03355"
FT   CDS_pept        complement(9344..12091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03355"
FT                   /product="outer membrane assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03355"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15899"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG41"
FT                   /protein_id="EAR15899.1"
FT   gene            complement(12200..12910)
FT                   /locus_tag="RB2501_03360"
FT   CDS_pept        complement(12200..12910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15900"
FT                   /db_xref="GOA:A4CG42"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG42"
FT                   /protein_id="EAR15900.1"
FT                   RFGLAPNEELPLAF"
FT   gene            complement(12913..14667)
FT                   /locus_tag="RB2501_03365"
FT   CDS_pept        complement(12913..14667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03365"
FT                   /product="protease IV"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03365"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15901"
FT                   /db_xref="GOA:A4CG43"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG43"
FT                   /protein_id="EAR15901.1"
FT                   LPFILEIR"
FT   gene            14762..15919
FT                   /locus_tag="RB2501_03370"
FT   CDS_pept        14762..15919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03370"
FT                   /product="deoxyguanosine kinase/deoxyadenosine kinase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03370"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15902"
FT                   /db_xref="GOA:A4CG44"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG44"
FT                   /protein_id="EAR15902.1"
FT   gene            complement(16049..16585)
FT                   /locus_tag="RB2501_03375"
FT   CDS_pept        complement(16049..16585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03375"
FT                   /product="putative SpoU rRNA methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03375"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15903"
FT                   /db_xref="GOA:A4CG45"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG45"
FT                   /protein_id="EAR15903.1"
FT                   VLLWDFYLKQARDLE"
FT   gene            16756..19371
FT                   /locus_tag="RB2501_03380"
FT   CDS_pept        16756..19371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03380"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15904"
FT                   /db_xref="GOA:A4CG46"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG46"
FT                   /protein_id="EAR15904.1"
FT                   "
FT   gene            19494..21191
FT                   /locus_tag="RB2501_03385"
FT   CDS_pept        19494..21191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03385"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03385"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15905"
FT                   /db_xref="GOA:A4CG47"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG47"
FT                   /protein_id="EAR15905.1"
FT   gene            21420..21492
FT                   /locus_tag="RB2501_t10132"
FT   tRNA            21420..21492
FT                   /locus_tag="RB2501_t10132"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            21540..21624
FT                   /locus_tag="RB2501_t10134"
FT   tRNA            21540..21624
FT                   /locus_tag="RB2501_t10134"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            complement(22096..23964)
FT                   /locus_tag="RB2501_03390"
FT   CDS_pept        complement(22096..23964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03390"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15906"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG48"
FT                   /protein_id="EAR15906.1"
FT   gene            complement(24103..24945)
FT                   /locus_tag="RB2501_03395"
FT   CDS_pept        complement(24103..24945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03395"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15907"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG49"
FT                   /protein_id="EAR15907.1"
FT   gene            25086..25730
FT                   /locus_tag="RB2501_03400"
FT   CDS_pept        25086..25730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03400"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03400"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15908"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG50"
FT                   /protein_id="EAR15908.1"
FT   gene            25811..27061
FT                   /locus_tag="RB2501_03405"
FT   CDS_pept        25811..27061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03405"
FT                   /product="transporter, NRAMP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03405"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15909"
FT                   /db_xref="GOA:A4CG51"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG51"
FT                   /protein_id="EAR15909.1"
FT                   GILFLSLFAAYYCWLLL"
FT   gene            27230..27421
FT                   /locus_tag="RB2501_03410"
FT   CDS_pept        27230..27421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15910"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG52"
FT                   /protein_id="EAR15910.1"
FT                   RQTYYGEVKACTDCQLER"
FT   gene            complement(27423..29294)
FT                   /locus_tag="RB2501_03415"
FT   CDS_pept        complement(27423..29294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03415"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15911"
FT                   /db_xref="GOA:A4CG53"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG53"
FT                   /protein_id="EAR15911.1"
FT   gene            complement(29358..30353)
FT                   /locus_tag="RB2501_03420"
FT   CDS_pept        complement(29358..30353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15912"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG54"
FT                   /protein_id="EAR15912.1"
FT   gene            complement(30355..35043)
FT                   /locus_tag="RB2501_03425"
FT   CDS_pept        complement(30355..35043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03425"
FT                   /product="probable aggregation factor core protein MAFp3,
FT                   isoform C"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15913"
FT                   /db_xref="GOA:A4CG55"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG55"
FT                   /protein_id="EAR15913.1"
FT   gene            complement(35210..36097)
FT                   /locus_tag="RB2501_03430"
FT   CDS_pept        complement(35210..36097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03430"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03430"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15914"
FT                   /db_xref="GOA:A4CG56"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG56"
FT                   /protein_id="EAR15914.1"
FT                   IESGVAAESAQLPG"
FT   gene            complement(36256..36801)
FT                   /locus_tag="RB2501_03435"
FT   CDS_pept        complement(36256..36801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03435"
FT                   /product="polyketide synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15915"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG57"
FT                   /protein_id="EAR15915.1"
FT                   PDLAKVAEICAKQGIRFV"
FT   gene            complement(36886..37710)
FT                   /locus_tag="RB2501_03440"
FT   CDS_pept        complement(36886..37710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03440"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15916"
FT                   /db_xref="GOA:A4CG58"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG58"
FT                   /protein_id="EAR15916.1"
FT   gene            complement(37784..38314)
FT                   /locus_tag="RB2501_03445"
FT   CDS_pept        complement(37784..38314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03445"
FT                   /product="putative hexapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03445"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15917"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG59"
FT                   /protein_id="EAR15917.1"
FT                   RYSGWFREGSPED"
FT   gene            complement(38368..39096)
FT                   /locus_tag="RB2501_03450"
FT   CDS_pept        complement(38368..39096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03450"
FT                   /product="two-component system response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15918"
FT                   /db_xref="GOA:A4CG60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG60"
FT                   /protein_id="EAR15918.1"
FT   gene            complement(39098..41095)
FT                   /locus_tag="RB2501_03455"
FT   CDS_pept        complement(39098..41095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03455"
FT                   /product="ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15919"
FT                   /db_xref="GOA:A4CG61"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG61"
FT                   /protein_id="EAR15919.1"
FT   gene            41301..42491
FT                   /locus_tag="RB2501_03460"
FT   CDS_pept        41301..42491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15920"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG62"
FT                   /protein_id="EAR15920.1"
FT   gene            42674..43723
FT                   /locus_tag="RB2501_03465"
FT   CDS_pept        42674..43723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03465"
FT                   /product="adenylate cyclase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03465"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15921"
FT                   /db_xref="GOA:A4CG63"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG63"
FT                   /protein_id="EAR15921.1"
FT                   FTVSPAAEM"
FT   gene            43840..43905
FT                   /locus_tag="RB2501_03470"
FT   CDS_pept        43840..43905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03470"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15922"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG64"
FT                   /protein_id="EAR15922.1"
FT                   /translation="MSMRASEKGLAKARAAKFPQA"
FT   gene            44196..44261
FT                   /locus_tag="RB2501_03475"
FT   CDS_pept        44196..44261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03475"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15923"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG65"
FT                   /protein_id="EAR15923.1"
FT                   /translation="MSMRASEKGLAKARAATFPQA"
FT   gene            complement(44351..45376)
FT                   /locus_tag="RB2501_03480"
FT   CDS_pept        complement(44351..45376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15924"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG66"
FT                   /protein_id="EAR15924.1"
FT                   Y"
FT   gene            45497..46399
FT                   /locus_tag="RB2501_03485"
FT   CDS_pept        45497..46399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03485"
FT                   /product="nifU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15925"
FT                   /db_xref="GOA:A4CG67"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG67"
FT                   /protein_id="EAR15925.1"
FT   gene            46466..46666
FT                   /locus_tag="RB2501_03490"
FT   CDS_pept        46466..46666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03490"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15926"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG68"
FT                   /protein_id="EAR15926.1"
FT   gene            46813..48858
FT                   /locus_tag="RB2501_03495"
FT   CDS_pept        46813..48858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15927"
FT                   /db_xref="GOA:A4CG69"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG69"
FT                   /protein_id="EAR15927.1"
FT   gene            48956..49786
FT                   /locus_tag="RB2501_03500"
FT   CDS_pept        48956..49786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03500"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03500"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15928"
FT                   /db_xref="GOA:A4CG70"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG70"
FT                   /protein_id="EAR15928.1"
FT   gene            49860..50567
FT                   /locus_tag="RB2501_03505"
FT   CDS_pept        49860..50567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03505"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15929"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG71"
FT                   /protein_id="EAR15929.1"
FT                   LLASSPESTFASR"
FT   gene            complement(50548..51213)
FT                   /locus_tag="RB2501_03510"
FT   CDS_pept        complement(50548..51213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03510"
FT                   /product="putative glycoprotease family exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03510"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15930"
FT                   /db_xref="GOA:A4CG72"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG72"
FT                   /protein_id="EAR15930.1"
FT   gene            complement(51291..52676)
FT                   /locus_tag="RB2501_03515"
FT   CDS_pept        complement(51291..52676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03515"
FT                   /product="putative outer membrane transport/efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15931"
FT                   /db_xref="GOA:A4CG73"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG73"
FT                   /protein_id="EAR15931.1"
FT                   TLD"
FT   gene            complement(52695..53807)
FT                   /locus_tag="RB2501_03520"
FT   CDS_pept        complement(52695..53807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03520"
FT                   /product="membrane fusion efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15932"
FT                   /db_xref="GOA:A4CG74"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG74"
FT                   /protein_id="EAR15932.1"
FT   gene            complement(53848..55068)
FT                   /locus_tag="RB2501_03525"
FT   CDS_pept        complement(53848..55068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03525"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15933"
FT                   /db_xref="GOA:A4CG75"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG75"
FT                   /protein_id="EAR15933.1"
FT                   IDALREE"
FT   gene            complement(55106..56335)
FT                   /locus_tag="RB2501_03530"
FT   CDS_pept        complement(55106..56335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03530"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15934"
FT                   /db_xref="GOA:A4CG76"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG76"
FT                   /protein_id="EAR15934.1"
FT                   VKPIDALRAD"
FT   gene            complement(56325..57029)
FT                   /locus_tag="RB2501_03535"
FT   CDS_pept        complement(56325..57029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03535"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03535"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15935"
FT                   /db_xref="GOA:A4CG77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG77"
FT                   /protein_id="EAR15935.1"
FT                   KIEQVRASQYVQ"
FT   gene            complement(57126..58238)
FT                   /locus_tag="RB2501_03540"
FT   CDS_pept        complement(57126..58238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03540"
FT                   /product="putative transport/efflux component protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15936"
FT                   /db_xref="GOA:A4CG78"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG78"
FT                   /protein_id="EAR15936.1"
FT   gene            complement(58302..59561)
FT                   /locus_tag="RB2501_03545"
FT   CDS_pept        complement(58302..59561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03545"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03545"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15937"
FT                   /db_xref="GOA:A4CG79"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG79"
FT                   /protein_id="EAR15937.1"
FT   gene            complement(59591..60835)
FT                   /locus_tag="RB2501_03550"
FT   CDS_pept        complement(59591..60835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03550"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03550"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15938"
FT                   /db_xref="GOA:A4CG80"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG80"
FT                   /protein_id="EAR15938.1"
FT                   WRAANIRVINALRDE"
FT   gene            complement(60939..61157)
FT                   /locus_tag="RB2501_03555"
FT   CDS_pept        complement(60939..61157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15939"
FT                   /db_xref="GOA:A4CG81"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG81"
FT                   /protein_id="EAR15939.1"
FT   gene            complement(61163..61726)
FT                   /locus_tag="RB2501_03560"
FT   CDS_pept        complement(61163..61726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03560"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15940"
FT                   /db_xref="GOA:A4CG82"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG82"
FT                   /protein_id="EAR15940.1"
FT   gene            complement(61716..62471)
FT                   /locus_tag="RB2501_03565"
FT   CDS_pept        complement(61716..62471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03565"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15941"
FT                   /db_xref="GOA:A4CG83"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG83"
FT                   /protein_id="EAR15941.1"
FT   gene            complement(62481..63122)
FT                   /locus_tag="RB2501_03570"
FT   CDS_pept        complement(62481..63122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15942"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG84"
FT                   /protein_id="EAR15942.1"
FT   gene            63516..63662
FT                   /locus_tag="RB2501_03575"
FT   CDS_pept        63516..63662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03575"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15943"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG85"
FT                   /protein_id="EAR15943.1"
FT                   RSA"
FT   gene            complement(63744..64127)
FT                   /locus_tag="RB2501_03580"
FT   CDS_pept        complement(63744..64127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15944"
FT                   /db_xref="GOA:A4CG86"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG86"
FT                   /protein_id="EAR15944.1"
FT   gene            complement(64149..65123)
FT                   /locus_tag="RB2501_03585"
FT   CDS_pept        complement(64149..65123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03585"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15945"
FT                   /db_xref="GOA:A4CG87"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG87"
FT                   /protein_id="EAR15945.1"
FT   gene            complement(65214..65804)
FT                   /locus_tag="RB2501_03590"
FT   CDS_pept        complement(65214..65804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03590"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03590"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15946"
FT                   /db_xref="GOA:A4CG88"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG88"
FT                   /protein_id="EAR15946.1"
FT   gene            complement(65801..66700)
FT                   /locus_tag="RB2501_03595"
FT   CDS_pept        complement(65801..66700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03595"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15947"
FT                   /db_xref="GOA:A4CG89"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG89"
FT                   /protein_id="EAR15947.1"
FT                   SVTYITLMQIVYVVDSFI"
FT   gene            complement(66818..67522)
FT                   /locus_tag="RB2501_03600"
FT   CDS_pept        complement(66818..67522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03600"
FT                   /product="TonB"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03600"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15948"
FT                   /db_xref="GOA:A4CG90"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG90"
FT                   /protein_id="EAR15948.1"
FT                   VPFSIPIMFKLQ"
FT   gene            complement(67577..67936)
FT                   /locus_tag="RB2501_03605"
FT   CDS_pept        complement(67577..67936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03605"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15949"
FT                   /db_xref="GOA:A4CG91"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG91"
FT                   /protein_id="EAR15949.1"
FT                   LKVAFHELGALNWPD"
FT   gene            complement(67971..68351)
FT                   /locus_tag="RB2501_03610"
FT   CDS_pept        complement(67971..68351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03610"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15950"
FT                   /db_xref="GOA:A4CG92"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG92"
FT                   /protein_id="EAR15950.1"
FT   gene            complement(68441..75625)
FT                   /locus_tag="RB2501_03615"
FT   CDS_pept        complement(68441..75625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03615"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15951"
FT                   /db_xref="InterPro:IPR025684"
FT                   /db_xref="InterPro:IPR026377"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG93"
FT                   /protein_id="EAR15951.1"
FT   gene            complement(75631..76212)
FT                   /locus_tag="RB2501_03620"
FT   CDS_pept        complement(75631..76212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03620"
FT                   /product="Holliday junction DNA helicase motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15952"
FT                   /db_xref="GOA:A4CG94"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG94"
FT                   /protein_id="EAR15952.1"
FT   gene            complement(76258..78552)
FT                   /locus_tag="RB2501_03625"
FT   CDS_pept        complement(76258..78552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03625"
FT                   /product="putative NADP-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15953"
FT                   /db_xref="GOA:A4CG95"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG95"
FT                   /protein_id="EAR15953.1"
FT                   REKRRRAKRKK"
FT   gene            78656..78721
FT                   /locus_tag="RB2501_03630"
FT   CDS_pept        78656..78721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15954"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG96"
FT                   /protein_id="EAR15954.1"
FT                   /translation="MGRFSLPETDGFLRDTGVFWF"
FT   gene            complement(78771..80099)
FT                   /locus_tag="RB2501_03635"
FT   CDS_pept        complement(78771..80099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03635"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03635"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15955"
FT                   /db_xref="GOA:A4CG97"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG97"
FT                   /protein_id="EAR15955.1"
FT   gene            complement(80214..81170)
FT                   /locus_tag="RB2501_03640"
FT   CDS_pept        complement(80214..81170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03640"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03640"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15956"
FT                   /db_xref="GOA:A4CG98"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG98"
FT                   /protein_id="EAR15956.1"
FT   gene            complement(81219..81818)
FT                   /locus_tag="RB2501_03645"
FT   CDS_pept        complement(81219..81818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03645"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03645"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15957"
FT                   /db_xref="GOA:A4CG99"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CG99"
FT                   /protein_id="EAR15957.1"
FT   gene            complement(81859..82422)
FT                   /locus_tag="RB2501_03650"
FT   CDS_pept        complement(81859..82422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15958"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA0"
FT                   /protein_id="EAR15958.1"
FT   gene            complement(82639..85548)
FT                   /locus_tag="RB2501_03655"
FT   CDS_pept        complement(82639..85548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03655"
FT                   /product="two-component system sensor histidine
FT                   kinase/response regulator, hybrid ('one component system')"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03655"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15959"
FT                   /db_xref="GOA:A4CGA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA1"
FT                   /protein_id="EAR15959.1"
FT   gene            complement(85635..86657)
FT                   /locus_tag="RB2501_03660"
FT   CDS_pept        complement(85635..86657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03660"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03660"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15960"
FT                   /db_xref="GOA:A4CGA2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA2"
FT                   /protein_id="EAR15960.1"
FT                   "
FT   gene            complement(86654..86854)
FT                   /locus_tag="RB2501_03665"
FT   CDS_pept        complement(86654..86854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15961"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA3"
FT                   /protein_id="EAR15961.1"
FT   gene            86880..88460
FT                   /locus_tag="RB2501_03670"
FT   CDS_pept        86880..88460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03670"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15962"
FT                   /db_xref="GOA:A4CGA4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA4"
FT                   /protein_id="EAR15962.1"
FT                   PEIVAAGPQ"
FT   gene            88585..90867
FT                   /locus_tag="RB2501_03675"
FT   CDS_pept        88585..90867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03675"
FT                   /product="acyl-coenzyme A oxidase I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03675"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15963"
FT                   /db_xref="GOA:A4CGA5"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA5"
FT                   /protein_id="EAR15963.1"
FT                   ADQSGSL"
FT   gene            complement(90849..91673)
FT                   /locus_tag="RB2501_03680"
FT   CDS_pept        complement(90849..91673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03680"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15964"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA6"
FT                   /protein_id="EAR15964.1"
FT   gene            complement(91864..93582)
FT                   /locus_tag="RB2501_03685"
FT   CDS_pept        complement(91864..93582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03685"
FT                   /product="Cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03685"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15965"
FT                   /db_xref="GOA:A4CGA7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA7"
FT                   /protein_id="EAR15965.1"
FT   gene            complement(93728..94735)
FT                   /locus_tag="RB2501_03690"
FT   CDS_pept        complement(93728..94735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03690"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15966"
FT                   /db_xref="GOA:A4CGA8"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA8"
FT                   /protein_id="EAR15966.1"
FT   gene            complement(94823..96172)
FT                   /locus_tag="RB2501_03695"
FT   CDS_pept        complement(94823..96172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03695"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15967"
FT                   /db_xref="GOA:A4CGA9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGA9"
FT                   /protein_id="EAR15967.1"
FT   gene            complement(96186..96746)
FT                   /locus_tag="RB2501_03700"
FT   CDS_pept        complement(96186..96746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03700"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15968"
FT                   /db_xref="GOA:A4CGB0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB0"
FT                   /protein_id="EAR15968.1"
FT   gene            complement(96756..97277)
FT                   /locus_tag="RB2501_03705"
FT   CDS_pept        complement(96756..97277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03705"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15969"
FT                   /db_xref="GOA:A4CGB1"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB1"
FT                   /protein_id="EAR15969.1"
FT                   GAVEINRVEK"
FT   gene            complement(97283..99025)
FT                   /locus_tag="RB2501_03710"
FT   CDS_pept        complement(97283..99025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03710"
FT                   /product="molybdopterin oxidoredutase membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03710"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15970"
FT                   /db_xref="GOA:A4CGB2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB2"
FT                   /protein_id="EAR15970.1"
FT                   NEKQ"
FT   gene            complement(99052..102183)
FT                   /locus_tag="RB2501_03715"
FT   CDS_pept        complement(99052..102183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03715"
FT                   /product="molybdopterin oxidoreductase, iron-sulfur binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15971"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR030948"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB3"
FT                   /protein_id="EAR15971.1"
FT   gene            complement(102217..103614)
FT                   /locus_tag="RB2501_03720"
FT   CDS_pept        complement(102217..103614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03720"
FT                   /product="Cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15972"
FT                   /db_xref="GOA:A4CGB4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB4"
FT                   /protein_id="EAR15972.1"
FT                   ECGKCHY"
FT   gene            103937..104305
FT                   /locus_tag="RB2501_03725"
FT   CDS_pept        103937..104305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03725"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15973"
FT                   /db_xref="GOA:A4CGB5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB5"
FT                   /protein_id="EAR15973.1"
FT                   REVRKKFPGALLLRPGDR"
FT   gene            complement(104678..107314)
FT                   /locus_tag="RB2501_03730"
FT   CDS_pept        complement(104678..107314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03730"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03730"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15974"
FT                   /db_xref="GOA:A4CGB6"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB6"
FT                   /protein_id="EAR15974.1"
FT                   VAVKKTL"
FT   gene            complement(107356..108588)
FT                   /locus_tag="RB2501_03735"
FT   CDS_pept        complement(107356..108588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03735"
FT                   /product="transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03735"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15975"
FT                   /db_xref="GOA:A4CGB7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB7"
FT                   /protein_id="EAR15975.1"
FT                   VIRILKEEFED"
FT   gene            complement(108604..109077)
FT                   /locus_tag="RB2501_03740"
FT   CDS_pept        complement(108604..109077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15976"
FT                   /db_xref="GOA:A4CGB8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB8"
FT                   /protein_id="EAR15976.1"
FT   gene            109270..110652
FT                   /locus_tag="RB2501_03745"
FT   CDS_pept        109270..110652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03745"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15977"
FT                   /db_xref="GOA:A4CGB9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGB9"
FT                   /protein_id="EAR15977.1"
FT                   NH"
FT   gene            110726..111316
FT                   /locus_tag="RB2501_03750"
FT   CDS_pept        110726..111316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03750"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15978"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC0"
FT                   /protein_id="EAR15978.1"
FT   gene            111335..111916
FT                   /locus_tag="RB2501_03755"
FT   CDS_pept        111335..111916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03755"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15979"
FT                   /db_xref="GOA:A4CGC1"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC1"
FT                   /protein_id="EAR15979.1"
FT   gene            complement(111956..112027)
FT                   /locus_tag="RB2501_t10170"
FT   tRNA            complement(111956..112027)
FT                   /locus_tag="RB2501_t10170"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            112222..115572
FT                   /locus_tag="RB2501_03760"
FT   CDS_pept        112222..115572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03760"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15980"
FT                   /db_xref="GOA:A4CGC2"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC2"
FT                   /protein_id="EAR15980.1"
FT                   VVPADSISN"
FT   gene            complement(115827..116123)
FT                   /locus_tag="RB2501_03765"
FT   CDS_pept        complement(115827..116123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03765"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03765"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15981"
FT                   /db_xref="GOA:A4CGC3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC3"
FT                   /protein_id="EAR15981.1"
FT   gene            complement(116215..117444)
FT                   /locus_tag="RB2501_03770"
FT   CDS_pept        complement(116215..117444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15982"
FT                   /db_xref="GOA:A4CGC4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC4"
FT                   /protein_id="EAR15982.1"
FT                   VITLKKTGLT"
FT   gene            complement(117484..118224)
FT                   /locus_tag="RB2501_03775"
FT   CDS_pept        complement(117484..118224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03775"
FT                   /product="probable copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03775"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15983"
FT                   /db_xref="GOA:A4CGC5"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC5"
FT                   /protein_id="EAR15983.1"
FT   gene            118266..119267
FT                   /locus_tag="RB2501_03780"
FT   CDS_pept        118266..119267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03780"
FT                   /product="asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15984"
FT                   /db_xref="GOA:A4CGC6"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC6"
FT                   /protein_id="EAR15984.1"
FT   gene            119307..122135
FT                   /locus_tag="RB2501_03785"
FT   CDS_pept        119307..122135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03785"
FT                   /product="putative DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03785"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15985"
FT                   /db_xref="GOA:A4CGC7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC7"
FT                   /protein_id="EAR15985.1"
FT                   DMGFGETWLEAH"
FT   gene            complement(122153..124606)
FT                   /locus_tag="RB2501_03790"
FT   CDS_pept        complement(122153..124606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03790"
FT                   /product="putative TonB-dependent outer membrane receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03790"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15986"
FT                   /db_xref="GOA:A4CGC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC8"
FT                   /protein_id="EAR15986.1"
FT                   NFSFD"
FT   gene            complement(124594..125745)
FT                   /locus_tag="RB2501_03795"
FT   CDS_pept        complement(124594..125745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03795"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15987"
FT                   /db_xref="InterPro:IPR025345"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGC9"
FT                   /protein_id="EAR15987.1"
FT   gene            complement(125847..128540)
FT                   /locus_tag="RB2501_03800"
FT   CDS_pept        complement(125847..128540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03800"
FT                   /product="putative membrane associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03800"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15988"
FT                   /db_xref="GOA:A4CGD0"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD0"
FT                   /protein_id="EAR15988.1"
FT   gene            128769..129224
FT                   /locus_tag="RB2501_03805"
FT   CDS_pept        128769..129224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03805"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03805"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15989"
FT                   /db_xref="GOA:A4CGD1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD1"
FT                   /protein_id="EAR15989.1"
FT   gene            129224..129610
FT                   /locus_tag="RB2501_03810"
FT   CDS_pept        129224..129610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03810"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03810"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15990"
FT                   /db_xref="GOA:A4CGD2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD2"
FT                   /protein_id="EAR15990.1"
FT   gene            129920..131089
FT                   /locus_tag="RB2501_03815"
FT   CDS_pept        129920..131089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03815"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03815"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15991"
FT                   /db_xref="GOA:A4CGD3"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD3"
FT                   /protein_id="EAR15991.1"
FT   gene            131162..131986
FT                   /locus_tag="RB2501_03820"
FT   CDS_pept        131162..131986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03820"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03820"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15992"
FT                   /db_xref="GOA:A4CGD4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD4"
FT                   /protein_id="EAR15992.1"
FT   gene            complement(132101..133969)
FT                   /locus_tag="RB2501_03825"
FT   CDS_pept        complement(132101..133969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03825"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15993"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD5"
FT                   /protein_id="EAR15993.1"
FT   gene            134116..134823
FT                   /locus_tag="RB2501_03830"
FT   CDS_pept        134116..134823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03830"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03830"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15994"
FT                   /db_xref="GOA:A4CGD6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD6"
FT                   /protein_id="EAR15994.1"
FT                   IVSGENIGTVVNL"
FT   gene            134845..135399
FT                   /locus_tag="RB2501_03835"
FT   CDS_pept        134845..135399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03835"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03835"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15995"
FT                   /db_xref="GOA:A4CGD7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD7"
FT                   /protein_id="EAR15995.1"
FT   gene            135700..138099
FT                   /locus_tag="RB2501_03840"
FT   CDS_pept        135700..138099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03840"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15996"
FT                   /db_xref="GOA:A4CGD8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD8"
FT                   /protein_id="EAR15996.1"
FT   gene            138196..139623
FT                   /locus_tag="RB2501_03845"
FT   CDS_pept        138196..139623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03845"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03845"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15997"
FT                   /db_xref="GOA:A4CGD9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGD9"
FT                   /protein_id="EAR15997.1"
FT                   NIRDVIPFPRTPQNAEF"
FT   gene            139680..141137
FT                   /locus_tag="RB2501_03850"
FT   CDS_pept        139680..141137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03850"
FT                   /product="RNA polymerase sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15998"
FT                   /db_xref="GOA:A4CGE0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE0"
FT                   /protein_id="EAR15998.1"
FT   gene            141137..141742
FT                   /locus_tag="RB2501_03855"
FT   CDS_pept        141137..141742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03855"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03855"
FT                   /db_xref="EnsemblGenomes-Tr:EAR15999"
FT                   /db_xref="GOA:A4CGE1"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE1"
FT                   /protein_id="EAR15999.1"
FT   gene            complement(141739..142500)
FT                   /locus_tag="RB2501_03860"
FT   CDS_pept        complement(141739..142500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16000"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE2"
FT                   /protein_id="EAR16000.1"
FT   gene            complement(142548..143030)
FT                   /locus_tag="RB2501_03865"
FT   CDS_pept        complement(142548..143030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03865"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16001"
FT                   /db_xref="GOA:A4CGE3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE3"
FT                   /protein_id="EAR16001.1"
FT   gene            complement(143043..143606)
FT                   /locus_tag="RB2501_03870"
FT   CDS_pept        complement(143043..143606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03870"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16002"
FT                   /db_xref="GOA:A4CGE4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE4"
FT                   /protein_id="EAR16002.1"
FT   gene            complement(143660..144040)
FT                   /locus_tag="RB2501_03875"
FT   CDS_pept        complement(143660..144040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03875"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16003"
FT                   /db_xref="GOA:A4CGE5"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE5"
FT                   /protein_id="EAR16003.1"
FT   gene            complement(144128..144790)
FT                   /locus_tag="RB2501_03880"
FT   CDS_pept        complement(144128..144790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03880"
FT                   /product="putative biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03880"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16004"
FT                   /db_xref="GOA:A4CGE6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE6"
FT                   /protein_id="EAR16004.1"
FT   gene            complement(145372..145459)
FT                   /locus_tag="RB2501_t10168"
FT   tRNA            complement(145372..145459)
FT                   /locus_tag="RB2501_t10168"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            complement(145525..146562)
FT                   /locus_tag="RB2501_03885"
FT   CDS_pept        complement(145525..146562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03885"
FT                   /product="L-asparaginase I"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03885"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16005"
FT                   /db_xref="GOA:A4CGE7"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE7"
FT                   /protein_id="EAR16005.1"
FT                   EMSQN"
FT   gene            complement(146575..147342)
FT                   /locus_tag="RB2501_03890"
FT   CDS_pept        complement(146575..147342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03890"
FT                   /product="putative DNAse related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03890"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16006"
FT                   /db_xref="GOA:A4CGE8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE8"
FT                   /protein_id="EAR16006.1"
FT   gene            147379..147816
FT                   /locus_tag="RB2501_03895"
FT   CDS_pept        147379..147816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03895"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGE9"
FT                   /protein_id="EAR16007.1"
FT   gene            complement(147900..149192)
FT                   /locus_tag="RB2501_03900"
FT   CDS_pept        complement(147900..149192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03900"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03900"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16008"
FT                   /db_xref="GOA:A4CGF0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF0"
FT                   /protein_id="EAR16008.1"
FT   gene            complement(149286..152108)
FT                   /locus_tag="RB2501_03905"
FT   CDS_pept        complement(149286..152108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03905"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03905"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16009"
FT                   /db_xref="GOA:A4CGF1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF1"
FT                   /protein_id="EAR16009.1"
FT                   VPADVATDEE"
FT   gene            complement(152217..153236)
FT                   /locus_tag="RB2501_03910"
FT   CDS_pept        complement(152217..153236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03910"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03910"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16010"
FT                   /db_xref="GOA:A4CGF2"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF2"
FT                   /protein_id="EAR16010.1"
FT   gene            complement(153271..154449)
FT                   /locus_tag="RB2501_03915"
FT   CDS_pept        complement(153271..154449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03915"
FT                   /product="pigmentation and extracellular proteinase
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03915"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16011"
FT                   /db_xref="GOA:A4CGF3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF3"
FT                   /protein_id="EAR16011.1"
FT   gene            154498..155844
FT                   /locus_tag="RB2501_03920"
FT   CDS_pept        154498..155844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03920"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03920"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16012"
FT                   /db_xref="GOA:A4CGF4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF4"
FT                   /protein_id="EAR16012.1"
FT   gene            155857..156087
FT                   /locus_tag="RB2501_03925"
FT   CDS_pept        155857..156087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03925"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16013"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF5"
FT                   /protein_id="EAR16013.1"
FT   gene            156233..157546
FT                   /locus_tag="RB2501_03930"
FT   CDS_pept        156233..157546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03930"
FT                   /product="xylose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03930"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16014"
FT                   /db_xref="GOA:A4CGF6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF6"
FT                   /protein_id="EAR16014.1"
FT   gene            158038..160401
FT                   /locus_tag="RB2501_03935"
FT   CDS_pept        158038..160401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03935"
FT                   /product="chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03935"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16015"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF7"
FT                   /protein_id="EAR16015.1"
FT   gene            160603..160737
FT                   /locus_tag="RB2501_03940"
FT   CDS_pept        160603..160737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03940"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16016"
FT                   /db_xref="GOA:A4CGF8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF8"
FT                   /protein_id="EAR16016.1"
FT   gene            160961..161128
FT                   /locus_tag="RB2501_03945"
FT   CDS_pept        160961..161128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16017"
FT                   /db_xref="GOA:A4CGF9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGF9"
FT                   /protein_id="EAR16017.1"
FT                   YNIISGRKAL"
FT   gene            complement(161205..161286)
FT                   /locus_tag="RB2501_t10166"
FT   tRNA            complement(161205..161286)
FT                   /locus_tag="RB2501_t10166"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUG"
FT   gene            complement(161327..161413)
FT                   /locus_tag="RB2501_03950"
FT   CDS_pept        complement(161327..161413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03950"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16018"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG0"
FT                   /protein_id="EAR16018.1"
FT                   /translation="MKKNTGLPREKKNFFVHIFKKQYICHPI"
FT   gene            161466..162302
FT                   /locus_tag="RB2501_03955"
FT   CDS_pept        161466..162302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03955"
FT                   /product="probable 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomaerase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03955"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16019"
FT                   /db_xref="GOA:A4CGG1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG1"
FT                   /protein_id="EAR16019.1"
FT   gene            complement(162397..163725)
FT                   /locus_tag="RB2501_03960"
FT   CDS_pept        complement(162397..163725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03960"
FT                   /product="putative dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03960"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16020"
FT                   /db_xref="GOA:A4CGG2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG2"
FT                   /protein_id="EAR16020.1"
FT   gene            complement(163732..165096)
FT                   /locus_tag="RB2501_03965"
FT   CDS_pept        complement(163732..165096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03965"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16021"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG3"
FT                   /protein_id="EAR16021.1"
FT   gene            complement(165206..166501)
FT                   /locus_tag="RB2501_03970"
FT   CDS_pept        complement(165206..166501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03970"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16022"
FT                   /db_xref="GOA:A4CGG4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG4"
FT                   /protein_id="EAR16022.1"
FT   gene            complement(166505..166966)
FT                   /locus_tag="RB2501_03975"
FT   CDS_pept        complement(166505..166966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03975"
FT                   /product="Hypothetical TRAP-type C4-dicarboxylate transport
FT                   system, small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16023"
FT                   /db_xref="GOA:A4CGG5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG5"
FT                   /protein_id="EAR16023.1"
FT   gene            complement(166963..167967)
FT                   /locus_tag="RB2501_03980"
FT   CDS_pept        complement(166963..167967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03980"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03980"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16024"
FT                   /db_xref="GOA:A4CGG6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG6"
FT                   /protein_id="EAR16024.1"
FT   gene            complement(167987..169384)
FT                   /locus_tag="RB2501_03985"
FT   CDS_pept        complement(167987..169384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03985"
FT                   /product="uronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16025"
FT                   /db_xref="GOA:A4CGG7"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG7"
FT                   /protein_id="EAR16025.1"
FT                   AKAYFDF"
FT   gene            169654..170826
FT                   /locus_tag="RB2501_03990"
FT   CDS_pept        169654..170826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03990"
FT                   /product="NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16026"
FT                   /db_xref="GOA:A4CGG8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG8"
FT                   /protein_id="EAR16026.1"
FT   gene            170894..171931
FT                   /locus_tag="RB2501_03995"
FT   CDS_pept        170894..171931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_03995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_03995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16027"
FT                   /db_xref="GOA:A4CGG9"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGG9"
FT                   /protein_id="EAR16027.1"
FT                   WDSQM"
FT   gene            172068..172793
FT                   /locus_tag="RB2501_04000"
FT   CDS_pept        172068..172793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16028"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH0"
FT                   /protein_id="EAR16028.1"
FT   gene            172865..173689
FT                   /locus_tag="RB2501_04005"
FT   CDS_pept        172865..173689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04005"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16029"
FT                   /db_xref="GOA:A4CGH1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH1"
FT                   /protein_id="EAR16029.1"
FT   gene            complement(173840..173921)
FT                   /locus_tag="RB2501_t10164"
FT   tRNA            complement(173840..173921)
FT                   /locus_tag="RB2501_t10164"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            complement(174019..175704)
FT                   /locus_tag="RB2501_04010"
FT   CDS_pept        complement(174019..175704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04010"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16030"
FT                   /db_xref="GOA:A4CGH2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH2"
FT                   /protein_id="EAR16030.1"
FT   gene            complement(175718..176095)
FT                   /locus_tag="RB2501_04015"
FT   CDS_pept        complement(175718..176095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04015"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04015"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16031"
FT                   /db_xref="GOA:A4CGH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH3"
FT                   /protein_id="EAR16031.1"
FT   gene            complement(176123..180490)
FT                   /locus_tag="RB2501_04020"
FT   CDS_pept        complement(176123..180490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04020"
FT                   /product="PAS/PAC Sensor Hybrid Histidine Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04020"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16032"
FT                   /db_xref="GOA:A4CGH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH4"
FT                   /protein_id="EAR16032.1"
FT   gene            180628..182019
FT                   /locus_tag="RB2501_04025"
FT   CDS_pept        180628..182019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04025"
FT                   /product="peptidase, M20/M25/M40 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16033"
FT                   /db_xref="GOA:A4CGH5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH5"
FT                   /protein_id="EAR16033.1"
FT                   EMSRG"
FT   gene            182198..182563
FT                   /locus_tag="RB2501_04030"
FT   CDS_pept        182198..182563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04030"
FT                   /product="putative antibiotic resistance-related regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16034"
FT                   /db_xref="GOA:A4CGH6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH6"
FT                   /protein_id="EAR16034.1"
FT                   EQLEELKSLIEEEIKKK"
FT   gene            182566..184116
FT                   /locus_tag="RB2501_04035"
FT   CDS_pept        182566..184116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16035"
FT                   /db_xref="GOA:A4CGH7"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH7"
FT                   /protein_id="EAR16035.1"
FT   gene            184227..185327
FT                   /locus_tag="RB2501_04040"
FT   CDS_pept        184227..185327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16036"
FT                   /db_xref="GOA:A4CGH8"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH8"
FT                   /protein_id="EAR16036.1"
FT   gene            complement(185363..187213)
FT                   /locus_tag="RB2501_04045"
FT   CDS_pept        complement(185363..187213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04045"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16037"
FT                   /db_xref="GOA:A4CGH9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGH9"
FT                   /protein_id="EAR16037.1"
FT   gene            complement(187210..187569)
FT                   /locus_tag="RB2501_04050"
FT   CDS_pept        complement(187210..187569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04050"
FT                   /product="putative MmcQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16038"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI0"
FT                   /protein_id="EAR16038.1"
FT                   ASLPAKSRKEWEALP"
FT   gene            complement(187581..188000)
FT                   /locus_tag="RB2501_04055"
FT   CDS_pept        complement(187581..188000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16039"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI1"
FT                   /protein_id="EAR16039.1"
FT   gene            complement(188017..188661)
FT                   /locus_tag="RB2501_04060"
FT   CDS_pept        complement(188017..188661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04060"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16040"
FT                   /db_xref="GOA:A4CGI2"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI2"
FT                   /protein_id="EAR16040.1"
FT   gene            complement(188654..189022)
FT                   /locus_tag="RB2501_04065"
FT   CDS_pept        complement(188654..189022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16041"
FT                   /db_xref="GOA:A4CGI3"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI3"
FT                   /protein_id="EAR16041.1"
FT                   GFQYTHLGEIGKNAKRHA"
FT   gene            complement(189019..189765)
FT                   /locus_tag="RB2501_04070"
FT   CDS_pept        complement(189019..189765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04070"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16042"
FT                   /db_xref="GOA:A4CGI4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI4"
FT                   /protein_id="EAR16042.1"
FT   gene            complement(189778..190911)
FT                   /locus_tag="RB2501_04075"
FT   CDS_pept        complement(189778..190911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04075"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16043"
FT                   /db_xref="GOA:A4CGI5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI5"
FT                   /protein_id="EAR16043.1"
FT   gene            complement(190993..191559)
FT                   /locus_tag="RB2501_04080"
FT   CDS_pept        complement(190993..191559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04080"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16044"
FT                   /db_xref="GOA:A4CGI6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI6"
FT                   /protein_id="EAR16044.1"
FT   gene            complement(191552..192037)
FT                   /locus_tag="RB2501_04085"
FT   CDS_pept        complement(191552..192037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04085"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16045"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI7"
FT                   /protein_id="EAR16045.1"
FT   gene            192208..192687
FT                   /locus_tag="RB2501_04090"
FT   CDS_pept        192208..192687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04090"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16046"
FT                   /db_xref="GOA:A4CGI8"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI8"
FT                   /protein_id="EAR16046.1"
FT   gene            complement(192766..193317)
FT                   /locus_tag="RB2501_04095"
FT   CDS_pept        complement(192766..193317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04095"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16047"
FT                   /db_xref="GOA:A4CGI9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGI9"
FT                   /protein_id="EAR16047.1"
FT   gene            complement(193371..194252)
FT                   /locus_tag="RB2501_04100"
FT   CDS_pept        complement(193371..194252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04100"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16048"
FT                   /db_xref="GOA:A4CGJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ0"
FT                   /protein_id="EAR16048.1"
FT                   CIEHLRGSSPEP"
FT   gene            194353..195933
FT                   /locus_tag="RB2501_04105"
FT   CDS_pept        194353..195933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04105"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16049"
FT                   /db_xref="GOA:A4CGJ1"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ1"
FT                   /protein_id="EAR16049.1"
FT                   DYDELFETY"
FT   gene            195933..197285
FT                   /locus_tag="RB2501_04110"
FT   CDS_pept        195933..197285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04110"
FT                   /product="imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04110"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16050"
FT                   /db_xref="GOA:A4CGJ2"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ2"
FT                   /protein_id="EAR16050.1"
FT   gene            197335..199362
FT                   /locus_tag="RB2501_04115"
FT   CDS_pept        197335..199362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04115"
FT                   /product="urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16051"
FT                   /db_xref="GOA:A4CGJ3"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ3"
FT                   /protein_id="EAR16051.1"
FT   gene            199376..200344
FT                   /locus_tag="RB2501_04120"
FT   CDS_pept        199376..200344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04120"
FT                   /product="formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16052"
FT                   /db_xref="GOA:A4CGJ4"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ4"
FT                   /protein_id="EAR16052.1"
FT   gene            complement(200353..201510)
FT                   /locus_tag="RB2501_04125"
FT   CDS_pept        complement(200353..201510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04125"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04125"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16053"
FT                   /db_xref="GOA:A4CGJ5"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ5"
FT                   /protein_id="EAR16053.1"
FT   gene            complement(201618..201758)
FT                   /locus_tag="RB2501_04130"
FT   CDS_pept        complement(201618..201758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16054"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ6"
FT                   /protein_id="EAR16054.1"
FT                   G"
FT   gene            complement(201806..203110)
FT                   /locus_tag="RB2501_04135"
FT   CDS_pept        complement(201806..203110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04135"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16055"
FT                   /db_xref="GOA:A4CGJ7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ7"
FT                   /protein_id="EAR16055.1"
FT   gene            complement(203204..203962)
FT                   /locus_tag="RB2501_04140"
FT   CDS_pept        complement(203204..203962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04140"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04140"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16056"
FT                   /db_xref="GOA:A4CGJ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ8"
FT                   /protein_id="EAR16056.1"
FT   gene            204035..206452
FT                   /locus_tag="RB2501_04145"
FT   CDS_pept        204035..206452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04145"
FT                   /product="probable cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04145"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16057"
FT                   /db_xref="GOA:A4CGJ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGJ9"
FT                   /protein_id="EAR16057.1"
FT   gene            206513..206710
FT                   /locus_tag="RB2501_04150"
FT   CDS_pept        206513..206710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04150"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16058"
FT                   /db_xref="GOA:A4CGK0"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK0"
FT                   /protein_id="EAR16058.1"
FT   gene            206720..208921
FT                   /locus_tag="RB2501_04155"
FT   CDS_pept        206720..208921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04155"
FT                   /product="probable cytochrome oxidase subunit (cbb3-type)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04155"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16059"
FT                   /db_xref="GOA:A4CGK1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK1"
FT                   /protein_id="EAR16059.1"
FT   gene            208925..209116
FT                   /locus_tag="RB2501_04160"
FT   CDS_pept        208925..209116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04160"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16060"
FT                   /db_xref="GOA:A4CGK2"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK2"
FT                   /protein_id="EAR16060.1"
FT                   KEMSELPLEDEQPKPTEK"
FT   gene            209113..210090
FT                   /locus_tag="RB2501_04165"
FT   CDS_pept        209113..210090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04165"
FT                   /product="cytochrome-c oxidase fixP chain"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04165"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16061"
FT                   /db_xref="GOA:A4CGK3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK3"
FT                   /protein_id="EAR16061.1"
FT   gene            210135..211550
FT                   /locus_tag="RB2501_04170"
FT   CDS_pept        210135..211550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04170"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04170"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16062"
FT                   /db_xref="GOA:A4CGK4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK4"
FT                   /protein_id="EAR16062.1"
FT                   TTATRFLAPRTYK"
FT   gene            211557..212003
FT                   /locus_tag="RB2501_04175"
FT   CDS_pept        211557..212003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04175"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16063"
FT                   /db_xref="GOA:A4CGK5"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK5"
FT                   /protein_id="EAR16063.1"
FT   gene            212098..212772
FT                   /locus_tag="RB2501_04180"
FT   CDS_pept        212098..212772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04180"
FT                   /product="Heavy-metal-associated domain (N-terminus) and
FT                   membrane-bounded cytochrome biogenesis cycZ-like domain,
FT                   possible"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04180"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16064"
FT                   /db_xref="GOA:A4CGK6"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK6"
FT                   /protein_id="EAR16064.1"
FT                   HP"
FT   gene            212846..214234
FT                   /locus_tag="RB2501_04185"
FT   CDS_pept        212846..214234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04185"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16065"
FT                   /db_xref="GOA:A4CGK7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK7"
FT                   /protein_id="EAR16065.1"
FT                   QIVG"
FT   gene            complement(214264..214977)
FT                   /locus_tag="RB2501_04190"
FT   CDS_pept        complement(214264..214977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04190"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04190"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16066"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK8"
FT                   /protein_id="EAR16066.1"
FT                   DIANHSSIPVLTFRM"
FT   gene            complement(215099..216457)
FT                   /locus_tag="RB2501_04195"
FT   CDS_pept        complement(215099..216457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04195"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04195"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16067"
FT                   /db_xref="GOA:A4CGK9"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGK9"
FT                   /protein_id="EAR16067.1"
FT   gene            complement(216564..217841)
FT                   /locus_tag="RB2501_04200"
FT   CDS_pept        complement(216564..217841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04200"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04200"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16068"
FT                   /db_xref="GOA:A4CGL0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL0"
FT                   /protein_id="EAR16068.1"
FT   gene            218028..218912
FT                   /locus_tag="RB2501_04205"
FT   CDS_pept        218028..218912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04205"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16069"
FT                   /db_xref="GOA:A4CGL1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL1"
FT                   /protein_id="EAR16069.1"
FT                   LSDKGRYPSPLWG"
FT   gene            218985..219995
FT                   /locus_tag="RB2501_04210"
FT   CDS_pept        218985..219995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04210"
FT                   /product="putative desulfatase possibly for mucin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04210"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16070"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL2"
FT                   /protein_id="EAR16070.1"
FT   gene            complement(220108..221286)
FT                   /locus_tag="RB2501_04215"
FT   CDS_pept        complement(220108..221286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04215"
FT                   /product="Acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04215"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16071"
FT                   /db_xref="GOA:A4CGL3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL3"
FT                   /protein_id="EAR16071.1"
FT   gene            complement(221345..222058)
FT                   /locus_tag="RB2501_04220"
FT   CDS_pept        complement(221345..222058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04220"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04220"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16072"
FT                   /db_xref="GOA:A4CGL4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL4"
FT                   /protein_id="EAR16072.1"
FT                   TDDYKNLTRDFYLKM"
FT   gene            complement(222069..223649)
FT                   /locus_tag="RB2501_04225"
FT   CDS_pept        complement(222069..223649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04225"
FT                   /product="arylsulfatase A (precursor)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04225"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16073"
FT                   /db_xref="GOA:A4CGL5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL5"
FT                   /protein_id="EAR16073.1"
FT                   VETGAGQEH"
FT   gene            223740..226523
FT                   /locus_tag="RB2501_04230"
FT   CDS_pept        223740..226523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04230"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16074"
FT                   /db_xref="GOA:A4CGL6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL6"
FT                   /protein_id="EAR16074.1"
FT   gene            226520..227563
FT                   /locus_tag="RB2501_04235"
FT   CDS_pept        226520..227563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04235"
FT                   /product="16S rRNA-processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04235"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16075"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL7"
FT                   /protein_id="EAR16075.1"
FT                   FCREALS"
FT   gene            complement(227602..228129)
FT                   /locus_tag="RB2501_04240"
FT   CDS_pept        complement(227602..228129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04240"
FT                   /product="16S rRNA-processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04240"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16076"
FT                   /db_xref="GOA:A4CGL8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL8"
FT                   /protein_id="EAR16076.1"
FT                   RTPEGLLDLYLT"
FT   gene            complement(228142..228819)
FT                   /locus_tag="RB2501_04245"
FT   CDS_pept        complement(228142..228819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04245"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04245"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16077"
FT                   /db_xref="GOA:A4CGL9"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGL9"
FT                   /protein_id="EAR16077.1"
FT                   DKE"
FT   gene            229190..229645
FT                   /locus_tag="RB2501_04250"
FT   CDS_pept        229190..229645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04250"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16078"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011971"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR016920"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM0"
FT                   /protein_id="EAR16078.1"
FT   gene            229859..234220
FT                   /locus_tag="RB2501_04255"
FT   CDS_pept        229859..234220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04255"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04255"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16079"
FT                   /db_xref="GOA:A4CGM1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM1"
FT                   /protein_id="EAR16079.1"
FT   gene            234501..234716
FT                   /locus_tag="RB2501_04260"
FT   CDS_pept        234501..234716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04260"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04260"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16080"
FT                   /db_xref="GOA:A4CGM2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM2"
FT                   /protein_id="EAR16080.1"
FT   gene            234854..235786
FT                   /locus_tag="RB2501_04265"
FT   CDS_pept        234854..235786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04265"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16081"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM3"
FT                   /protein_id="EAR16081.1"
FT   gene            235919..235992
FT                   /locus_tag="RB2501_t10136"
FT   tRNA            235919..235992
FT                   /locus_tag="RB2501_t10136"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            236228..236992
FT                   /locus_tag="RB2501_04270"
FT   CDS_pept        236228..236992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04270"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16082"
FT                   /db_xref="GOA:A4CGM4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM4"
FT                   /protein_id="EAR16082.1"
FT   gene            237281..238741
FT                   /locus_tag="RB2501_04275"
FT   CDS_pept        237281..238741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04275"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16083"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM5"
FT                   /protein_id="EAR16083.1"
FT   gene            238742..239701
FT                   /locus_tag="RB2501_04280"
FT   CDS_pept        238742..239701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04280"
FT                   /product="DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16084"
FT                   /db_xref="GOA:A4CGM6"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM6"
FT                   /protein_id="EAR16084.1"
FT   gene            complement(239818..240864)
FT                   /locus_tag="RB2501_04285"
FT   CDS_pept        complement(239818..240864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04285"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16085"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM7"
FT                   /protein_id="EAR16085.1"
FT                   RKRKHSRL"
FT   gene            complement(240861..241202)
FT                   /locus_tag="RB2501_04290"
FT   CDS_pept        complement(240861..241202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04290"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16086"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM8"
FT                   /protein_id="EAR16086.1"
FT                   TLKANIVKP"
FT   gene            complement(241342..241632)
FT                   /locus_tag="RB2501_04295"
FT   CDS_pept        complement(241342..241632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04295"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16087"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGM9"
FT                   /protein_id="EAR16087.1"
FT   gene            complement(241629..241799)
FT                   /locus_tag="RB2501_04300"
FT   CDS_pept        complement(241629..241799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04300"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16088"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN0"
FT                   /protein_id="EAR16088.1"
FT                   FNKVNHKITLP"
FT   gene            243217..244950
FT                   /locus_tag="RB2501_04305"
FT   CDS_pept        243217..244950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04305"
FT                   /product="transcriptional regulatory protein; HypF"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04305"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16089"
FT                   /db_xref="GOA:A4CGN1"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN1"
FT                   /protein_id="EAR16089.1"
FT                   E"
FT   gene            244947..246047
FT                   /locus_tag="RB2501_04310"
FT   CDS_pept        244947..246047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04310"
FT                   /product="putative [NiFe] hydrogenase expression/formation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04310"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16090"
FT                   /db_xref="GOA:A4CGN2"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN2"
FT                   /protein_id="EAR16090.1"
FT   gene            246104..247123
FT                   /locus_tag="RB2501_04315"
FT   CDS_pept        246104..247123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04315"
FT                   /product="Hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16091"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN3"
FT                   /protein_id="EAR16091.1"
FT   gene            247180..249297
FT                   /locus_tag="RB2501_04320"
FT   CDS_pept        247180..249297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04320"
FT                   /product="possible tonB-dependent receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04320"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16092"
FT                   /db_xref="GOA:A4CGN4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN4"
FT                   /protein_id="EAR16092.1"
FT                   QLIIKLGVAGK"
FT   gene            249332..249973
FT                   /locus_tag="RB2501_04325"
FT   CDS_pept        249332..249973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04325"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04325"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16093"
FT                   /db_xref="GOA:A4CGN5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN5"
FT                   /protein_id="EAR16093.1"
FT   gene            249990..250247
FT                   /locus_tag="RB2501_04330"
FT   CDS_pept        249990..250247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04330"
FT                   /product="hydrogenase expression/formation protein; HypC"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16094"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN6"
FT                   /protein_id="EAR16094.1"
FT   gene            250263..251033
FT                   /locus_tag="RB2501_04335"
FT   CDS_pept        250263..251033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04335"
FT                   /product="CODH nickel-insertion accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16095"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN7"
FT                   /protein_id="EAR16095.1"
FT   gene            complement(251035..252018)
FT                   /locus_tag="RB2501_04340"
FT   CDS_pept        complement(251035..252018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16096"
FT                   /db_xref="GOA:A4CGN8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN8"
FT                   /protein_id="EAR16096.1"
FT   gene            complement(252088..252606)
FT                   /locus_tag="RB2501_04345"
FT   CDS_pept        complement(252088..252606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04345"
FT                   /product="putative [NiFe] hydrogenase-specific C-terminal
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04345"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16097"
FT                   /db_xref="GOA:A4CGN9"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGN9"
FT                   /protein_id="EAR16097.1"
FT                   SQKKLANFE"
FT   gene            complement(252612..253406)
FT                   /locus_tag="RB2501_04350"
FT   CDS_pept        complement(252612..253406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16098"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP0"
FT                   /protein_id="EAR16098.1"
FT   gene            complement(253423..253716)
FT                   /locus_tag="RB2501_04355"
FT   CDS_pept        complement(253423..253716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04355"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP1"
FT                   /protein_id="EAR16099.1"
FT   gene            complement(253718..254116)
FT                   /locus_tag="RB2501_04360"
FT   CDS_pept        complement(253718..254116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16100"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP2"
FT                   /protein_id="EAR16100.1"
FT   gene            complement(254113..254538)
FT                   /locus_tag="RB2501_04365"
FT   CDS_pept        complement(254113..254538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04365"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16101"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP3"
FT                   /protein_id="EAR16101.1"
FT   gene            complement(254654..256528)
FT                   /locus_tag="RB2501_04370"
FT   CDS_pept        complement(254654..256528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04370"
FT                   /product="putative cytochrome C3-like [NiFe] hydrogenase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04370"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16102"
FT                   /db_xref="GOA:A4CGP4"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP4"
FT                   /protein_id="EAR16102.1"
FT   gene            complement(256559..256834)
FT                   /locus_tag="RB2501_04375"
FT   CDS_pept        complement(256559..256834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04375"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16103"
FT                   /db_xref="GOA:A4CGP5"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP5"
FT                   /protein_id="EAR16103.1"
FT   gene            complement(256841..257005)
FT                   /locus_tag="RB2501_04380"
FT   CDS_pept        complement(256841..257005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16104"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP6"
FT                   /protein_id="EAR16104.1"
FT                   LATRAEKIN"
FT   gene            complement(257133..257423)
FT                   /locus_tag="RB2501_04385"
FT   CDS_pept        complement(257133..257423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04385"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16105"
FT                   /db_xref="GOA:A4CGP7"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP7"
FT                   /protein_id="EAR16105.1"
FT   gene            complement(257420..257746)
FT                   /locus_tag="RB2501_04390"
FT   CDS_pept        complement(257420..257746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04390"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16106"
FT                   /db_xref="GOA:A4CGP8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP8"
FT                   /protein_id="EAR16106.1"
FT                   NSSL"
FT   gene            complement(257766..258047)
FT                   /locus_tag="RB2501_04395"
FT   CDS_pept        complement(257766..258047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04395"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16107"
FT                   /db_xref="GOA:A4CGP9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGP9"
FT                   /protein_id="EAR16107.1"
FT   gene            complement(258050..258214)
FT                   /locus_tag="RB2501_04400"
FT   CDS_pept        complement(258050..258214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04400"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16108"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ0"
FT                   /protein_id="EAR16108.1"
FT                   DSPKPGSNK"
FT   gene            259397..259480
FT                   /locus_tag="RB2501_04405"
FT   CDS_pept        259397..259480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04405"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16109"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ1"
FT                   /protein_id="EAR16109.1"
FT                   /translation="MGFINGNFFETKFLDEKRIIFTKKHYF"
FT   gene            259503..260615
FT                   /locus_tag="RB2501_04410"
FT   CDS_pept        259503..260615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16110"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ2"
FT                   /protein_id="EAR16110.1"
FT   gene            complement(260677..261396)
FT                   /locus_tag="RB2501_04415"
FT   CDS_pept        complement(260677..261396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04415"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16111"
FT                   /db_xref="GOA:A4CGQ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ3"
FT                   /protein_id="EAR16111.1"
FT                   ISNYEAAQKLKEAWGLD"
FT   gene            261439..261657
FT                   /locus_tag="RB2501_04420"
FT   CDS_pept        261439..261657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16112"
FT                   /db_xref="GOA:A4CGQ4"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ4"
FT                   /protein_id="EAR16112.1"
FT   gene            262044..262235
FT                   /locus_tag="RB2501_04425"
FT   CDS_pept        262044..262235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16113"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ5"
FT                   /protein_id="EAR16113.1"
FT                   RKDFALQQAHPLGRFRMK"
FT   gene            complement(262517..263410)
FT                   /locus_tag="RB2501_04430"
FT   CDS_pept        complement(262517..263410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04430"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04430"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16114"
FT                   /db_xref="GOA:A4CGQ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ6"
FT                   /protein_id="EAR16114.1"
FT                   GYFAAIEEFLGMLRDR"
FT   gene            263591..265624
FT                   /locus_tag="RB2501_04435"
FT   CDS_pept        263591..265624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04435"
FT                   /product="dipeptidyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16115"
FT                   /db_xref="GOA:A4CGQ7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ7"
FT                   /protein_id="EAR16115.1"
FT   gene            265815..266540
FT                   /locus_tag="RB2501_04440"
FT   CDS_pept        265815..266540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16116"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ8"
FT                   /protein_id="EAR16116.1"
FT   gene            266732..267316
FT                   /locus_tag="RB2501_04445"
FT   CDS_pept        266732..267316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04445"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16117"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGQ9"
FT                   /protein_id="EAR16117.1"
FT   gene            267323..268669
FT                   /locus_tag="RB2501_04450"
FT   CDS_pept        267323..268669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16118"
FT                   /db_xref="GOA:A4CGR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR0"
FT                   /protein_id="EAR16118.1"
FT   gene            268672..269082
FT                   /locus_tag="RB2501_04455"
FT   CDS_pept        268672..269082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16119"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR1"
FT                   /protein_id="EAR16119.1"
FT   gene            269147..269524
FT                   /locus_tag="RB2501_04460"
FT   CDS_pept        269147..269524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16120"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR2"
FT                   /protein_id="EAR16120.1"
FT   gene            complement(269527..270093)
FT                   /locus_tag="RB2501_04465"
FT   CDS_pept        complement(269527..270093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04465"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16121"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR3"
FT                   /protein_id="EAR16121.1"
FT   gene            complement(270312..270623)
FT                   /locus_tag="RB2501_04470"
FT   CDS_pept        complement(270312..270623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04470"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16122"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR4"
FT                   /protein_id="EAR16122.1"
FT   gene            270786..271187
FT                   /locus_tag="RB2501_04475"
FT   CDS_pept        270786..271187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04475"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16123"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR5"
FT                   /protein_id="EAR16123.1"
FT   gene            complement(271197..271514)
FT                   /locus_tag="RB2501_04480"
FT   CDS_pept        complement(271197..271514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16124"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR6"
FT                   /protein_id="EAR16124.1"
FT                   D"
FT   gene            complement(271576..271887)
FT                   /locus_tag="RB2501_04485"
FT   CDS_pept        complement(271576..271887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16125"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR7"
FT                   /protein_id="EAR16125.1"
FT   gene            271995..273995
FT                   /locus_tag="RB2501_04490"
FT   CDS_pept        271995..273995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04490"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16126"
FT                   /db_xref="GOA:A4CGR8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR8"
FT                   /protein_id="EAR16126.1"
FT   gene            274019..276307
FT                   /locus_tag="RB2501_04495"
FT   CDS_pept        274019..276307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04495"
FT                   /product="Peptidase C14, caspase catalytic subunit p20"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16127"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGR9"
FT                   /protein_id="EAR16127.1"
FT                   RFLKAHYLS"
FT   gene            276321..276545
FT                   /locus_tag="RB2501_04500"
FT   CDS_pept        276321..276545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04500"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16128"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS0"
FT                   /protein_id="EAR16128.1"
FT   gene            complement(276575..279031)
FT                   /locus_tag="RB2501_04505"
FT   CDS_pept        complement(276575..279031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04505"
FT                   /product="Peptidase C14, caspase catalytic subunit p20"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04505"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16129"
FT                   /db_xref="GOA:A4CGS1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS1"
FT                   /protein_id="EAR16129.1"
FT                   FLKVAY"
FT   gene            complement(279031..280575)
FT                   /locus_tag="RB2501_04510"
FT   CDS_pept        complement(279031..280575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04510"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16130"
FT                   /db_xref="GOA:A4CGS2"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS2"
FT                   /protein_id="EAR16130.1"
FT   gene            complement(280641..281090)
FT                   /locus_tag="RB2501_04515"
FT   CDS_pept        complement(280641..281090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16131"
FT                   /db_xref="GOA:A4CGS3"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS3"
FT                   /protein_id="EAR16131.1"
FT   gene            complement(281133..282290)
FT                   /locus_tag="RB2501_04520"
FT   CDS_pept        complement(281133..282290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04520"
FT                   /product="mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16132"
FT                   /db_xref="GOA:A4CGS4"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS4"
FT                   /protein_id="EAR16132.1"
FT   gene            complement(282391..283131)
FT                   /locus_tag="RB2501_04525"
FT   CDS_pept        complement(282391..283131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04525"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16133"
FT                   /db_xref="GOA:A4CGS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS5"
FT                   /protein_id="EAR16133.1"
FT   gene            complement(283168..285468)
FT                   /locus_tag="RB2501_04530"
FT   CDS_pept        complement(283168..285468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04530"
FT                   /product="alpha-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16134"
FT                   /db_xref="GOA:A4CGS6"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS6"
FT                   /protein_id="EAR16134.1"
FT                   KFPYAPGIRPQWD"
FT   gene            285687..287180
FT                   /locus_tag="RB2501_04535"
FT   CDS_pept        285687..287180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04535"
FT                   /product="putative xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04535"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16135"
FT                   /db_xref="GOA:A4CGS7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS7"
FT                   /protein_id="EAR16135.1"
FT   gene            287177..288502
FT                   /locus_tag="RB2501_04540"
FT   CDS_pept        287177..288502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04540"
FT                   /product="xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16136"
FT                   /db_xref="GOA:A4CGS8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS8"
FT                   /protein_id="EAR16136.1"
FT   gene            complement(288557..289672)
FT                   /locus_tag="RB2501_04545"
FT   CDS_pept        complement(288557..289672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04545"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16137"
FT                   /db_xref="GOA:A4CGS9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGS9"
FT                   /protein_id="EAR16137.1"
FT   gene            complement(289696..290886)
FT                   /locus_tag="RB2501_04550"
FT   CDS_pept        complement(289696..290886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04550"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04550"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16138"
FT                   /db_xref="GOA:A4CGT0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT0"
FT                   /protein_id="EAR16138.1"
FT   gene            complement(291074..294160)
FT                   /locus_tag="RB2501_04555"
FT   CDS_pept        complement(291074..294160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04555"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16139"
FT                   /db_xref="GOA:A4CGT1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT1"
FT                   /protein_id="EAR16139.1"
FT   gene            complement(294237..295451)
FT                   /locus_tag="RB2501_04560"
FT   CDS_pept        complement(294237..295451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04560"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04560"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16140"
FT                   /db_xref="GOA:A4CGT2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT2"
FT                   /protein_id="EAR16140.1"
FT                   AHRKQ"
FT   gene            complement(295695..296024)
FT                   /locus_tag="RB2501_04565"
FT   CDS_pept        complement(295695..296024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04565"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04565"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16141"
FT                   /db_xref="GOA:A4CGT3"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT3"
FT                   /protein_id="EAR16141.1"
FT                   TLSRK"
FT   gene            complement(296172..296528)
FT                   /locus_tag="RB2501_04570"
FT   CDS_pept        complement(296172..296528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04570"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16142"
FT                   /db_xref="GOA:A4CGT4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT4"
FT                   /protein_id="EAR16142.1"
FT                   AFDEMERQGYGENR"
FT   gene            complement(296525..297235)
FT                   /locus_tag="RB2501_04575"
FT   CDS_pept        complement(296525..297235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04575"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04575"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16143"
FT                   /db_xref="GOA:A4CGT5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT5"
FT                   /protein_id="EAR16143.1"
FT                   EGVLTWMRNESRAL"
FT   gene            297331..298005
FT                   /locus_tag="RB2501_04580"
FT   CDS_pept        297331..298005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04580"
FT                   /product="putative flavodoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16144"
FT                   /db_xref="GOA:A4CGT6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT6"
FT                   /protein_id="EAR16144.1"
FT                   GY"
FT   gene            298163..298693
FT                   /locus_tag="RB2501_04585"
FT   CDS_pept        298163..298693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04585"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16145"
FT                   /db_xref="GOA:A4CGT7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT7"
FT                   /protein_id="EAR16145.1"
FT                   AEFMASLKMQGSL"
FT   gene            298744..299268
FT                   /locus_tag="RB2501_04590"
FT   CDS_pept        298744..299268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04590"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16146"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT8"
FT                   /protein_id="EAR16146.1"
FT                   HAEMVQKKLGK"
FT   gene            299268..299609
FT                   /locus_tag="RB2501_04595"
FT   CDS_pept        299268..299609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16147"
FT                   /db_xref="GOA:A4CGT9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGT9"
FT                   /protein_id="EAR16147.1"
FT                   VMKGTIVVE"
FT   gene            299683..301035
FT                   /locus_tag="RB2501_04600"
FT   CDS_pept        299683..301035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04600"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16148"
FT                   /db_xref="GOA:A4CGU0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU0"
FT                   /protein_id="EAR16148.1"
FT   gene            301243..302040
FT                   /locus_tag="RB2501_04605"
FT   CDS_pept        301243..302040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04605"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16149"
FT                   /db_xref="GOA:A4CGU1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU1"
FT                   /protein_id="EAR16149.1"
FT   gene            302037..305207
FT                   /locus_tag="RB2501_04610"
FT   CDS_pept        302037..305207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04610"
FT                   /product="Cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16150"
FT                   /db_xref="GOA:A4CGU2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU2"
FT                   /protein_id="EAR16150.1"
FT                   VKAHRHHV"
FT   gene            complement(305251..306054)
FT                   /locus_tag="RB2501_04615"
FT   CDS_pept        complement(305251..306054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04615"
FT                   /product="putative flavodoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04615"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16151"
FT                   /db_xref="GOA:A4CGU3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU3"
FT                   /protein_id="EAR16151.1"
FT   gene            306476..307324
FT                   /locus_tag="RB2501_04620"
FT   CDS_pept        306476..307324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04620"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16152"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU4"
FT                   /protein_id="EAR16152.1"
FT                   L"
FT   gene            307520..307705
FT                   /locus_tag="RB2501_04625"
FT   CDS_pept        307520..307705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04625"
FT                   /product="CsbD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16153"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU5"
FT                   /protein_id="EAR16153.1"
FT                   KTGKRKEEIRKEIESW"
FT   gene            308137..309198
FT                   /locus_tag="RB2501_04630"
FT   CDS_pept        308137..309198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04630"
FT                   /product="putative bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16154"
FT                   /db_xref="GOA:A4CGU6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="InterPro:IPR035386"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU6"
FT                   /protein_id="EAR16154.1"
FT                   DEAIDKLPVLQID"
FT   gene            complement(309577..309774)
FT                   /locus_tag="RB2501_04635"
FT   CDS_pept        complement(309577..309774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04635"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16155"
FT                   /db_xref="GOA:A4CGU7"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU7"
FT                   /protein_id="EAR16155.1"
FT   gene            complement(310239..312050)
FT                   /locus_tag="RB2501_04640"
FT   CDS_pept        complement(310239..312050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04640"
FT                   /product="putative metal transport-related, exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04640"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16156"
FT                   /db_xref="GOA:A4CGU8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU8"
FT                   /protein_id="EAR16156.1"
FT   gene            complement(312079..312480)
FT                   /locus_tag="RB2501_04645"
FT   CDS_pept        complement(312079..312480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04645"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16157"
FT                   /db_xref="GOA:A4CGU9"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGU9"
FT                   /protein_id="EAR16157.1"
FT   gene            complement(312592..313299)
FT                   /locus_tag="RB2501_04650"
FT   CDS_pept        complement(312592..313299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16158"
FT                   /db_xref="GOA:A4CGV0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV0"
FT                   /protein_id="EAR16158.1"
FT                   SSLSIRKLKKKFK"
FT   gene            complement(313301..313708)
FT                   /locus_tag="RB2501_04655"
FT   CDS_pept        complement(313301..313708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04655"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16159"
FT                   /db_xref="InterPro:IPR021314"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV1"
FT                   /protein_id="EAR16159.1"
FT   gene            complement(313735..314487)
FT                   /locus_tag="RB2501_04660"
FT   CDS_pept        complement(313735..314487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04660"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16160"
FT                   /db_xref="GOA:A4CGV2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV2"
FT                   /protein_id="EAR16160.1"
FT   gene            complement(314490..315656)
FT                   /locus_tag="RB2501_04665"
FT   CDS_pept        complement(314490..315656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04665"
FT                   /product="Uncharacterized conserved membrane protein,
FT                   probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16161"
FT                   /db_xref="GOA:A4CGV3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV3"
FT                   /protein_id="EAR16161.1"
FT   gene            complement(315730..316200)
FT                   /locus_tag="RB2501_04670"
FT   CDS_pept        complement(315730..316200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16162"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV4"
FT                   /protein_id="EAR16162.1"
FT   gene            complement(316205..316762)
FT                   /locus_tag="RB2501_04675"
FT   CDS_pept        complement(316205..316762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04675"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16163"
FT                   /db_xref="GOA:A4CGV5"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV5"
FT                   /protein_id="EAR16163.1"
FT   gene            complement(316759..318264)
FT                   /locus_tag="RB2501_04680"
FT   CDS_pept        complement(316759..318264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04680"
FT                   /product="glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04680"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16164"
FT                   /db_xref="GOA:A4CGV6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV6"
FT                   /protein_id="EAR16164.1"
FT   gene            complement(318818..319348)
FT                   /locus_tag="RB2501_04685"
FT   CDS_pept        complement(318818..319348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04685"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16165"
FT                   /db_xref="GOA:A4CGV7"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV7"
FT                   /protein_id="EAR16165.1"
FT                   IFLICKKFIKEKV"
FT   gene            complement(319492..320010)
FT                   /locus_tag="RB2501_04690"
FT   CDS_pept        complement(319492..320010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16166"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV8"
FT                   /protein_id="EAR16166.1"
FT                   CGKVAEVIE"
FT   gene            complement(320035..320487)
FT                   /locus_tag="RB2501_04695"
FT   CDS_pept        complement(320035..320487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04695"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16167"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGV9"
FT                   /protein_id="EAR16167.1"
FT   gene            complement(320488..321117)
FT                   /locus_tag="RB2501_04700"
FT   CDS_pept        complement(320488..321117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04700"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16168"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW0"
FT                   /protein_id="EAR16168.1"
FT   gene            complement(321138..321605)
FT                   /locus_tag="RB2501_04705"
FT   CDS_pept        complement(321138..321605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04705"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16169"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW1"
FT                   /protein_id="EAR16169.1"
FT   gene            complement(321616..322002)
FT                   /locus_tag="RB2501_04710"
FT   CDS_pept        complement(321616..322002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04710"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16170"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW2"
FT                   /protein_id="EAR16170.1"
FT   gene            complement(322007..322198)
FT                   /locus_tag="RB2501_04715"
FT   CDS_pept        complement(322007..322198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16171"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW3"
FT                   /protein_id="EAR16171.1"
FT                   EMSKEEYEEQKRTINSKN"
FT   gene            complement(322256..322729)
FT                   /locus_tag="RB2501_04720"
FT   CDS_pept        complement(322256..322729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16172"
FT                   /db_xref="GOA:A4CGW4"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR036353"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW4"
FT                   /protein_id="EAR16172.1"
FT   gene            complement(322874..324166)
FT                   /locus_tag="RB2501_04725"
FT   CDS_pept        complement(322874..324166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04725"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16173"
FT                   /db_xref="GOA:A4CGW5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW5"
FT                   /protein_id="EAR16173.1"
FT   gene            complement(324170..326506)
FT                   /locus_tag="RB2501_04730"
FT   CDS_pept        complement(324170..326506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04730"
FT                   /product="Copper resistance protein CopA"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04730"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16174"
FT                   /db_xref="GOA:A4CGW6"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW6"
FT                   /protein_id="EAR16174.1"
FT   gene            complement(326585..327802)
FT                   /locus_tag="RB2501_04735"
FT   CDS_pept        complement(326585..327802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04735"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04735"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16175"
FT                   /db_xref="GOA:A4CGW7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW7"
FT                   /protein_id="EAR16175.1"
FT                   INYLKS"
FT   gene            complement(327799..331566)
FT                   /locus_tag="RB2501_04740"
FT   CDS_pept        complement(327799..331566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04740"
FT                   /product="putative copper/silver resistance-related
FT                   transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16176"
FT                   /db_xref="GOA:A4CGW8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW8"
FT                   /protein_id="EAR16176.1"
FT   gene            complement(331676..332056)
FT                   /locus_tag="RB2501_04745"
FT   CDS_pept        complement(331676..332056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04745"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16177"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGW9"
FT                   /protein_id="EAR16177.1"
FT   gene            333401..333955
FT                   /locus_tag="RB2501_04750"
FT   CDS_pept        333401..333955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04750"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04750"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16178"
FT                   /db_xref="GOA:A4CGX0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX0"
FT                   /protein_id="EAR16178.1"
FT   gene            334032..334439
FT                   /locus_tag="RB2501_04755"
FT   CDS_pept        334032..334439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04755"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16179"
FT                   /db_xref="GOA:A4CGX1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX1"
FT                   /protein_id="EAR16179.1"
FT   gene            334436..335596
FT                   /locus_tag="RB2501_04760"
FT   CDS_pept        334436..335596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04760"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16180"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX2"
FT                   /protein_id="EAR16180.1"
FT   gene            335619..335939
FT                   /locus_tag="RB2501_04765"
FT   CDS_pept        335619..335939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04765"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX3"
FT                   /protein_id="EAR16181.1"
FT                   AN"
FT   gene            336075..336533
FT                   /locus_tag="RB2501_04770"
FT   CDS_pept        336075..336533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16182"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX4"
FT                   /protein_id="EAR16182.1"
FT   gene            336577..336801
FT                   /locus_tag="RB2501_04775"
FT   CDS_pept        336577..336801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04775"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16183"
FT                   /db_xref="GOA:A4CGX5"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX5"
FT                   /protein_id="EAR16183.1"
FT   gene            336815..337030
FT                   /locus_tag="RB2501_04780"
FT   CDS_pept        336815..337030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16184"
FT                   /db_xref="GOA:A4CGX6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX6"
FT                   /protein_id="EAR16184.1"
FT   gene            337091..337279
FT                   /locus_tag="RB2501_04785"
FT   CDS_pept        337091..337279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04785"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16185"
FT                   /db_xref="GOA:A4CGX7"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX7"
FT                   /protein_id="EAR16185.1"
FT                   ISKEEYEESKKVLESDK"
FT   gene            337295..337576
FT                   /locus_tag="RB2501_04790"
FT   CDS_pept        337295..337576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04790"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16186"
FT                   /db_xref="GOA:A4CGX8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGX8"
FT                   /protein_id="EAR16186.1"
FT   gene            337573..338586
FT                   /pseudo
FT                   /locus_tag="RB2501_04795"
FT                   /note="glyceraldehyde 3-phosphate dehydrogenase pseudogene"
FT   gene            338595..339653
FT                   /locus_tag="RB2501_04805"
FT   CDS_pept        338595..339653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04805"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04805"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16189"
FT                   /db_xref="GOA:A4CGY1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY1"
FT                   /protein_id="EAR16189.1"
FT                   QGVYLEKKVTIA"
FT   gene            339667..341031
FT                   /locus_tag="RB2501_04810"
FT   CDS_pept        339667..341031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04810"
FT                   /product="proton/sodium-glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04810"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16190"
FT                   /db_xref="GOA:A4CGY2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY2"
FT                   /protein_id="EAR16190.1"
FT   gene            341147..341479
FT                   /locus_tag="RB2501_04815"
FT   CDS_pept        341147..341479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04815"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04815"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16191"
FT                   /db_xref="GOA:A4CGY3"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY3"
FT                   /protein_id="EAR16191.1"
FT                   MKRQKP"
FT   gene            341755..342516
FT                   /locus_tag="RB2501_04820"
FT   CDS_pept        341755..342516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04820"
FT                   /product="stress response protein/ ferredoxin I 3"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04820"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16192"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY4"
FT                   /protein_id="EAR16192.1"
FT   gene            342519..343370
FT                   /locus_tag="RB2501_04825"
FT   CDS_pept        342519..343370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04825"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16193"
FT                   /db_xref="GOA:A4CGY5"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY5"
FT                   /protein_id="EAR16193.1"
FT                   NT"
FT   gene            343374..344750
FT                   /locus_tag="RB2501_04830"
FT   CDS_pept        343374..344750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04830"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16194"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY6"
FT                   /protein_id="EAR16194.1"
FT                   "
FT   gene            344780..346282
FT                   /locus_tag="RB2501_04835"
FT   CDS_pept        344780..346282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04835"
FT                   /product="putative thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04835"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16195"
FT                   /db_xref="GOA:A4CGY7"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR028579"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY7"
FT                   /protein_id="EAR16195.1"
FT   gene            346292..347185
FT                   /locus_tag="RB2501_04840"
FT   CDS_pept        346292..347185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04840"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04840"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16196"
FT                   /db_xref="GOA:A4CGY8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY8"
FT                   /protein_id="EAR16196.1"
FT                   LSDVIAQEVTELMYHT"
FT   gene            347248..347832
FT                   /locus_tag="RB2501_04845"
FT   CDS_pept        347248..347832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04845"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16197"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGY9"
FT                   /protein_id="EAR16197.1"
FT   gene            347844..348137
FT                   /locus_tag="RB2501_04850"
FT   CDS_pept        347844..348137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16198"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ0"
FT                   /protein_id="EAR16198.1"
FT   gene            348154..350310
FT                   /locus_tag="RB2501_04855"
FT   CDS_pept        348154..350310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04855"
FT                   /product="copper-transporting ATPase, P-type (copB)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04855"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16199"
FT                   /db_xref="GOA:A4CGZ1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ1"
FT                   /protein_id="EAR16199.1"
FT   gene            350311..351525
FT                   /locus_tag="RB2501_04860"
FT   CDS_pept        350311..351525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04860"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16200"
FT                   /db_xref="GOA:A4CGZ2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ2"
FT                   /protein_id="EAR16200.1"
FT                   LQTKN"
FT   gene            complement(351812..352633)
FT                   /locus_tag="RB2501_04865"
FT   CDS_pept        complement(351812..352633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04865"
FT                   /product="NHL repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04865"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16201"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ3"
FT                   /protein_id="EAR16201.1"
FT   gene            complement(352971..353456)
FT                   /locus_tag="RB2501_04870"
FT   CDS_pept        complement(352971..353456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04870"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16202"
FT                   /db_xref="GOA:A4CGZ4"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ4"
FT                   /protein_id="EAR16202.1"
FT   gene            complement(353484..354341)
FT                   /locus_tag="RB2501_04875"
FT   CDS_pept        complement(353484..354341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04875"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16203"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ5"
FT                   /protein_id="EAR16203.1"
FT                   SYWL"
FT   gene            complement(354439..354708)
FT                   /locus_tag="RB2501_04880"
FT   CDS_pept        complement(354439..354708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04880"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04880"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16204"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ6"
FT                   /protein_id="EAR16204.1"
FT   gene            complement(354861..355223)
FT                   /locus_tag="RB2501_04885"
FT   CDS_pept        complement(354861..355223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04885"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16205"
FT                   /db_xref="GOA:A4CGZ7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ7"
FT                   /protein_id="EAR16205.1"
FT                   KEIAALKSKLEDSNKE"
FT   gene            complement(355509..356855)
FT                   /locus_tag="RB2501_04890"
FT   CDS_pept        complement(355509..356855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04890"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04890"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16206"
FT                   /db_xref="GOA:A4CGZ8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ8"
FT                   /protein_id="EAR16206.1"
FT   gene            complement(356856..357386)
FT                   /locus_tag="RB2501_04895"
FT   CDS_pept        complement(356856..357386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04895"
FT                   /product="probable copper-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04895"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16207"
FT                   /db_xref="GOA:A4CGZ9"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4CGZ9"
FT                   /protein_id="EAR16207.1"
FT                   GYKVVEKTTKENK"
FT   gene            complement(357489..357860)
FT                   /locus_tag="RB2501_04900"
FT   CDS_pept        complement(357489..357860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04900"
FT                   /product="transcriptional regulator, ArsR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04900"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16208"
FT                   /db_xref="GOA:A4CH00"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH00"
FT                   /protein_id="EAR16208.1"
FT   gene            complement(357958..359922)
FT                   /locus_tag="RB2501_04905"
FT   CDS_pept        complement(357958..359922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04905"
FT                   /product="cation-transporting ATPase, P-type, putative
FT                   zinc-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04905"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16209"
FT                   /db_xref="GOA:A4CH01"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH01"
FT                   /protein_id="EAR16209.1"
FT   gene            complement(360033..360449)
FT                   /locus_tag="RB2501_04910"
FT   CDS_pept        complement(360033..360449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04910"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16210"
FT                   /db_xref="GOA:A4CH02"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH02"
FT                   /protein_id="EAR16210.1"
FT   gene            complement(360446..361084)
FT                   /locus_tag="RB2501_04915"
FT   CDS_pept        complement(360446..361084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04915"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04915"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16211"
FT                   /db_xref="GOA:A4CH03"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR026765"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH03"
FT                   /protein_id="EAR16211.1"
FT   gene            complement(361089..362291)
FT                   /locus_tag="RB2501_04920"
FT   CDS_pept        complement(361089..362291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04920"
FT                   /product="cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04920"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16212"
FT                   /db_xref="GOA:A4CH04"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH04"
FT                   /protein_id="EAR16212.1"
FT                   H"
FT   gene            complement(362293..366630)
FT                   /locus_tag="RB2501_04925"
FT   CDS_pept        complement(362293..366630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04925"
FT                   /product="putative transport-related, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04925"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16213"
FT                   /db_xref="GOA:A4CH05"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH05"
FT                   /protein_id="EAR16213.1"
FT   gene            366805..366942
FT                   /locus_tag="RB2501_04930"
FT   CDS_pept        366805..366942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04930"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16214"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH06"
FT                   /protein_id="EAR16214.1"
FT                   "
FT   gene            complement(367231..367557)
FT                   /locus_tag="RB2501_04935"
FT   CDS_pept        complement(367231..367557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04935"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16215"
FT                   /db_xref="GOA:A4CH07"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH07"
FT                   /protein_id="EAR16215.1"
FT                   LLKT"
FT   gene            complement(367563..368432)
FT                   /locus_tag="RB2501_04940"
FT   CDS_pept        complement(367563..368432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04940"
FT                   /product="mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04940"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16216"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH08"
FT                   /protein_id="EAR16216.1"
FT                   VRSASIEL"
FT   gene            complement(368429..368725)
FT                   /locus_tag="RB2501_04945"
FT   CDS_pept        complement(368429..368725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16217"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH09"
FT                   /protein_id="EAR16217.1"
FT   gene            complement(368846..369127)
FT                   /locus_tag="RB2501_04950"
FT   CDS_pept        complement(368846..369127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04950"
FT                   /product="putative excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04950"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16218"
FT                   /db_xref="GOA:A4CH10"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH10"
FT                   /protein_id="EAR16218.1"
FT   gene            369155..369520
FT                   /locus_tag="RB2501_04955"
FT   CDS_pept        369155..369520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04955"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04955"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16219"
FT                   /db_xref="GOA:A4CH11"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH11"
FT                   /protein_id="EAR16219.1"
FT                   INEMKSVNTICFEKQRI"
FT   gene            complement(369609..369690)
FT                   /locus_tag="RB2501_t10162"
FT   tRNA            complement(369609..369690)
FT                   /locus_tag="RB2501_t10162"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   gene            369835..370776
FT                   /locus_tag="RB2501_04960"
FT   CDS_pept        369835..370776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04960"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04960"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16220"
FT                   /db_xref="GOA:A4CH12"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH12"
FT                   /protein_id="EAR16220.1"
FT   gene            370951..371463
FT                   /locus_tag="RB2501_04965"
FT   CDS_pept        370951..371463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04965"
FT                   /product="putative 50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04965"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16221"
FT                   /db_xref="GOA:A4CH13"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH13"
FT                   /protein_id="EAR16221.1"
FT                   PAAEAQE"
FT   gene            371635..372201
FT                   /locus_tag="RB2501_04970"
FT   CDS_pept        371635..372201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04970"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04970"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16222"
FT                   /db_xref="GOA:A4CH14"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH14"
FT                   /protein_id="EAR16222.1"
FT   gene            complement(372235..372900)
FT                   /locus_tag="RB2501_04975"
FT   CDS_pept        complement(372235..372900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16223"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH15"
FT                   /protein_id="EAR16223.1"
FT   gene            complement(372915..376622)
FT                   /locus_tag="RB2501_04980"
FT   CDS_pept        complement(372915..376622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04980"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16224"
FT                   /db_xref="GOA:A4CH16"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH16"
FT                   /protein_id="EAR16224.1"
FT                   QEALLKVFRR"
FT   gene            376890..377684
FT                   /locus_tag="RB2501_04985"
FT   CDS_pept        376890..377684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04985"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16225"
FT                   /db_xref="GOA:A4CH17"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH17"
FT                   /protein_id="EAR16225.1"
FT   gene            377681..379006
FT                   /locus_tag="RB2501_04990"
FT   CDS_pept        377681..379006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04990"
FT                   /product="gamma-glutamyl carboxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16226"
FT                   /db_xref="GOA:A4CH18"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH18"
FT                   /protein_id="EAR16226.1"
FT   gene            379094..380365
FT                   /locus_tag="RB2501_04995"
FT   CDS_pept        379094..380365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_04995"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_04995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16227"
FT                   /db_xref="GOA:A4CH19"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH19"
FT                   /protein_id="EAR16227.1"
FT   gene            380465..382249
FT                   /locus_tag="RB2501_05000"
FT   CDS_pept        380465..382249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05000"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16228"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH20"
FT                   /protein_id="EAR16228.1"
FT                   HFPEARKQFRRLRGDPVN"
FT   gene            382275..382589
FT                   /locus_tag="RB2501_05005"
FT   CDS_pept        382275..382589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16229"
FT                   /db_xref="InterPro:IPR025563"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH21"
FT                   /protein_id="EAR16229.1"
FT                   "
FT   gene            382611..383576
FT                   /locus_tag="RB2501_05010"
FT   CDS_pept        382611..383576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05010"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16230"
FT                   /db_xref="GOA:A4CH22"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH22"
FT                   /protein_id="EAR16230.1"
FT   gene            383563..384915
FT                   /locus_tag="RB2501_05015"
FT   CDS_pept        383563..384915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05015"
FT                   /product="putative transmembrane Mg2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05015"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16231"
FT                   /db_xref="GOA:A4CH23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH23"
FT                   /protein_id="EAR16231.1"
FT   gene            384993..385940
FT                   /locus_tag="RB2501_05020"
FT   CDS_pept        384993..385940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05020"
FT                   /product="putative D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05020"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16232"
FT                   /db_xref="GOA:A4CH24"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH24"
FT                   /protein_id="EAR16232.1"
FT   gene            385988..386407
FT                   /locus_tag="RB2501_05025"
FT   CDS_pept        385988..386407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05025"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16233"
FT                   /db_xref="GOA:A4CH25"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH25"
FT                   /protein_id="EAR16233.1"
FT   gene            386508..387032
FT                   /locus_tag="RB2501_05030"
FT   CDS_pept        386508..387032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16234"
FT                   /db_xref="GOA:A4CH26"
FT                   /db_xref="InterPro:IPR025250"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH26"
FT                   /protein_id="EAR16234.1"
FT                   ILKRKPSTATS"
FT   gene            387092..387547
FT                   /locus_tag="RB2501_05035"
FT   CDS_pept        387092..387547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16235"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH27"
FT                   /protein_id="EAR16235.1"
FT   gene            387560..387949
FT                   /locus_tag="RB2501_05040"
FT   CDS_pept        387560..387949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05040"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16236"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH28"
FT                   /protein_id="EAR16236.1"
FT   gene            387996..388397
FT                   /locus_tag="RB2501_05045"
FT   CDS_pept        387996..388397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16237"
FT                   /db_xref="GOA:A4CH29"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH29"
FT                   /protein_id="EAR16237.1"
FT   gene            388521..388844
FT                   /locus_tag="RB2501_05050"
FT   CDS_pept        388521..388844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05050"
FT                   /product="bacterial regulatory protein, ArsR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16238"
FT                   /db_xref="GOA:A4CH30"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH30"
FT                   /protein_id="EAR16238.1"
FT                   QCC"
FT   gene            388954..389445
FT                   /locus_tag="RB2501_05055"
FT   CDS_pept        388954..389445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16239"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH31"
FT                   /protein_id="EAR16239.1"
FT                   "
FT   gene            389461..389952
FT                   /locus_tag="RB2501_05060"
FT   CDS_pept        389461..389952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05060"
FT                   /product="phosphinothricin N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05060"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16240"
FT                   /db_xref="GOA:A4CH32"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH32"
FT                   /protein_id="EAR16240.1"
FT                   "
FT   gene            389987..390409
FT                   /locus_tag="RB2501_05065"
FT   CDS_pept        389987..390409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05065"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16241"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH33"
FT                   /protein_id="EAR16241.1"
FT   gene            complement(390387..392222)
FT                   /locus_tag="RB2501_05070"
FT   CDS_pept        complement(390387..392222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05070"
FT                   /product="Putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05070"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16242"
FT                   /db_xref="GOA:A4CH34"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH34"
FT                   /protein_id="EAR16242.1"
FT   gene            complement(392324..393574)
FT                   /locus_tag="RB2501_05075"
FT   CDS_pept        complement(392324..393574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05075"
FT                   /product="aspartate kinase III"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16243"
FT                   /db_xref="GOA:A4CH35"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH35"
FT                   /protein_id="EAR16243.1"
FT                   EVLLEQRSKETVQLVVK"
FT   gene            complement(393561..394049)
FT                   /locus_tag="RB2501_05080"
FT   CDS_pept        complement(393561..394049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05080"
FT                   /product="N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16244"
FT                   /db_xref="GOA:A4CH36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032959"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH36"
FT                   /protein_id="EAR16244.1"
FT   gene            394164..395171
FT                   /locus_tag="RB2501_05085"
FT   CDS_pept        394164..395171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05085"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05085"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16245"
FT                   /db_xref="GOA:A4CH37"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH37"
FT                   /protein_id="EAR16245.1"
FT   gene            complement(395225..395653)
FT                   /locus_tag="RB2501_05090"
FT   CDS_pept        complement(395225..395653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05090"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16246"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH38"
FT                   /protein_id="EAR16246.1"
FT   gene            395882..396895
FT                   /locus_tag="RB2501_05095"
FT   CDS_pept        395882..396895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05095"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16247"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH39"
FT                   /protein_id="EAR16247.1"
FT   gene            396892..398499
FT                   /locus_tag="RB2501_05100"
FT   CDS_pept        396892..398499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05100"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16248"
FT                   /db_xref="GOA:A4CH40"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH40"
FT                   /protein_id="EAR16248.1"
FT                   DKPISEANTLAELENMIP"
FT   gene            398503..401007
FT                   /locus_tag="RB2501_05105"
FT   CDS_pept        398503..401007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05105"
FT                   /product="Helicase, C-terminal:DEAD/DEAH box helicase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16249"
FT                   /db_xref="GOA:A4CH41"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH41"
FT                   /protein_id="EAR16249.1"
FT   gene            401028..401702
FT                   /locus_tag="RB2501_05110"
FT   CDS_pept        401028..401702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05110"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16250"
FT                   /db_xref="GOA:A4CH42"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH42"
FT                   /protein_id="EAR16250.1"
FT                   KS"
FT   gene            401699..402514
FT                   /locus_tag="RB2501_05115"
FT   CDS_pept        401699..402514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16251"
FT                   /db_xref="GOA:A4CH43"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH43"
FT                   /protein_id="EAR16251.1"
FT   gene            402576..405941
FT                   /locus_tag="RB2501_05120"
FT   CDS_pept        402576..405941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05120"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16252"
FT                   /db_xref="GOA:A4CH44"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH44"
FT                   /protein_id="EAR16252.1"
FT                   GALEPIAGSRVPQA"
FT   gene            406046..407965
FT                   /locus_tag="RB2501_05125"
FT   CDS_pept        406046..407965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05125"
FT                   /product="Alpha-amino acid ester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05125"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16253"
FT                   /db_xref="GOA:A4CH45"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH45"
FT                   /protein_id="EAR16253.1"
FT                   FIRD"
FT   gene            complement(408063..408722)
FT                   /locus_tag="RB2501_05130"
FT   CDS_pept        complement(408063..408722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16254"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH46"
FT                   /protein_id="EAR16254.1"
FT   gene            complement(408805..409191)
FT                   /locus_tag="RB2501_05135"
FT   CDS_pept        complement(408805..409191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16255"
FT                   /db_xref="GOA:A4CH47"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH47"
FT                   /protein_id="EAR16255.1"
FT   gene            409391..410899
FT                   /locus_tag="RB2501_05140"
FT   CDS_pept        409391..410899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05140"
FT                   /product="probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05140"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16256"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH48"
FT                   /protein_id="EAR16256.1"
FT   gene            411026..412606
FT                   /locus_tag="RB2501_05145"
FT   CDS_pept        411026..412606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05145"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16257"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH49"
FT                   /protein_id="EAR16257.1"
FT                   HLAKSIMVA"
FT   gene            412754..414829
FT                   /locus_tag="RB2501_05150"
FT   CDS_pept        412754..414829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05150"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05150"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16258"
FT                   /db_xref="GOA:A4CH50"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH50"
FT                   /protein_id="EAR16258.1"
FT   gene            414834..415736
FT                   /locus_tag="RB2501_05155"
FT   CDS_pept        414834..415736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05155"
FT                   /product="Histone deacetylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05155"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16259"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH51"
FT                   /protein_id="EAR16259.1"
FT   gene            415736..416575
FT                   /locus_tag="RB2501_05160"
FT   CDS_pept        415736..416575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05160"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05160"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16260"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH52"
FT                   /protein_id="EAR16260.1"
FT   gene            417056..417574
FT                   /locus_tag="RB2501_05165"
FT   CDS_pept        417056..417574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05165"
FT                   /product="ferritin 1"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05165"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16261"
FT                   /db_xref="GOA:A4CH53"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH53"
FT                   /protein_id="EAR16261.1"
FT                   DSAASGETA"
FT   gene            417665..417886
FT                   /locus_tag="RB2501_05170"
FT   CDS_pept        417665..417886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05170"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16262"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH54"
FT                   /protein_id="EAR16262.1"
FT   gene            complement(417948..418403)
FT                   /locus_tag="RB2501_05175"
FT   CDS_pept        complement(417948..418403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05175"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16263"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH55"
FT                   /protein_id="EAR16263.1"
FT   gene            complement(418545..418877)
FT                   /locus_tag="RB2501_05180"
FT   CDS_pept        complement(418545..418877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05180"
FT                   /product="Single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05180"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16264"
FT                   /db_xref="GOA:A4CH56"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH56"
FT                   /protein_id="EAR16264.1"
FT                   LLLLGK"
FT   gene            419121..420689
FT                   /locus_tag="RB2501_05185"
FT   CDS_pept        419121..420689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05185"
FT                   /product="peptidase, M28 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05185"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16265"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH57"
FT                   /protein_id="EAR16265.1"
FT                   EGGQD"
FT   gene            420771..422081
FT                   /locus_tag="RB2501_05190"
FT   CDS_pept        420771..422081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05190"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16266"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH58"
FT                   /protein_id="EAR16266.1"
FT   gene            422177..425317
FT                   /locus_tag="RB2501_05195"
FT   CDS_pept        422177..425317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05195"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16267"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH59"
FT                   /protein_id="EAR16267.1"
FT   gene            complement(425567..425689)
FT                   /locus_tag="RB2501_05200"
FT   CDS_pept        complement(425567..425689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05200"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16268"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH60"
FT                   /protein_id="EAR16268.1"
FT   gene            complement(425729..426247)
FT                   /locus_tag="RB2501_05205"
FT   CDS_pept        complement(425729..426247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05205"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05205"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16269"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH61"
FT                   /protein_id="EAR16269.1"
FT                   LKLNSQNWK"
FT   gene            426321..428606
FT                   /locus_tag="RB2501_05210"
FT   CDS_pept        426321..428606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05210"
FT                   /product="peptidase, M20/M25/M40 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05210"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16270"
FT                   /db_xref="GOA:A4CH62"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH62"
FT                   /protein_id="EAR16270.1"
FT                   LIKSLHFE"
FT   gene            428599..429453
FT                   /locus_tag="RB2501_05215"
FT   CDS_pept        428599..429453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05215"
FT                   /product="Hypothetical enzyme of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05215"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16271"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH63"
FT                   /protein_id="EAR16271.1"
FT                   PEA"
FT   gene            429572..429946
FT                   /locus_tag="RB2501_05220"
FT   CDS_pept        429572..429946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05220"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16272"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH64"
FT                   /protein_id="EAR16272.1"
FT   gene            430139..430846
FT                   /locus_tag="RB2501_05225"
FT   CDS_pept        430139..430846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05225"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16273"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH65"
FT                   /protein_id="EAR16273.1"
FT                   RKQQAQEGENPDN"
FT   gene            complement(430941..431417)
FT                   /locus_tag="RB2501_05230"
FT   CDS_pept        complement(430941..431417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05230"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16274"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH66"
FT                   /protein_id="EAR16274.1"
FT   gene            complement(431452..431946)
FT                   /locus_tag="RB2501_05235"
FT   CDS_pept        complement(431452..431946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05235"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16275"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH67"
FT                   /protein_id="EAR16275.1"
FT                   D"
FT   gene            432009..432959
FT                   /locus_tag="RB2501_05240"
FT   CDS_pept        432009..432959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05240"
FT                   /product="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05240"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16276"
FT                   /db_xref="GOA:A4CH68"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH68"
FT                   /protein_id="EAR16276.1"
FT   gene            complement(432947..434320)
FT                   /locus_tag="RB2501_05245"
FT   CDS_pept        complement(432947..434320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05245"
FT                   /product="possible ribosomal protein S6 modification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05245"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16277"
FT                   /db_xref="GOA:A4CH69"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH69"
FT                   /protein_id="EAR16277.1"
FT   gene            complement(434401..434709)
FT                   /locus_tag="RB2501_05250"
FT   CDS_pept        complement(434401..434709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05250"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16278"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH70"
FT                   /protein_id="EAR16278.1"
FT   gene            complement(434712..435686)
FT                   /locus_tag="RB2501_05255"
FT   CDS_pept        complement(434712..435686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05255"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16279"
FT                   /db_xref="GOA:A4CH71"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH71"
FT                   /protein_id="EAR16279.1"
FT   gene            complement(435743..436615)
FT                   /locus_tag="RB2501_05260"
FT   CDS_pept        complement(435743..436615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05260"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05260"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16280"
FT                   /db_xref="GOA:A4CH72"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH72"
FT                   /protein_id="EAR16280.1"
FT                   REDAIEGDA"
FT   gene            complement(436669..438132)
FT                   /locus_tag="RB2501_05265"
FT   CDS_pept        complement(436669..438132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05265"
FT                   /product="arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05265"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16281"
FT                   /db_xref="GOA:A4CH73"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH73"
FT                   /protein_id="EAR16281.1"
FT   gene            438620..439276
FT                   /locus_tag="RB2501_05270"
FT   CDS_pept        438620..439276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05270"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16282"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH74"
FT                   /protein_id="EAR16282.1"
FT   gene            complement(439383..439817)
FT                   /locus_tag="RB2501_05275"
FT   CDS_pept        complement(439383..439817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05275"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05275"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16283"
FT                   /db_xref="GOA:A4CH75"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH75"
FT                   /protein_id="EAR16283.1"
FT   gene            complement(439837..440304)
FT                   /locus_tag="RB2501_05280"
FT   CDS_pept        complement(439837..440304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05280"
FT                   /product="molybdopterinconverting factor, subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16284"
FT                   /db_xref="GOA:A4CH76"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH76"
FT                   /protein_id="EAR16284.1"
FT   gene            440557..440628
FT                   /locus_tag="RB2501_t10138"
FT   tRNA            440557..440628
FT                   /locus_tag="RB2501_t10138"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            441066..441137
FT                   /locus_tag="RB2501_t10140"
FT   tRNA            441066..441137
FT                   /locus_tag="RB2501_t10140"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            442099..442764
FT                   /locus_tag="RB2501_05285"
FT   CDS_pept        442099..442764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05285"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05285"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16285"
FT                   /db_xref="GOA:A4CH77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH77"
FT                   /protein_id="EAR16285.1"
FT   gene            443214..443288
FT                   /locus_tag="RB2501_05290"
FT   CDS_pept        443214..443288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05290"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16286"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH78"
FT                   /protein_id="EAR16286.1"
FT                   /translation="MKQKFDKMREAVKNKQPNFSILHF"
FT   gene            443304..443747
FT                   /locus_tag="RB2501_05295"
FT   CDS_pept        443304..443747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05295"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16287"
FT                   /db_xref="GOA:A4CH79"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH79"
FT                   /protein_id="EAR16287.1"
FT   gene            complement(443740..443874)
FT                   /locus_tag="RB2501_05300"
FT   CDS_pept        complement(443740..443874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05300"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16288"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH80"
FT                   /protein_id="EAR16288.1"
FT   gene            443960..444292
FT                   /locus_tag="RB2501_05305"
FT   CDS_pept        443960..444292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05305"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16289"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH81"
FT                   /protein_id="EAR16289.1"
FT                   VIGNIQ"
FT   gene            444633..445070
FT                   /locus_tag="RB2501_05310"
FT   CDS_pept        444633..445070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05310"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16290"
FT                   /db_xref="InterPro:IPR041519"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH82"
FT                   /protein_id="EAR16290.1"
FT   gene            445063..445383
FT                   /locus_tag="RB2501_05315"
FT   CDS_pept        445063..445383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16291"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH83"
FT                   /protein_id="EAR16291.1"
FT                   ST"
FT   gene            445751..446920
FT                   /locus_tag="RB2501_05320"
FT   CDS_pept        445751..446920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05320"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16292"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH84"
FT                   /protein_id="EAR16292.1"
FT   gene            complement(446956..449076)
FT                   /locus_tag="RB2501_05325"
FT   CDS_pept        complement(446956..449076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05325"
FT                   /product="serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05325"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16293"
FT                   /db_xref="GOA:A4CH85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH85"
FT                   /protein_id="EAR16293.1"
FT                   RLEKELEQEGLL"
FT   gene            449237..449806
FT                   /locus_tag="RB2501_05330"
FT   CDS_pept        449237..449806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05330"
FT                   /product="Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16294"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH86"
FT                   /protein_id="EAR16294.1"
FT   gene            449881..450930
FT                   /locus_tag="RB2501_05335"
FT   CDS_pept        449881..450930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05335"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16295"
FT                   /db_xref="GOA:A4CH87"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH87"
FT                   /protein_id="EAR16295.1"
FT                   LPKSAGTME"
FT   gene            complement(450957..451580)
FT                   /locus_tag="RB2501_05340"
FT   CDS_pept        complement(450957..451580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05340"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16296"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH88"
FT                   /protein_id="EAR16296.1"
FT   gene            complement(451669..451863)
FT                   /locus_tag="RB2501_05345"
FT   CDS_pept        complement(451669..451863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05345"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05345"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16297"
FT                   /db_xref="GOA:A4CH89"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH89"
FT                   /protein_id="EAR16297.1"
FT   gene            complement(451881..452291)
FT                   /locus_tag="RB2501_05350"
FT   CDS_pept        complement(451881..452291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16298"
FT                   /db_xref="GOA:A4CH90"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH90"
FT                   /protein_id="EAR16298.1"
FT   gene            complement(452385..453023)
FT                   /locus_tag="RB2501_05355"
FT   CDS_pept        complement(452385..453023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05355"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16299"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH91"
FT                   /protein_id="EAR16299.1"
FT   gene            complement(453153..456293)
FT                   /locus_tag="RB2501_05360"
FT   CDS_pept        complement(453153..456293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16300"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH92"
FT                   /protein_id="EAR16300.1"
FT   gene            complement(456364..457341)
FT                   /locus_tag="RB2501_05365"
FT   CDS_pept        complement(456364..457341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05365"
FT                   /product="probable large multifunctional protein-putative
FT                   glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05365"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16301"
FT                   /db_xref="GOA:A4CH93"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH93"
FT                   /protein_id="EAR16301.1"
FT   gene            457471..457869
FT                   /locus_tag="RB2501_05370"
FT   CDS_pept        457471..457869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05370"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16302"
FT                   /db_xref="GOA:A4CH94"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH94"
FT                   /protein_id="EAR16302.1"
FT   gene            457874..457966
FT                   /locus_tag="RB2501_05375"
FT   CDS_pept        457874..457966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05375"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16303"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH95"
FT                   /protein_id="EAR16303.1"
FT                   /translation="MGFGKGEGTVQGPLGMAFIMDDYRMVLELS"
FT   gene            complement(458009..458701)
FT                   /locus_tag="RB2501_05380"
FT   CDS_pept        complement(458009..458701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16304"
FT                   /db_xref="GOA:A4CH96"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH96"
FT                   /protein_id="EAR16304.1"
FT                   LQNFKIDR"
FT   gene            458792..459853
FT                   /locus_tag="RB2501_05385"
FT   CDS_pept        458792..459853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05385"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16305"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH97"
FT                   /protein_id="EAR16305.1"
FT                   SYREQILVSARDQ"
FT   gene            complement(459860..461536)
FT                   /locus_tag="RB2501_05390"
FT   CDS_pept        complement(459860..461536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05390"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16306"
FT                   /db_xref="GOA:A4CH98"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR026263"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH98"
FT                   /protein_id="EAR16306.1"
FT   gene            complement(461643..462764)
FT                   /locus_tag="RB2501_05395"
FT   CDS_pept        complement(461643..462764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05395"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05395"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16307"
FT                   /db_xref="GOA:A4CH99"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4CH99"
FT                   /protein_id="EAR16307.1"
FT   gene            462985..463272
FT                   /locus_tag="RB2501_05400"
FT   CDS_pept        462985..463272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05400"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16308"
FT                   /db_xref="GOA:A4CHA0"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA0"
FT                   /protein_id="EAR16308.1"
FT   gene            463891..464289
FT                   /locus_tag="RB2501_05405"
FT   CDS_pept        463891..464289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05405"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16309"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA1"
FT                   /protein_id="EAR16309.1"
FT   gene            464370..468701
FT                   /locus_tag="RB2501_05410"
FT   CDS_pept        464370..468701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05410"
FT                   /product="putative transport-related, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16310"
FT                   /db_xref="GOA:A4CHA2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA2"
FT                   /protein_id="EAR16310.1"
FT   gene            468736..469911
FT                   /locus_tag="RB2501_05415"
FT   CDS_pept        468736..469911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05415"
FT                   /product="cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16311"
FT                   /db_xref="GOA:A4CHA3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA3"
FT                   /protein_id="EAR16311.1"
FT   gene            complement(469925..472399)
FT                   /locus_tag="RB2501_05420"
FT   CDS_pept        complement(469925..472399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05420"
FT                   /product="penicillin acylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16312"
FT                   /db_xref="GOA:A4CHA4"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA4"
FT                   /protein_id="EAR16312.1"
FT                   KHADARMVLQPE"
FT   gene            complement(472401..474482)
FT                   /locus_tag="RB2501_05425"
FT   CDS_pept        complement(472401..474482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05425"
FT                   /product="Penicillin amidase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16313"
FT                   /db_xref="GOA:A4CHA5"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA5"
FT                   /protein_id="EAR16313.1"
FT   gene            complement(474532..475050)
FT                   /locus_tag="RB2501_05430"
FT   CDS_pept        complement(474532..475050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05430"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16314"
FT                   /db_xref="GOA:A4CHA6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA6"
FT                   /protein_id="EAR16314.1"
FT                   LLTVILLFV"
FT   gene            complement(475270..478518)
FT                   /locus_tag="RB2501_05435"
FT   CDS_pept        complement(475270..478518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16315"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA7"
FT                   /protein_id="EAR16315.1"
FT   gene            complement(478610..479392)
FT                   /locus_tag="RB2501_05440"
FT   CDS_pept        complement(478610..479392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16316"
FT                   /db_xref="GOA:A4CHA8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA8"
FT                   /protein_id="EAR16316.1"
FT   gene            complement(479385..480095)
FT                   /locus_tag="RB2501_05445"
FT   CDS_pept        complement(479385..480095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05445"
FT                   /product="ATP-binding transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05445"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16317"
FT                   /db_xref="GOA:A4CHA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHA9"
FT                   /protein_id="EAR16317.1"
FT                   EHAIAAITSEKQHA"
FT   gene            complement(480092..481276)
FT                   /locus_tag="RB2501_05450"
FT   CDS_pept        complement(480092..481276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05450"
FT                   /product="putative copper-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16318"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB0"
FT                   /protein_id="EAR16318.1"
FT   gene            complement(481369..481788)
FT                   /locus_tag="RB2501_05455"
FT   CDS_pept        complement(481369..481788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16319"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB1"
FT                   /protein_id="EAR16319.1"
FT   gene            complement(481858..482472)
FT                   /locus_tag="RB2501_05460"
FT   CDS_pept        complement(481858..482472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16320"
FT                   /db_xref="GOA:A4CHB2"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB2"
FT                   /protein_id="EAR16320.1"
FT   gene            complement(482579..484537)
FT                   /locus_tag="RB2501_05465"
FT   CDS_pept        complement(482579..484537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05465"
FT                   /product="nitrous oxide reductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05465"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16321"
FT                   /db_xref="GOA:A4CHB3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB3"
FT                   /protein_id="EAR16321.1"
FT                   RVSPANSNLELSWSLGE"
FT   gene            complement(484579..485154)
FT                   /locus_tag="RB2501_05470"
FT   CDS_pept        complement(484579..485154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05470"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16322"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB4"
FT                   /protein_id="EAR16322.1"
FT   gene            complement(485161..485652)
FT                   /locus_tag="RB2501_05475"
FT   CDS_pept        complement(485161..485652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05475"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16323"
FT                   /db_xref="GOA:A4CHB5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB5"
FT                   /protein_id="EAR16323.1"
FT                   "
FT   gene            485697..485807
FT                   /locus_tag="RB2501_05480"
FT   CDS_pept        485697..485807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16324"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB6"
FT                   /protein_id="EAR16324.1"
FT   gene            485804..486235
FT                   /locus_tag="RB2501_05485"
FT   CDS_pept        485804..486235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16325"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB7"
FT                   /protein_id="EAR16325.1"
FT   gene            complement(486431..486898)
FT                   /locus_tag="RB2501_05490"
FT   CDS_pept        complement(486431..486898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05490"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16326"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB8"
FT                   /protein_id="EAR16326.1"
FT   gene            486984..488231
FT                   /locus_tag="RB2501_05495"
FT   CDS_pept        486984..488231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHB9"
FT                   /protein_id="EAR16327.1"
FT                   PQPDKWQGLVINRIQF"
FT   gene            488233..488679
FT                   /locus_tag="RB2501_05500"
FT   CDS_pept        488233..488679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05500"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05500"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16328"
FT                   /db_xref="GOA:A4CHC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC0"
FT                   /protein_id="EAR16328.1"
FT   gene            complement(488820..488893)
FT                   /locus_tag="RB2501_t10160"
FT   tRNA            complement(488820..488893)
FT                   /locus_tag="RB2501_t10160"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            complement(489044..490387)
FT                   /locus_tag="RB2501_05505"
FT   CDS_pept        complement(489044..490387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05505"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05505"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16329"
FT                   /db_xref="GOA:A4CHC1"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC1"
FT                   /protein_id="EAR16329.1"
FT   gene            490504..491229
FT                   /locus_tag="RB2501_05510"
FT   CDS_pept        490504..491229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05510"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16330"
FT                   /db_xref="GOA:A4CHC2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC2"
FT                   /protein_id="EAR16330.1"
FT   gene            491438..491671
FT                   /locus_tag="RB2501_05515"
FT   CDS_pept        491438..491671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05515"
FT                   /product="probable ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16331"
FT                   /db_xref="GOA:A4CHC3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC3"
FT                   /protein_id="EAR16331.1"
FT   gene            491664..493901
FT                   /locus_tag="RB2501_05520"
FT   CDS_pept        491664..493901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05520"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16332"
FT                   /db_xref="GOA:A4CHC4"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC4"
FT                   /protein_id="EAR16332.1"
FT   gene            493901..494035
FT                   /locus_tag="RB2501_05525"
FT   CDS_pept        493901..494035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16333"
FT                   /db_xref="GOA:A4CHC5"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC5"
FT                   /protein_id="EAR16333.1"
FT   gene            494049..494462
FT                   /locus_tag="RB2501_05530"
FT   CDS_pept        494049..494462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05530"
FT                   /product="putative TonB-linked outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16334"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC6"
FT                   /protein_id="EAR16334.1"
FT   gene            complement(494463..494876)
FT                   /locus_tag="RB2501_05535"
FT   CDS_pept        complement(494463..494876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05535"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16335"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC7"
FT                   /protein_id="EAR16335.1"
FT   gene            complement(495041..495478)
FT                   /locus_tag="RB2501_05540"
FT   CDS_pept        complement(495041..495478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16336"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC8"
FT                   /protein_id="EAR16336.1"
FT   gene            495733..496254
FT                   /locus_tag="RB2501_05545"
FT   CDS_pept        495733..496254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05545"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16337"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHC9"
FT                   /protein_id="EAR16337.1"
FT                   VVPPWSEGGQ"
FT   gene            complement(496320..497141)
FT                   /locus_tag="RB2501_05550"
FT   CDS_pept        complement(496320..497141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05550"
FT                   /product="GufA protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05550"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16338"
FT                   /db_xref="GOA:A4CHD0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD0"
FT                   /protein_id="EAR16338.1"
FT   gene            complement(497138..497800)
FT                   /locus_tag="RB2501_05555"
FT   CDS_pept        complement(497138..497800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05555"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16339"
FT                   /db_xref="GOA:A4CHD1"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD1"
FT                   /protein_id="EAR16339.1"
FT   gene            497895..500171
FT                   /locus_tag="RB2501_05560"
FT   CDS_pept        497895..500171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05560"
FT                   /product="putative TonB-dependent outer membrane receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05560"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16340"
FT                   /db_xref="GOA:A4CHD2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD2"
FT                   /protein_id="EAR16340.1"
FT                   LRYQL"
FT   gene            500301..501506
FT                   /locus_tag="RB2501_05565"
FT   CDS_pept        500301..501506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05565"
FT                   /product="lycopene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05565"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16341"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD3"
FT                   /protein_id="EAR16341.1"
FT                   FR"
FT   gene            complement(501436..502413)
FT                   /locus_tag="RB2501_05570"
FT   CDS_pept        complement(501436..502413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05570"
FT                   /product="putative isoprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16342"
FT                   /db_xref="GOA:A4CHD4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD4"
FT                   /protein_id="EAR16342.1"
FT   gene            502498..503070
FT                   /locus_tag="RB2501_05575"
FT   CDS_pept        502498..503070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05575"
FT                   /product="Sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05575"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16343"
FT                   /db_xref="GOA:A4CHD5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD5"
FT                   /protein_id="EAR16343.1"
FT   gene            503083..503532
FT                   /locus_tag="RB2501_05580"
FT   CDS_pept        503083..503532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16344"
FT                   /db_xref="GOA:A4CHD6"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD6"
FT                   /protein_id="EAR16344.1"
FT   gene            503725..504330
FT                   /locus_tag="RB2501_05585"
FT   CDS_pept        503725..504330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16345"
FT                   /db_xref="GOA:A4CHD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD7"
FT                   /protein_id="EAR16345.1"
FT   gene            504331..505734
FT                   /locus_tag="RB2501_05590"
FT   CDS_pept        504331..505734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05590"
FT                   /product="outer membrane efflux protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05590"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16346"
FT                   /db_xref="GOA:A4CHD8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD8"
FT                   /protein_id="EAR16346.1"
FT                   TALENILNP"
FT   gene            505734..506990
FT                   /locus_tag="RB2501_05595"
FT   CDS_pept        505734..506990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05595"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16347"
FT                   /db_xref="GOA:A4CHD9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHD9"
FT                   /protein_id="EAR16347.1"
FT   gene            506987..510493
FT                   /locus_tag="RB2501_05600"
FT   CDS_pept        506987..510493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05600"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05600"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16348"
FT                   /db_xref="GOA:A4CHE0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE0"
FT                   /protein_id="EAR16348.1"
FT                   AA"
FT   gene            510591..512342
FT                   /locus_tag="RB2501_05605"
FT   CDS_pept        510591..512342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05605"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05605"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16349"
FT                   /db_xref="GOA:A4CHE1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE1"
FT                   /protein_id="EAR16349.1"
FT                   HLGLLES"
FT   gene            512438..514222
FT                   /locus_tag="RB2501_05610"
FT   CDS_pept        512438..514222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05610"
FT                   /product="putative transport related, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16350"
FT                   /db_xref="GOA:A4CHE2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE2"
FT                   /protein_id="EAR16350.1"
FT                   SKSKLLTAYRRKLITFAR"
FT   gene            514222..514485
FT                   /locus_tag="RB2501_05615"
FT   CDS_pept        514222..514485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05615"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16351"
FT                   /db_xref="GOA:A4CHE3"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE3"
FT                   /protein_id="EAR16351.1"
FT   gene            514574..514768
FT                   /locus_tag="RB2501_05620"
FT   CDS_pept        514574..514768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05620"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16352"
FT                   /db_xref="GOA:A4CHE4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE4"
FT                   /protein_id="EAR16352.1"
FT   gene            complement(514843..515292)
FT                   /locus_tag="RB2501_05625"
FT   CDS_pept        complement(514843..515292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05625"
FT                   /product="putative cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16353"
FT                   /db_xref="GOA:A4CHE5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE5"
FT                   /protein_id="EAR16353.1"
FT   gene            515391..517163
FT                   /locus_tag="RB2501_05630"
FT   CDS_pept        515391..517163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05630"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16354"
FT                   /db_xref="GOA:A4CHE6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE6"
FT                   /protein_id="EAR16354.1"
FT                   KASLLRTLNNLTHE"
FT   gene            517156..518259
FT                   /locus_tag="RB2501_05635"
FT   CDS_pept        517156..518259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05635"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16355"
FT                   /db_xref="InterPro:IPR021428"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE7"
FT                   /protein_id="EAR16355.1"
FT   gene            complement(518260..519609)
FT                   /locus_tag="RB2501_05640"
FT   CDS_pept        complement(518260..519609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05640"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05640"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16356"
FT                   /db_xref="GOA:A4CHE8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE8"
FT                   /protein_id="EAR16356.1"
FT   gene            519848..522607
FT                   /locus_tag="RB2501_05645"
FT   CDS_pept        519848..522607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05645"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05645"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16357"
FT                   /db_xref="GOA:A4CHE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHE9"
FT                   /protein_id="EAR16357.1"
FT   gene            522691..524688
FT                   /locus_tag="RB2501_05650"
FT   CDS_pept        522691..524688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16358"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF0"
FT                   /protein_id="EAR16358.1"
FT   gene            524952..527210
FT                   /locus_tag="RB2501_05655"
FT   CDS_pept        524952..527210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05655"
FT                   /product="phosphate sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05655"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16359"
FT                   /db_xref="GOA:A4CHF1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF1"
FT                   /protein_id="EAR16359.1"
FT   gene            complement(527340..527669)
FT                   /locus_tag="RB2501_05660"
FT   CDS_pept        complement(527340..527669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05660"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05660"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16360"
FT                   /db_xref="GOA:A4CHF2"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF2"
FT                   /protein_id="EAR16360.1"
FT                   VAVNR"
FT   gene            527959..528690
FT                   /locus_tag="RB2501_05665"
FT   CDS_pept        527959..528690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16361"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF3"
FT                   /protein_id="EAR16361.1"
FT   gene            528874..529299
FT                   /locus_tag="RB2501_05670"
FT   CDS_pept        528874..529299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16362"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF4"
FT                   /protein_id="EAR16362.1"
FT   gene            complement(529374..529958)
FT                   /locus_tag="RB2501_05675"
FT   CDS_pept        complement(529374..529958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05675"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05675"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16363"
FT                   /db_xref="GOA:A4CHF5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF5"
FT                   /protein_id="EAR16363.1"
FT   gene            complement(529977..530627)
FT                   /locus_tag="RB2501_05680"
FT   CDS_pept        complement(529977..530627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05680"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05680"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16364"
FT                   /db_xref="GOA:A4CHF6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF6"
FT                   /protein_id="EAR16364.1"
FT   gene            complement(530627..531484)
FT                   /locus_tag="RB2501_05685"
FT   CDS_pept        complement(530627..531484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05685"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16365"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF7"
FT                   /protein_id="EAR16365.1"
FT                   LNVL"
FT   gene            complement(531598..532413)
FT                   /locus_tag="RB2501_05690"
FT   CDS_pept        complement(531598..532413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05690"
FT                   /product="putative multi-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16366"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF8"
FT                   /protein_id="EAR16366.1"
FT   gene            complement(532416..533168)
FT                   /locus_tag="RB2501_05695"
FT   CDS_pept        complement(532416..533168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05695"
FT                   /product="probable secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05695"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16367"
FT                   /db_xref="GOA:A4CHF9"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHF9"
FT                   /protein_id="EAR16367.1"
FT   gene            complement(533202..534254)
FT                   /locus_tag="RB2501_05700"
FT   CDS_pept        complement(533202..534254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05700"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16368"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG0"
FT                   /protein_id="EAR16368.1"
FT                   KEMLRKILGQ"
FT   gene            534478..536184
FT                   /locus_tag="RB2501_05705"
FT   CDS_pept        534478..536184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05705"
FT                   /product="oxidoreductase, GMC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05705"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16369"
FT                   /db_xref="GOA:A4CHG1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG1"
FT                   /protein_id="EAR16369.1"
FT   gene            536199..536663
FT                   /locus_tag="RB2501_05710"
FT   CDS_pept        536199..536663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05710"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16370"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG2"
FT                   /protein_id="EAR16370.1"
FT   gene            536748..536810
FT                   /locus_tag="RB2501_05715"
FT   CDS_pept        536748..536810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16371"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG3"
FT                   /protein_id="EAR16371.1"
FT                   /translation="MLLRYFLPSLPFTYKPESLV"
FT   gene            complement(536930..538066)
FT                   /locus_tag="RB2501_05720"
FT   CDS_pept        complement(536930..538066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05720"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16372"
FT                   /db_xref="GOA:A4CHG4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG4"
FT                   /protein_id="EAR16372.1"
FT   gene            complement(538088..539347)
FT                   /locus_tag="RB2501_05725"
FT   CDS_pept        complement(538088..539347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16373"
FT                   /db_xref="GOA:A4CHG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG5"
FT                   /protein_id="EAR16373.1"
FT   gene            complement(539391..540563)
FT                   /locus_tag="RB2501_05730"
FT   CDS_pept        complement(539391..540563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05730"
FT                   /product="putative nucleoside permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05730"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16374"
FT                   /db_xref="GOA:A4CHG6"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG6"
FT                   /protein_id="EAR16374.1"
FT   gene            complement(540609..541052)
FT                   /locus_tag="RB2501_05735"
FT   CDS_pept        complement(540609..541052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05735"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16375"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG7"
FT                   /protein_id="EAR16375.1"
FT   gene            complement(541068..542081)
FT                   /locus_tag="RB2501_05740"
FT   CDS_pept        complement(541068..542081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16376"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG8"
FT                   /protein_id="EAR16376.1"
FT   gene            542288..544000
FT                   /locus_tag="RB2501_05745"
FT   CDS_pept        542288..544000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05745"
FT                   /product="oxidoreductase, GMC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05745"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16377"
FT                   /db_xref="GOA:A4CHG9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHG9"
FT                   /protein_id="EAR16377.1"
FT   gene            544027..544650
FT                   /locus_tag="RB2501_05750"
FT   CDS_pept        544027..544650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05750"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16378"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH0"
FT                   /protein_id="EAR16378.1"
FT   gene            544760..545614
FT                   /locus_tag="RB2501_05755"
FT   CDS_pept        544760..545614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05755"
FT                   /product="probable glyoxylate-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05755"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16379"
FT                   /db_xref="GOA:A4CHH1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH1"
FT                   /protein_id="EAR16379.1"
FT                   VDP"
FT   gene            545703..545834
FT                   /locus_tag="RB2501_05760"
FT   CDS_pept        545703..545834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05760"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16380"
FT                   /db_xref="GOA:A4CHH2"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH2"
FT                   /protein_id="EAR16380.1"
FT   gene            545947..546033
FT                   /locus_tag="RB2501_05765"
FT   CDS_pept        545947..546033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05765"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16381"
FT                   /db_xref="GOA:A4CHH3"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH3"
FT                   /protein_id="EAR16381.1"
FT                   /translation="MENYYIILLGYLAAFLVIRSIVRPMLKD"
FT   gene            complement(546219..548657)
FT                   /locus_tag="RB2501_05770"
FT   CDS_pept        complement(546219..548657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05770"
FT                   /product="probable ribonucleoside-diphosphate reductase
FT                   large chain"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16382"
FT                   /db_xref="GOA:A4CHH4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH4"
FT                   /protein_id="EAR16382.1"
FT                   "
FT   gene            complement(548822..549808)
FT                   /locus_tag="RB2501_05775"
FT   CDS_pept        complement(548822..549808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05775"
FT                   /product="probable ribonucleoside-diphosphate reductase
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05775"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16383"
FT                   /db_xref="GOA:A4CHH5"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH5"
FT                   /protein_id="EAR16383.1"
FT   gene            complement(550299..550874)
FT                   /locus_tag="RB2501_05780"
FT   CDS_pept        complement(550299..550874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16384"
FT                   /db_xref="GOA:A4CHH6"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH6"
FT                   /protein_id="EAR16384.1"
FT   gene            complement(550871..551095)
FT                   /locus_tag="RB2501_05785"
FT   CDS_pept        complement(550871..551095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05785"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16385"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH7"
FT                   /protein_id="EAR16385.1"
FT   gene            551380..552114
FT                   /locus_tag="RB2501_05790"
FT   CDS_pept        551380..552114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05790"
FT                   /product="LytTr DNA-binding domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05790"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16386"
FT                   /db_xref="GOA:A4CHH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH8"
FT                   /protein_id="EAR16386.1"
FT   gene            552128..554062
FT                   /locus_tag="RB2501_05795"
FT   CDS_pept        552128..554062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05795"
FT                   /product="Signal transduction ATPase, FimS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05795"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16387"
FT                   /db_xref="GOA:A4CHH9"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHH9"
FT                   /protein_id="EAR16387.1"
FT                   EVILKIPTI"
FT   gene            complement(554055..554621)
FT                   /locus_tag="RB2501_05800"
FT   CDS_pept        complement(554055..554621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05800"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16388"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI0"
FT                   /protein_id="EAR16388.1"
FT   gene            554633..554755
FT                   /locus_tag="RB2501_05805"
FT   CDS_pept        554633..554755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05805"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16389"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI1"
FT                   /protein_id="EAR16389.1"
FT   gene            554745..555317
FT                   /locus_tag="RB2501_05810"
FT   CDS_pept        554745..555317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05810"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05810"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16390"
FT                   /db_xref="GOA:A4CHI2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI2"
FT                   /protein_id="EAR16390.1"
FT   gene            555382..555570
FT                   /locus_tag="RB2501_05815"
FT   CDS_pept        555382..555570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05815"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16391"
FT                   /db_xref="GOA:A4CHI3"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI3"
FT                   /protein_id="EAR16391.1"
FT                   LLIYQTSRRIQKKLDGE"
FT   gene            complement(555626..557260)
FT                   /locus_tag="RB2501_05820"
FT   CDS_pept        complement(555626..557260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05820"
FT                   /product="putative carboxy-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05820"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16392"
FT                   /db_xref="GOA:A4CHI4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI4"
FT                   /protein_id="EAR16392.1"
FT   gene            complement(557250..557702)
FT                   /locus_tag="RB2501_05825"
FT   CDS_pept        complement(557250..557702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05825"
FT                   /product="deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05825"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16393"
FT                   /db_xref="GOA:A4CHI5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI5"
FT                   /protein_id="EAR16393.1"
FT   gene            complement(557807..558394)
FT                   /locus_tag="RB2501_05830"
FT   CDS_pept        complement(557807..558394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05830"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16394"
FT                   /db_xref="GOA:A4CHI6"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI6"
FT                   /protein_id="EAR16394.1"
FT   gene            complement(558480..559205)
FT                   /locus_tag="RB2501_05835"
FT   CDS_pept        complement(558480..559205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05835"
FT                   /product="Heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05835"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16395"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI7"
FT                   /protein_id="EAR16395.1"
FT   gene            559359..559769
FT                   /locus_tag="RB2501_05840"
FT   CDS_pept        559359..559769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05840"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16396"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI8"
FT                   /protein_id="EAR16396.1"
FT   gene            559870..560607
FT                   /locus_tag="RB2501_05845"
FT   CDS_pept        559870..560607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05845"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05845"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16397"
FT                   /db_xref="GOA:A4CHI9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHI9"
FT                   /protein_id="EAR16397.1"
FT   gene            560604..561263
FT                   /locus_tag="RB2501_05850"
FT   CDS_pept        560604..561263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05850"
FT                   /product="hydrolase, HAD superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16398"
FT                   /db_xref="GOA:A4CHJ0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ0"
FT                   /protein_id="EAR16398.1"
FT   gene            561399..562820
FT                   /locus_tag="RB2501_05855"
FT   CDS_pept        561399..562820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05855"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05855"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16399"
FT                   /db_xref="GOA:A4CHJ1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ1"
FT                   /protein_id="EAR16399.1"
FT                   NEWVNGSYREGWDLA"
FT   gene            complement(562889..563965)
FT                   /locus_tag="RB2501_05860"
FT   CDS_pept        complement(562889..563965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05860"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16400"
FT                   /db_xref="GOA:A4CHJ2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ2"
FT                   /protein_id="EAR16400.1"
FT                   ELNTSLHAAHKSGQWELF"
FT   gene            complement(564083..565618)
FT                   /locus_tag="RB2501_05865"
FT   CDS_pept        complement(564083..565618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05865"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16401"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ3"
FT                   /protein_id="EAR16401.1"
FT   gene            complement(565652..566434)
FT                   /locus_tag="RB2501_05870"
FT   CDS_pept        complement(565652..566434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05870"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05870"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16402"
FT                   /db_xref="GOA:A4CHJ4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ4"
FT                   /protein_id="EAR16402.1"
FT   gene            complement(566501..567955)
FT                   /locus_tag="RB2501_05875"
FT   CDS_pept        complement(566501..567955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05875"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05875"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16403"
FT                   /db_xref="GOA:A4CHJ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ5"
FT                   /protein_id="EAR16403.1"
FT   gene            complement(568026..568580)
FT                   /locus_tag="RB2501_05880"
FT   CDS_pept        complement(568026..568580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05880"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16404"
FT                   /db_xref="GOA:A4CHJ6"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ6"
FT                   /protein_id="EAR16404.1"
FT   gene            complement(568627..569895)
FT                   /locus_tag="RB2501_05885"
FT   CDS_pept        complement(568627..569895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05885"
FT                   /product="sodium-coupled branched-chain amino acid carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05885"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16405"
FT                   /db_xref="GOA:A4CHJ7"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ7"
FT                   /protein_id="EAR16405.1"
FT   gene            570128..570358
FT                   /locus_tag="RB2501_05890"
FT   CDS_pept        570128..570358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05890"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16406"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ8"
FT                   /protein_id="EAR16406.1"
FT   gene            complement(570359..571414)
FT                   /locus_tag="RB2501_05895"
FT   CDS_pept        complement(570359..571414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05895"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05895"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16407"
FT                   /db_xref="GOA:A4CHJ9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHJ9"
FT                   /protein_id="EAR16407.1"
FT                   RGWNAFGSAGE"
FT   gene            571471..572748
FT                   /locus_tag="RB2501_05900"
FT   CDS_pept        571471..572748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05900"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16408"
FT                   /db_xref="InterPro:IPR027589"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK0"
FT                   /protein_id="EAR16408.1"
FT   gene            572745..574157
FT                   /locus_tag="RB2501_05905"
FT   CDS_pept        572745..574157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05905"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16409"
FT                   /db_xref="GOA:A4CHK1"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK1"
FT                   /protein_id="EAR16409.1"
FT                   LGETDLLLLKIR"
FT   gene            574324..574653
FT                   /locus_tag="RB2501_05910"
FT   CDS_pept        574324..574653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05910"
FT                   /product="Scaffold protein for iron-sulfur cluster
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05910"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16410"
FT                   /db_xref="GOA:A4CHK2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK2"
FT                   /protein_id="EAR16410.1"
FT                   ESFSL"
FT   gene            574705..576150
FT                   /locus_tag="RB2501_05915"
FT   CDS_pept        574705..576150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05915"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16411"
FT                   /db_xref="GOA:A4CHK3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK3"
FT                   /protein_id="EAR16411.1"
FT   gene            576181..576933
FT                   /locus_tag="RB2501_05920"
FT   CDS_pept        576181..576933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05920"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05920"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16412"
FT                   /db_xref="GOA:A4CHK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK4"
FT                   /protein_id="EAR16412.1"
FT   gene            576937..578304
FT                   /locus_tag="RB2501_05925"
FT   CDS_pept        576937..578304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05925"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05925"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16413"
FT                   /db_xref="GOA:A4CHK5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK5"
FT                   /protein_id="EAR16413.1"
FT   gene            578357..579571
FT                   /locus_tag="RB2501_05930"
FT   CDS_pept        578357..579571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05930"
FT                   /product="selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05930"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16414"
FT                   /db_xref="GOA:A4CHK6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK6"
FT                   /protein_id="EAR16414.1"
FT                   RQMLA"
FT   gene            579707..580141
FT                   /locus_tag="RB2501_05935"
FT   CDS_pept        579707..580141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05935"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16415"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK7"
FT                   /protein_id="EAR16415.1"
FT   gene            580199..580528
FT                   /locus_tag="RB2501_05940"
FT   CDS_pept        580199..580528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05940"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16416"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK8"
FT                   /protein_id="EAR16416.1"
FT                   ELGLL"
FT   gene            580580..581092
FT                   /locus_tag="RB2501_05945"
FT   CDS_pept        580580..581092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16417"
FT                   /db_xref="InterPro:IPR018914"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHK9"
FT                   /protein_id="EAR16417.1"
FT                   VPIVRRK"
FT   gene            581193..582086
FT                   /locus_tag="RB2501_05950"
FT   CDS_pept        581193..582086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05950"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16418"
FT                   /db_xref="InterPro:IPR021428"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL0"
FT                   /protein_id="EAR16418.1"
FT                   DNDLQTYWTLGLSYKF"
FT   gene            complement(582348..583565)
FT                   /locus_tag="RB2501_05955"
FT   CDS_pept        complement(582348..583565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05955"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05955"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16419"
FT                   /db_xref="GOA:A4CHL1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL1"
FT                   /protein_id="EAR16419.1"
FT                   LDAYSQ"
FT   gene            complement(583675..584271)
FT                   /locus_tag="RB2501_05960"
FT   CDS_pept        complement(583675..584271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05960"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16420"
FT                   /db_xref="GOA:A4CHL2"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL2"
FT                   /protein_id="EAR16420.1"
FT   gene            complement(584512..585231)
FT                   /locus_tag="RB2501_05965"
FT   CDS_pept        complement(584512..585231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05965"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16421"
FT                   /db_xref="GOA:A4CHL3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL3"
FT                   /protein_id="EAR16421.1"
FT                   LRNEGLLTEDQIIRVQS"
FT   gene            complement(585246..585578)
FT                   /locus_tag="RB2501_05970"
FT   CDS_pept        complement(585246..585578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05970"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16422"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL4"
FT                   /protein_id="EAR16422.1"
FT                   DFVFFR"
FT   gene            complement(585530..586000)
FT                   /locus_tag="RB2501_05975"
FT   CDS_pept        complement(585530..586000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05975"
FT                   /product="hypothetical methylated DNA-protein
FT                   cysteinemethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16423"
FT                   /db_xref="GOA:A4CHL5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL5"
FT                   /protein_id="EAR16423.1"
FT   gene            complement(586160..587260)
FT                   /locus_tag="RB2501_05980"
FT   CDS_pept        complement(586160..587260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05980"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16424"
FT                   /db_xref="GOA:A4CHL6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL6"
FT                   /protein_id="EAR16424.1"
FT   gene            complement(587311..588585)
FT                   /locus_tag="RB2501_05985"
FT   CDS_pept        complement(587311..588585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05985"
FT                   /product="beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16425"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL7"
FT                   /protein_id="EAR16425.1"
FT   gene            complement(588753..589742)
FT                   /locus_tag="RB2501_05990"
FT   CDS_pept        complement(588753..589742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05990"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16426"
FT                   /db_xref="GOA:A4CHL8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL8"
FT                   /protein_id="EAR16426.1"
FT   gene            complement(589746..590570)
FT                   /locus_tag="RB2501_05995"
FT   CDS_pept        complement(589746..590570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_05995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_05995"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16427"
FT                   /db_xref="GOA:A4CHL9"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHL9"
FT                   /protein_id="EAR16427.1"
FT   gene            complement(590619..591521)
FT                   /locus_tag="RB2501_06000"
FT   CDS_pept        complement(590619..591521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06000"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16428"
FT                   /db_xref="GOA:A4CHM0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM0"
FT                   /protein_id="EAR16428.1"
FT   gene            complement(591611..592660)
FT                   /locus_tag="RB2501_06005"
FT   CDS_pept        complement(591611..592660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06005"
FT                   /product="Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16429"
FT                   /db_xref="GOA:A4CHM1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM1"
FT                   /protein_id="EAR16429.1"
FT                   AVKTYREEG"
FT   gene            complement(592734..593405)
FT                   /locus_tag="RB2501_06010"
FT   CDS_pept        complement(592734..593405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06010"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16430"
FT                   /db_xref="GOA:A4CHM2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM2"
FT                   /protein_id="EAR16430.1"
FT                   G"
FT   gene            complement(593402..594349)
FT                   /locus_tag="RB2501_06015"
FT   CDS_pept        complement(593402..594349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06015"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06015"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16431"
FT                   /db_xref="GOA:A4CHM3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM3"
FT                   /protein_id="EAR16431.1"
FT   gene            complement(594346..595602)
FT                   /locus_tag="RB2501_06020"
FT   CDS_pept        complement(594346..595602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06020"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06020"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16432"
FT                   /db_xref="GOA:A4CHM4"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM4"
FT                   /protein_id="EAR16432.1"
FT   gene            595809..596690
FT                   /locus_tag="RB2501_06025"
FT   CDS_pept        595809..596690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06025"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06025"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16433"
FT                   /db_xref="GOA:A4CHM5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM5"
FT                   /protein_id="EAR16433.1"
FT                   NTTPKKYLMSLA"
FT   gene            complement(596693..597544)
FT                   /locus_tag="RB2501_06030"
FT   CDS_pept        complement(596693..597544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16434"
FT                   /db_xref="InterPro:IPR010846"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM6"
FT                   /protein_id="EAR16434.1"
FT                   MR"
FT   gene            complement(597780..598856)
FT                   /locus_tag="RB2501_06035"
FT   CDS_pept        complement(597780..598856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06035"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16435"
FT                   /db_xref="GOA:A4CHM7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM7"
FT                   /protein_id="EAR16435.1"
FT                   AHTRVLLHENLNGEKADD"
FT   gene            complement(598841..599053)
FT                   /locus_tag="RB2501_06040"
FT   CDS_pept        complement(598841..599053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16436"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM8"
FT                   /protein_id="EAR16436.1"
FT   gene            599242..600276
FT                   /locus_tag="RB2501_06045"
FT   CDS_pept        599242..600276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06045"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16437"
FT                   /db_xref="GOA:A4CHM9"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHM9"
FT                   /protein_id="EAR16437.1"
FT                   LPAV"
FT   gene            600383..601759
FT                   /locus_tag="RB2501_06050"
FT   CDS_pept        600383..601759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06050"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16438"
FT                   /db_xref="GOA:A4CHN0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN0"
FT                   /protein_id="EAR16438.1"
FT                   "
FT   gene            complement(601914..603188)
FT                   /locus_tag="RB2501_06055"
FT   CDS_pept        complement(601914..603188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06055"
FT                   /product="putative UDP-glucose:sterol glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16439"
FT                   /db_xref="GOA:A4CHN1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN1"
FT                   /protein_id="EAR16439.1"
FT   gene            complement(603258..604085)
FT                   /locus_tag="RB2501_06060"
FT   CDS_pept        complement(603258..604085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06060"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16440"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN2"
FT                   /protein_id="EAR16440.1"
FT   gene            604386..605888
FT                   /locus_tag="RB2501_06065"
FT   CDS_pept        604386..605888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06065"
FT                   /product="probable outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16441"
FT                   /db_xref="GOA:A4CHN3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN3"
FT                   /protein_id="EAR16441.1"
FT   gene            605885..607150
FT                   /locus_tag="RB2501_06070"
FT   CDS_pept        605885..607150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06070"
FT                   /product="probable RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06070"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16442"
FT                   /db_xref="GOA:A4CHN4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN4"
FT                   /protein_id="EAR16442.1"
FT   gene            607152..610421
FT                   /locus_tag="RB2501_06075"
FT   CDS_pept        607152..610421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06075"
FT                   /product="probable multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16443"
FT                   /db_xref="GOA:A4CHN5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN5"
FT                   /protein_id="EAR16443.1"
FT   gene            610685..612370
FT                   /locus_tag="RB2501_06080"
FT   CDS_pept        610685..612370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06080"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16444"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN6"
FT                   /protein_id="EAR16444.1"
FT   gene            complement(612431..613231)
FT                   /locus_tag="RB2501_06085"
FT   CDS_pept        complement(612431..613231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06085"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16445"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN7"
FT                   /protein_id="EAR16445.1"
FT   gene            613383..614045
FT                   /locus_tag="RB2501_06090"
FT   CDS_pept        613383..614045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06090"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16446"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN8"
FT                   /protein_id="EAR16446.1"
FT   gene            complement(614158..614889)
FT                   /locus_tag="RB2501_06095"
FT   CDS_pept        complement(614158..614889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06095"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16447"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHN9"
FT                   /protein_id="EAR16447.1"
FT   gene            615184..615327
FT                   /locus_tag="RB2501_06100"
FT   CDS_pept        615184..615327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16448"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP0"
FT                   /protein_id="EAR16448.1"
FT                   RI"
FT   gene            complement(615426..615812)
FT                   /locus_tag="RB2501_06105"
FT   CDS_pept        complement(615426..615812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06105"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16449"
FT                   /db_xref="GOA:A4CHP1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP1"
FT                   /protein_id="EAR16449.1"
FT   gene            complement(615948..616544)
FT                   /locus_tag="RB2501_06110"
FT   CDS_pept        complement(615948..616544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06110"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16450"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP2"
FT                   /protein_id="EAR16450.1"
FT   gene            616788..617888
FT                   /locus_tag="RB2501_06115"
FT   CDS_pept        616788..617888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06115"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16451"
FT                   /db_xref="GOA:A4CHP3"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP3"
FT                   /protein_id="EAR16451.1"
FT   gene            617959..618957
FT                   /locus_tag="RB2501_06120"
FT   CDS_pept        617959..618957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06120"
FT                   /product="M23 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16452"
FT                   /db_xref="GOA:A4CHP4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP4"
FT                   /protein_id="EAR16452.1"
FT   gene            complement(619000..620097)
FT                   /locus_tag="RB2501_06125"
FT   CDS_pept        complement(619000..620097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06125"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06125"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16453"
FT                   /db_xref="GOA:A4CHP5"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP5"
FT                   /protein_id="EAR16453.1"
FT   gene            620436..620627
FT                   /locus_tag="RB2501_06130"
FT   CDS_pept        620436..620627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16454"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP6"
FT                   /protein_id="EAR16454.1"
FT                   RYESDSVDAIEKRRANPL"
FT   gene            620762..621760
FT                   /locus_tag="RB2501_06135"
FT   CDS_pept        620762..621760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06135"
FT                   /product="M23 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06135"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16455"
FT                   /db_xref="GOA:A4CHP7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP7"
FT                   /protein_id="EAR16455.1"
FT   gene            622291..623184
FT                   /locus_tag="RB2501_06140"
FT   CDS_pept        622291..623184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06140"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06140"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16456"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP8"
FT                   /protein_id="EAR16456.1"
FT                   LGNDKAYEEIEKYCNN"
FT   gene            623246..623521
FT                   /locus_tag="RB2501_06145"
FT   CDS_pept        623246..623521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06145"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16457"
FT                   /db_xref="GOA:A4CHP9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHP9"
FT                   /protein_id="EAR16457.1"
FT   gene            623545..624219
FT                   /locus_tag="RB2501_06150"
FT   CDS_pept        623545..624219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06150"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06150"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16458"
FT                   /db_xref="GOA:A4CHQ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ0"
FT                   /protein_id="EAR16458.1"
FT                   VM"
FT   gene            624258..624368
FT                   /locus_tag="RB2501_06155"
FT   CDS_pept        624258..624368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06155"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16459"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ1"
FT                   /protein_id="EAR16459.1"
FT   gene            624365..624502
FT                   /locus_tag="RB2501_06160"
FT   CDS_pept        624365..624502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06160"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16460"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ2"
FT                   /protein_id="EAR16460.1"
FT                   "
FT   gene            complement(624519..627878)
FT                   /locus_tag="RB2501_06165"
FT   CDS_pept        complement(624519..627878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06165"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16461"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ3"
FT                   /protein_id="EAR16461.1"
FT                   AFCRFREMAIEY"
FT   gene            628629..629045
FT                   /locus_tag="RB2501_06170"
FT   CDS_pept        628629..629045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06170"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16462"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ4"
FT                   /protein_id="EAR16462.1"
FT   gene            629050..630018
FT                   /locus_tag="RB2501_06175"
FT   CDS_pept        629050..630018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06175"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16463"
FT                   /db_xref="GOA:A4CHQ5"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ5"
FT                   /protein_id="EAR16463.1"
FT   gene            630188..630934
FT                   /locus_tag="RB2501_06180"
FT   CDS_pept        630188..630934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06180"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16464"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ6"
FT                   /protein_id="EAR16464.1"
FT   gene            631046..631489
FT                   /locus_tag="RB2501_06185"
FT   CDS_pept        631046..631489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06185"
FT                   /product="predicted micrococcal nuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06185"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16465"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ7"
FT                   /protein_id="EAR16465.1"
FT   gene            complement(631490..631714)
FT                   /locus_tag="RB2501_06190"
FT   CDS_pept        complement(631490..631714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06190"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16466"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ8"
FT                   /protein_id="EAR16466.1"
FT   gene            complement(631788..632474)
FT                   /locus_tag="RB2501_06195"
FT   CDS_pept        complement(631788..632474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06195"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16467"
FT                   /db_xref="GOA:A4CHQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHQ9"
FT                   /protein_id="EAR16467.1"
FT                   PTYPNN"
FT   gene            632745..632906
FT                   /locus_tag="RB2501_06200"
FT   CDS_pept        632745..632906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06200"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16468"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR0"
FT                   /protein_id="EAR16468.1"
FT                   DDPDDGDN"
FT   gene            632944..634920
FT                   /locus_tag="RB2501_06205"
FT   CDS_pept        632944..634920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06205"
FT                   /product="Periplasmic Sensor Signal Transduction Histidine
FT                   Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06205"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16469"
FT                   /db_xref="GOA:A4CHR1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR1"
FT                   /protein_id="EAR16469.1"
FT   gene            634935..635600
FT                   /locus_tag="RB2501_06210"
FT   CDS_pept        634935..635600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06210"
FT                   /product="response regulator GacA"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06210"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16470"
FT                   /db_xref="GOA:A4CHR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR2"
FT                   /protein_id="EAR16470.1"
FT   gene            635612..635977
FT                   /locus_tag="RB2501_06215"
FT   CDS_pept        635612..635977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06215"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16471"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR3"
FT                   /protein_id="EAR16471.1"
FT                   WKYIQPYSDVLGCAPDF"
FT   gene            636033..636758
FT                   /locus_tag="RB2501_06220"
FT   CDS_pept        636033..636758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06220"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16472"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR4"
FT                   /protein_id="EAR16472.1"
FT   gene            637038..637418
FT                   /locus_tag="RB2501_06225"
FT   CDS_pept        637038..637418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06225"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16473"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR5"
FT                   /protein_id="EAR16473.1"
FT   gene            637539..638156
FT                   /locus_tag="RB2501_06230"
FT   CDS_pept        637539..638156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06230"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16474"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR6"
FT                   /protein_id="EAR16474.1"
FT   gene            complement(638318..639181)
FT                   /locus_tag="RB2501_06235"
FT   CDS_pept        complement(638318..639181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06235"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16475"
FT                   /db_xref="InterPro:IPR041650"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR7"
FT                   /protein_id="EAR16475.1"
FT                   ERLSIL"
FT   gene            639375..639755
FT                   /locus_tag="RB2501_06240"
FT   CDS_pept        639375..639755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06240"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16476"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR8"
FT                   /protein_id="EAR16476.1"
FT   gene            639769..640221
FT                   /locus_tag="RB2501_06245"
FT   CDS_pept        639769..640221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06245"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16477"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHR9"
FT                   /protein_id="EAR16477.1"
FT   gene            640346..641242
FT                   /locus_tag="RB2501_06250"
FT   CDS_pept        640346..641242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06250"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16478"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS0"
FT                   /protein_id="EAR16478.1"
FT                   AIRMNFLKRSYDYVLHS"
FT   gene            641220..644453
FT                   /locus_tag="RB2501_06255"
FT   CDS_pept        641220..644453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06255"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16479"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS1"
FT                   /protein_id="EAR16479.1"
FT   gene            644446..645573
FT                   /locus_tag="RB2501_06260"
FT   CDS_pept        644446..645573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06260"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06260"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16480"
FT                   /db_xref="GOA:A4CHS2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS2"
FT                   /protein_id="EAR16480.1"
FT   gene            complement(645566..647857)
FT                   /locus_tag="RB2501_06265"
FT   CDS_pept        complement(645566..647857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06265"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16481"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS3"
FT                   /protein_id="EAR16481.1"
FT                   GKTASWINFK"
FT   gene            complement(647896..648963)
FT                   /locus_tag="RB2501_06270"
FT   CDS_pept        complement(647896..648963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06270"
FT                   /product="IscS"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06270"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16482"
FT                   /db_xref="GOA:A4CHS4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS4"
FT                   /protein_id="EAR16482.1"
FT                   IPNFNVKSTFRISIA"
FT   gene            complement(649051..650388)
FT                   /locus_tag="RB2501_06275"
FT   CDS_pept        complement(649051..650388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06275"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16483"
FT                   /db_xref="GOA:A4CHS5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS5"
FT                   /protein_id="EAR16483.1"
FT   gene            complement(650567..651361)
FT                   /locus_tag="RB2501_06280"
FT   CDS_pept        complement(650567..651361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06280"
FT                   /product="probable secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16484"
FT                   /db_xref="GOA:A4CHS6"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS6"
FT                   /protein_id="EAR16484.1"
FT   gene            complement(651504..652247)
FT                   /locus_tag="RB2501_06285"
FT   CDS_pept        complement(651504..652247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06285"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16485"
FT                   /db_xref="GOA:A4CHS7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS7"
FT                   /protein_id="EAR16485.1"
FT   gene            652484..654181
FT                   /locus_tag="RB2501_06290"
FT   CDS_pept        652484..654181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06290"
FT                   /product="Serine protease / subtilase peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06290"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16486"
FT                   /db_xref="GOA:A4CHS8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS8"
FT                   /protein_id="EAR16486.1"
FT   gene            complement(654269..655417)
FT                   /locus_tag="RB2501_06295"
FT   CDS_pept        complement(654269..655417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06295"
FT                   /product="Peptidase family T4"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06295"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16487"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHS9"
FT                   /protein_id="EAR16487.1"
FT   gene            complement(655534..655806)
FT                   /locus_tag="RB2501_06300"
FT   CDS_pept        complement(655534..655806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06300"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16488"
FT                   /db_xref="InterPro:IPR025336"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT0"
FT                   /protein_id="EAR16488.1"
FT   gene            complement(656021..657268)
FT                   /locus_tag="RB2501_06305"
FT   CDS_pept        complement(656021..657268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06305"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16489"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT1"
FT                   /protein_id="EAR16489.1"
FT                   AIGDYANDNFLRPLPR"
FT   gene            657263..657451
FT                   /locus_tag="RB2501_06310"
FT   CDS_pept        657263..657451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06310"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16490"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT2"
FT                   /protein_id="EAR16490.1"
FT                   GNGPVAGNAGFRDENSF"
FT   gene            complement(657567..658391)
FT                   /locus_tag="RB2501_06315"
FT   CDS_pept        complement(657567..658391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06315"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16491"
FT                   /db_xref="GOA:A4CHT3"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT3"
FT                   /protein_id="EAR16491.1"
FT   gene            complement(658557..660161)
FT                   /locus_tag="RB2501_06320"
FT   CDS_pept        complement(658557..660161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06320"
FT                   /product="hypothetical beta-lactamase precursor
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06320"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16492"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT4"
FT                   /protein_id="EAR16492.1"
FT                   DPKVQQLDVSFEGENED"
FT   gene            complement(660187..660537)
FT                   /locus_tag="RB2501_06325"
FT   CDS_pept        complement(660187..660537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06325"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16493"
FT                   /db_xref="GOA:A4CHT5"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT5"
FT                   /protein_id="EAR16493.1"
FT                   VFIRLFIRRAPQ"
FT   gene            660762..661307
FT                   /locus_tag="RB2501_06330"
FT   CDS_pept        660762..661307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06330"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16494"
FT                   /db_xref="GOA:A4CHT6"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT6"
FT                   /protein_id="EAR16494.1"
FT                   EDISLKTKGFQLGVGYRF"
FT   gene            661474..664605
FT                   /locus_tag="RB2501_06335"
FT   CDS_pept        661474..664605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06335"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16495"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT7"
FT                   /protein_id="EAR16495.1"
FT   gene            664607..664771
FT                   /locus_tag="RB2501_06340"
FT   CDS_pept        664607..664771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16496"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT8"
FT                   /protein_id="EAR16496.1"
FT                   LSLFDIERA"
FT   gene            complement(664849..666162)
FT                   /locus_tag="RB2501_06345"
FT   CDS_pept        complement(664849..666162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06345"
FT                   /product="proline aminopeptidase P II"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06345"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16497"
FT                   /db_xref="GOA:A4CHT9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHT9"
FT                   /protein_id="EAR16497.1"
FT   gene            666464..669352
FT                   /locus_tag="RB2501_06350"
FT   CDS_pept        666464..669352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16498"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU0"
FT                   /protein_id="EAR16498.1"
FT   gene            669360..669749
FT                   /locus_tag="RB2501_06355"
FT   CDS_pept        669360..669749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06355"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16499"
FT                   /db_xref="GOA:A4CHU1"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU1"
FT                   /protein_id="EAR16499.1"
FT   gene            669930..670586
FT                   /locus_tag="RB2501_06360"
FT   CDS_pept        669930..670586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16500"
FT                   /db_xref="GOA:A4CHU2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU2"
FT                   /protein_id="EAR16500.1"
FT   gene            670722..671393
FT                   /locus_tag="RB2501_06365"
FT   CDS_pept        670722..671393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06365"
FT                   /product="Succinate dehydrogenase, cytochrome b558 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06365"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16501"
FT                   /db_xref="GOA:A4CHU3"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU3"
FT                   /protein_id="EAR16501.1"
FT                   S"
FT   gene            671395..673398
FT                   /locus_tag="RB2501_06370"
FT   CDS_pept        671395..673398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06370"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06370"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16502"
FT                   /db_xref="GOA:A4CHU4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU4"
FT                   /protein_id="EAR16502.1"
FT   gene            673438..674184
FT                   /locus_tag="RB2501_06375"
FT   CDS_pept        673438..674184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06375"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06375"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16503"
FT                   /db_xref="GOA:A4CHU5"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU5"
FT                   /protein_id="EAR16503.1"
FT   gene            674271..674411
FT                   /locus_tag="RB2501_06380"
FT   CDS_pept        674271..674411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16504"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU6"
FT                   /protein_id="EAR16504.1"
FT                   E"
FT   gene            674444..674989
FT                   /locus_tag="RB2501_06385"
FT   CDS_pept        674444..674989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06385"
FT                   /product="putative intracellular protease, PfpI family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06385"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16505"
FT                   /db_xref="GOA:A4CHU7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU7"
FT                   /protein_id="EAR16505.1"
FT                   NSKVIEEIREGKHEEQHA"
FT   gene            675052..676200
FT                   /locus_tag="RB2501_06390"
FT   CDS_pept        675052..676200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06390"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06390"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16506"
FT                   /db_xref="GOA:A4CHU8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU8"
FT                   /protein_id="EAR16506.1"
FT   gene            complement(676314..677225)
FT                   /locus_tag="RB2501_06395"
FT   CDS_pept        complement(676314..677225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06395"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16507"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHU9"
FT                   /protein_id="EAR16507.1"
FT   gene            complement(677250..677420)
FT                   /locus_tag="RB2501_06400"
FT   CDS_pept        complement(677250..677420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06400"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16508"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV0"
FT                   /protein_id="EAR16508.1"
FT                   GSRDLRRAILE"
FT   gene            complement(677477..678049)
FT                   /locus_tag="RB2501_06405"
FT   CDS_pept        complement(677477..678049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06405"
FT                   /product="Putative N-acetyltransferase, GNAT family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06405"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16509"
FT                   /db_xref="GOA:A4CHV1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV1"
FT                   /protein_id="EAR16509.1"
FT   gene            complement(678200..678307)
FT                   /locus_tag="RB2501_06410"
FT   CDS_pept        complement(678200..678307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06410"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16510"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV2"
FT                   /protein_id="EAR16510.1"
FT   gene            complement(678488..679141)
FT                   /locus_tag="RB2501_06415"
FT   CDS_pept        complement(678488..679141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06415"
FT                   /product="probable CoA transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16511"
FT                   /db_xref="GOA:A4CHV3"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV3"
FT                   /protein_id="EAR16511.1"
FT   gene            complement(679200..679562)
FT                   /locus_tag="RB2501_06420"
FT   CDS_pept        complement(679200..679562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16512"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV4"
FT                   /protein_id="EAR16512.1"
FT                   LVISKIIGTSKRNIYN"
FT   gene            complement(679681..680382)
FT                   /locus_tag="RB2501_06425"
FT   CDS_pept        complement(679681..680382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06425"
FT                   /product="3-oxoacid CoA-transferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16513"
FT                   /db_xref="GOA:A4CHV5"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV5"
FT                   /protein_id="EAR16513.1"
FT                   RIEQRTVRERG"
FT   gene            complement(680395..682758)
FT                   /locus_tag="RB2501_06430"
FT   CDS_pept        complement(680395..682758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06430"
FT                   /product="penicillin-binding protein 1A (PBP-1a)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06430"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16514"
FT                   /db_xref="GOA:A4CHV6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV6"
FT                   /protein_id="EAR16514.1"
FT   gene            complement(682767..683132)
FT                   /locus_tag="RB2501_06435"
FT   CDS_pept        complement(682767..683132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06435"
FT                   /product="putative gliding motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16515"
FT                   /db_xref="InterPro:IPR020018"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV7"
FT                   /protein_id="EAR16515.1"
FT                   QALPGVLDVGLQVEPNQ"
FT   gene            complement(683242..684279)
FT                   /locus_tag="RB2501_06440"
FT   CDS_pept        complement(683242..684279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16516"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV8"
FT                   /protein_id="EAR16516.1"
FT                   KARNA"
FT   gene            complement(684577..685665)
FT                   /locus_tag="RB2501_06445"
FT   CDS_pept        complement(684577..685665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06445"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16517"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHV9"
FT                   /protein_id="EAR16517.1"
FT   gene            complement(685738..685818)
FT                   /locus_tag="RB2501_06450"
FT   CDS_pept        complement(685738..685818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06450"
FT                   /product="recombinase A"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06450"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16518"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW0"
FT                   /protein_id="EAR16518.1"
FT                   /translation="MRLKKAVAHVAFRGTRKACLQIETFP"
FT   gene            686133..687140
FT                   /locus_tag="RB2501_06455"
FT   CDS_pept        686133..687140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06455"
FT                   /product="recombinase A"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06455"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16519"
FT                   /db_xref="GOA:A4CHW1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW1"
FT                   /protein_id="EAR16519.1"
FT   gene            687215..687640
FT                   /locus_tag="RB2501_06460"
FT   CDS_pept        687215..687640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06460"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16520"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW2"
FT                   /protein_id="EAR16520.1"
FT   gene            687685..688224
FT                   /locus_tag="RB2501_06465"
FT   CDS_pept        687685..688224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06465"
FT                   /product="putative RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06465"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16521"
FT                   /db_xref="GOA:A4CHW3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW3"
FT                   /protein_id="EAR16521.1"
FT                   RAILRDRIKNTKINIA"
FT   gene            688235..689776
FT                   /locus_tag="RB2501_06470"
FT   CDS_pept        688235..689776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06470"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16522"
FT                   /db_xref="GOA:A4CHW4"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW4"
FT                   /protein_id="EAR16522.1"
FT   gene            complement(689773..690522)
FT                   /locus_tag="RB2501_06475"
FT   CDS_pept        complement(689773..690522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06475"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06475"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16523"
FT                   /db_xref="GOA:A4CHW5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW5"
FT                   /protein_id="EAR16523.1"
FT   gene            690612..691580
FT                   /locus_tag="RB2501_06480"
FT   CDS_pept        690612..691580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06480"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16524"
FT                   /db_xref="GOA:A4CHW6"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW6"
FT                   /protein_id="EAR16524.1"
FT   gene            complement(691759..692997)
FT                   /locus_tag="RB2501_06485"
FT   CDS_pept        complement(691759..692997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06485"
FT                   /product="DNA processing protein DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16525"
FT                   /db_xref="GOA:A4CHW7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW7"
FT                   /protein_id="EAR16525.1"
FT                   VRSLPGKLFRWGA"
FT   gene            complement(692994..693083)
FT                   /locus_tag="RB2501_06490"
FT   CDS_pept        complement(692994..693083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06490"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16526"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW8"
FT                   /protein_id="EAR16526.1"
FT                   /translation="MLKFNIYTNGSRYLFINFFSWQVVNYSFK"
FT   gene            693094..694041
FT                   /locus_tag="RB2501_06495"
FT   CDS_pept        693094..694041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16527"
FT                   /db_xref="GOA:A4CHW9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR040495"
FT                   /db_xref="InterPro:IPR041268"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHW9"
FT                   /protein_id="EAR16527.1"
FT   gene            694122..694601
FT                   /locus_tag="RB2501_06500"
FT   CDS_pept        694122..694601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06500"
FT                   /product="thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06500"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16528"
FT                   /db_xref="GOA:A4CHX0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX0"
FT                   /protein_id="EAR16528.1"
FT   gene            complement(694692..695528)
FT                   /locus_tag="RB2501_06505"
FT   CDS_pept        complement(694692..695528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06505"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06505"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16529"
FT                   /db_xref="GOA:A4CHX1"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX1"
FT                   /protein_id="EAR16529.1"
FT   gene            complement(695538..696773)
FT                   /locus_tag="RB2501_06510"
FT   CDS_pept        complement(695538..696773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06510"
FT                   /product="putative exported peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06510"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16530"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX2"
FT                   /protein_id="EAR16530.1"
FT                   TRLNPEDWIYRL"
FT   gene            complement(696770..697543)
FT                   /locus_tag="RB2501_06515"
FT   CDS_pept        complement(696770..697543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06515"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06515"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16531"
FT                   /db_xref="GOA:A4CHX3"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX3"
FT                   /protein_id="EAR16531.1"
FT   gene            complement(697543..698505)
FT                   /locus_tag="RB2501_06520"
FT   CDS_pept        complement(697543..698505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16532"
FT                   /db_xref="GOA:A4CHX4"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX4"
FT                   /protein_id="EAR16532.1"
FT   gene            complement(698508..698942)
FT                   /locus_tag="RB2501_06525"
FT   CDS_pept        complement(698508..698942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06525"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16533"
FT                   /db_xref="GOA:A4CHX5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX5"
FT                   /protein_id="EAR16533.1"
FT   gene            complement(698939..700405)
FT                   /locus_tag="RB2501_06530"
FT   CDS_pept        complement(698939..700405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06530"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16534"
FT                   /db_xref="GOA:A4CHX6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX6"
FT                   /protein_id="EAR16534.1"
FT   gene            complement(700462..700974)
FT                   /locus_tag="RB2501_06535"
FT   CDS_pept        complement(700462..700974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06535"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16535"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX7"
FT                   /protein_id="EAR16535.1"
FT                   YPGKQRQ"
FT   gene            complement(701159..702019)
FT                   /locus_tag="RB2501_06540"
FT   CDS_pept        complement(701159..702019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06540"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16536"
FT                   /db_xref="GOA:A4CHX8"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX8"
FT                   /protein_id="EAR16536.1"
FT                   EALAG"
FT   gene            complement(702069..703649)
FT                   /locus_tag="RB2501_06545"
FT   CDS_pept        complement(702069..703649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06545"
FT                   /product="ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06545"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16537"
FT                   /db_xref="GOA:A4CHX9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHX9"
FT                   /protein_id="EAR16537.1"
FT                   RDLAAKYKA"
FT   gene            complement(703698..704234)
FT                   /locus_tag="RB2501_06550"
FT   CDS_pept        complement(703698..704234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06550"
FT                   /product="ATP synthase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06550"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16538"
FT                   /db_xref="GOA:A4CHY0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY0"
FT                   /protein_id="EAR16538.1"
FT                   LAHKLENLKRELVQK"
FT   gene            complement(704238..704738)
FT                   /locus_tag="RB2501_06555"
FT   CDS_pept        complement(704238..704738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06555"
FT                   /product="ATP synthase F0, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16539"
FT                   /db_xref="GOA:A4CHY1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY1"
FT                   /protein_id="EAR16539.1"
FT                   KLR"
FT   gene            complement(704819..705010)
FT                   /locus_tag="RB2501_06560"
FT   CDS_pept        complement(704819..705010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06560"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16540"
FT                   /db_xref="GOA:A4CHY2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY2"
FT                   /protein_id="EAR16540.1"
FT                   LIAAALIEGIGFAAIFAG"
FT   gene            complement(705057..706190)
FT                   /locus_tag="RB2501_06565"
FT   CDS_pept        complement(705057..706190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06565"
FT                   /product="ATP synthase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06565"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16541"
FT                   /db_xref="GOA:A4CHY3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY3"
FT                   /protein_id="EAR16541.1"
FT   gene            complement(706291..706701)
FT                   /locus_tag="RB2501_06570"
FT   CDS_pept        complement(706291..706701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16542"
FT                   /db_xref="GOA:A4CHY4"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY4"
FT                   /protein_id="EAR16542.1"
FT   gene            complement(706698..706853)
FT                   /locus_tag="RB2501_06575"
FT   CDS_pept        complement(706698..706853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06575"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16543"
FT                   /db_xref="GOA:A4CHY5"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY5"
FT                   /protein_id="EAR16543.1"
FT                   IKRLNP"
FT   gene            complement(706915..707385)
FT                   /locus_tag="RB2501_06580"
FT   CDS_pept        complement(706915..707385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16544"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY6"
FT                   /protein_id="EAR16544.1"
FT   gene            complement(707421..709976)
FT                   /locus_tag="RB2501_06585"
FT   CDS_pept        complement(707421..709976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06585"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16545"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY7"
FT                   /protein_id="EAR16545.1"
FT   gene            complement(710114..710863)
FT                   /locus_tag="RB2501_06590"
FT   CDS_pept        complement(710114..710863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06590"
FT                   /product="putative ATP-binding component of ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06590"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16546"
FT                   /db_xref="GOA:A4CHY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY8"
FT                   /protein_id="EAR16546.1"
FT   gene            complement(710892..712364)
FT                   /locus_tag="RB2501_06595"
FT   CDS_pept        complement(710892..712364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16547"
FT                   /db_xref="GOA:A4CHY9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHY9"
FT                   /protein_id="EAR16547.1"
FT   gene            712491..713540
FT                   /locus_tag="RB2501_06600"
FT   CDS_pept        712491..713540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06600"
FT                   /product="probable phenylacetic acid degradation NADH
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06600"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16548"
FT                   /db_xref="GOA:A4CHZ0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ0"
FT                   /protein_id="EAR16548.1"
FT                   ELTVDYDDV"
FT   gene            complement(713569..714354)
FT                   /locus_tag="RB2501_06605"
FT   CDS_pept        complement(713569..714354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06605"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16549"
FT                   /db_xref="GOA:A4CHZ1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ1"
FT                   /protein_id="EAR16549.1"
FT   gene            complement(714445..716064)
FT                   /locus_tag="RB2501_06610"
FT   CDS_pept        complement(714445..716064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06610"
FT                   /product="serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16550"
FT                   /db_xref="GOA:A4CHZ2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ2"
FT                   /protein_id="EAR16550.1"
FT   gene            716401..716736
FT                   /locus_tag="RB2501_06615"
FT   CDS_pept        716401..716736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06615"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06615"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16551"
FT                   /db_xref="GOA:A4CHZ3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR026445"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ3"
FT                   /protein_id="EAR16551.1"
FT                   KYDKLSM"
FT   gene            716771..717826
FT                   /locus_tag="RB2501_06620"
FT   CDS_pept        716771..717826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16552"
FT                   /db_xref="GOA:A4CHZ4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024521"
FT                   /db_xref="InterPro:IPR026351"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ4"
FT                   /protein_id="EAR16552.1"
FT                   GAGSSCQGSVA"
FT   gene            718024..718638
FT                   /locus_tag="RB2501_06625"
FT   CDS_pept        718024..718638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06625"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16553"
FT                   /db_xref="GOA:A4CHZ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ5"
FT                   /protein_id="EAR16553.1"
FT   gene            complement(718602..719657)
FT                   /locus_tag="RB2501_06630"
FT   CDS_pept        complement(718602..719657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06630"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16554"
FT                   /db_xref="GOA:A4CHZ6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ6"
FT                   /protein_id="EAR16554.1"
FT                   QASTTGESERK"
FT   gene            complement(719704..720309)
FT                   /locus_tag="RB2501_06635"
FT   CDS_pept        complement(719704..720309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06635"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16555"
FT                   /db_xref="InterPro:IPR025350"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ7"
FT                   /protein_id="EAR16555.1"
FT   gene            complement(720406..721344)
FT                   /locus_tag="RB2501_06640"
FT   CDS_pept        complement(720406..721344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06640"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16556"
FT                   /db_xref="GOA:A4CHZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ8"
FT                   /protein_id="EAR16556.1"
FT   gene            721384..721605
FT                   /locus_tag="RB2501_06645"
FT   CDS_pept        721384..721605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06645"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16557"
FT                   /db_xref="GOA:A4CHZ9"
FT                   /db_xref="UniProtKB/TrEMBL:A4CHZ9"
FT                   /protein_id="EAR16557.1"
FT   gene            complement(721612..722886)
FT                   /locus_tag="RB2501_06650"
FT   CDS_pept        complement(721612..722886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06650"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16558"
FT                   /db_xref="GOA:A4CI00"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI00"
FT                   /protein_id="EAR16558.1"
FT   gene            complement(723120..724058)
FT                   /locus_tag="RB2501_06655"
FT   CDS_pept        complement(723120..724058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06655"
FT                   /product="UDP-glucuronate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06655"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16559"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI01"
FT                   /protein_id="EAR16559.1"
FT   gene            complement(724187..725488)
FT                   /locus_tag="RB2501_06660"
FT   CDS_pept        complement(724187..725488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06660"
FT                   /product="probable nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06660"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16560"
FT                   /db_xref="GOA:A4CI02"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI02"
FT                   /protein_id="EAR16560.1"
FT   gene            complement(725718..727076)
FT                   /locus_tag="RB2501_06665"
FT   CDS_pept        complement(725718..727076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06665"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16561"
FT                   /db_xref="GOA:A4CI03"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI03"
FT                   /protein_id="EAR16561.1"
FT   gene            complement(727150..727887)
FT                   /locus_tag="RB2501_06670"
FT   CDS_pept        complement(727150..727887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06670"
FT                   /product="Glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16562"
FT                   /db_xref="GOA:A4CI04"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI04"
FT                   /protein_id="EAR16562.1"
FT   gene            complement(727892..729031)
FT                   /locus_tag="RB2501_06675"
FT   CDS_pept        complement(727892..729031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06675"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06675"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16563"
FT                   /db_xref="GOA:A4CI05"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI05"
FT                   /protein_id="EAR16563.1"
FT   gene            complement(729009..730244)
FT                   /locus_tag="RB2501_06680"
FT   CDS_pept        complement(729009..730244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06680"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16564"
FT                   /db_xref="GOA:A4CI06"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI06"
FT                   /protein_id="EAR16564.1"
FT                   FKFSAYERSSDT"
FT   gene            complement(730241..731569)
FT                   /locus_tag="RB2501_06685"
FT   CDS_pept        complement(730241..731569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06685"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16565"
FT                   /db_xref="GOA:A4CI07"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI07"
FT                   /protein_id="EAR16565.1"
FT   gene            complement(731563..732390)
FT                   /locus_tag="RB2501_06690"
FT   CDS_pept        complement(731563..732390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16566"
FT                   /db_xref="GOA:A4CI08"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI08"
FT                   /protein_id="EAR16566.1"
FT   gene            complement(732394..733191)
FT                   /locus_tag="RB2501_06695"
FT   CDS_pept        complement(732394..733191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06695"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16567"
FT                   /db_xref="GOA:A4CI09"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI09"
FT                   /protein_id="EAR16567.1"
FT   gene            complement(733292..734641)
FT                   /locus_tag="RB2501_06700"
FT   CDS_pept        complement(733292..734641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06700"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16568"
FT                   /db_xref="GOA:A4CI10"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI10"
FT                   /protein_id="EAR16568.1"
FT   gene            complement(734681..735196)
FT                   /locus_tag="RB2501_06705"
FT   CDS_pept        complement(734681..735196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06705"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16569"
FT                   /db_xref="GOA:A4CI11"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI11"
FT                   /protein_id="EAR16569.1"
FT                   DSIPIRIR"
FT   gene            complement(735201..736163)
FT                   /locus_tag="RB2501_06710"
FT   CDS_pept        complement(735201..736163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06710"
FT                   /product="GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06710"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16570"
FT                   /db_xref="GOA:A4CI12"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI12"
FT                   /protein_id="EAR16570.1"
FT   gene            complement(736160..737275)
FT                   /locus_tag="RB2501_06715"
FT   CDS_pept        complement(736160..737275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06715"
FT                   /product="GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16571"
FT                   /db_xref="GOA:A4CI13"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI13"
FT                   /protein_id="EAR16571.1"
FT   gene            complement(737297..738073)
FT                   /locus_tag="RB2501_06720"
FT   CDS_pept        complement(737297..738073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06720"
FT                   /product="spore coat polysaccharide synthesis
FT                   (dTDP-4-dehydrorhamnose reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16572"
FT                   /db_xref="GOA:A4CI14"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI14"
FT                   /protein_id="EAR16572.1"
FT   gene            complement(738073..738537)
FT                   /locus_tag="RB2501_06725"
FT   CDS_pept        complement(738073..738537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06725"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16573"
FT                   /db_xref="GOA:A4CI15"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI15"
FT                   /protein_id="EAR16573.1"
FT   gene            complement(738628..739494)
FT                   /locus_tag="RB2501_06730"
FT   CDS_pept        complement(738628..739494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06730"
FT                   /product="DTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06730"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16574"
FT                   /db_xref="GOA:A4CI16"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI16"
FT                   /protein_id="EAR16574.1"
FT                   LSLIQHT"
FT   gene            complement(739491..740522)
FT                   /locus_tag="RB2501_06735"
FT   CDS_pept        complement(739491..740522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06735"
FT                   /product="dTDP-glucose 4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06735"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16575"
FT                   /db_xref="GOA:A4CI17"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI17"
FT                   /protein_id="EAR16575.1"
FT                   KKL"
FT   gene            complement(740519..741520)
FT                   /locus_tag="RB2501_06740"
FT   CDS_pept        complement(740519..741520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16576"
FT                   /db_xref="GOA:A4CI18"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI18"
FT                   /protein_id="EAR16576.1"
FT   gene            complement(741527..743194)
FT                   /locus_tag="RB2501_06745"
FT   CDS_pept        complement(741527..743194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06745"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16577"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI19"
FT                   /protein_id="EAR16577.1"
FT   gene            complement(743250..744746)
FT                   /locus_tag="RB2501_06750"
FT   CDS_pept        complement(743250..744746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06750"
FT                   /product="putative auxin-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06750"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16578"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI20"
FT                   /protein_id="EAR16578.1"
FT   gene            complement(744752..745621)
FT                   /locus_tag="RB2501_06755"
FT   CDS_pept        complement(744752..745621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06755"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06755"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16579"
FT                   /db_xref="GOA:A4CI21"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI21"
FT                   /protein_id="EAR16579.1"
FT                   PLNYIDFN"
FT   gene            745731..745913
FT                   /locus_tag="RB2501_06760"
FT   CDS_pept        745731..745913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06760"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16580"
FT                   /db_xref="GOA:A4CI22"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI22"
FT                   /protein_id="EAR16580.1"
FT                   KDASREDEKLDEKKD"
FT   gene            746310..748808
FT                   /locus_tag="RB2501_06765"
FT   CDS_pept        746310..748808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06765"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06765"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16581"
FT                   /db_xref="GOA:A4CI23"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI23"
FT                   /protein_id="EAR16581.1"
FT   gene            748856..749026
FT                   /locus_tag="RB2501_06770"
FT   CDS_pept        748856..749026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16582"
FT                   /db_xref="GOA:A4CI24"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI24"
FT                   /protein_id="EAR16582.1"
FT                   IYRVATGFAFD"
FT   gene            749220..749390
FT                   /locus_tag="RB2501_06775"
FT   CDS_pept        749220..749390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06775"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16583"
FT                   /db_xref="GOA:A4CI25"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI25"
FT                   /protein_id="EAR16583.1"
FT                   IFRVSTGYAFD"
FT   gene            complement(749482..750495)
FT                   /locus_tag="RB2501_06780"
FT   CDS_pept        complement(749482..750495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2501_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RB2501_06780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR16584"
FT                   /db_xref="InterPro:IPR032286"
FT                   /db_xref="UniProtKB/TrEMBL:A4CI26"
FT                   /protein_id="EAR16584.1"