(data stored in ACNUC7421 zone)

EMBL: CP001715

ID   CP001715; SV 1; circular; genomic DNA; STD; PRO; 5058518 BP.
XX
AC   CP001715;
XX
PR   Project:PRJNA29435;
XX
DT   03-SEP-2009 (Rel. 102, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Candidatus Accumulibacter phosphatis clade IIA str. UW-1 chromosome,
DE   complete genome.
XX
KW   .
XX
OS   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Candidatus Accumulibacter.
XX
RN   [1]
RP   1-5058518
RG   US DOE Joint Genome Institute
RA   Martin H.G., Ivanova N., Kunin V., Warnecke F., Barry K., He S.,
RA   Salamov A., Szeto E., Dalin E., Pangilinan J.L., Lapidus A., Lowry S.,
RA   Kyrpides N.C., McMahon K.D., Hugenholtz P.;
RT   "Complete sequence of chromosome of Candidatus Accumulibacter phosphatis
RT   clade IIA str. UW-1";
RL   Unpublished.
XX
RN   [2]
RP   1-5058518
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Barry K., Pitluck S., Lowry S., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., McMahon K.D., Hugenholtz P.;
RT   ;
RL   Submitted (27-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d44e33e88898896a08fc525ba11f6e87.
DR   BioSample; SAMN02598465.
DR   EnsemblGenomes-Gn; CAP2UW1_R0001.
DR   EnsemblGenomes-Gn; CAP2UW1_R0002.
DR   EnsemblGenomes-Gn; CAP2UW1_R0003.
DR   EnsemblGenomes-Gn; CAP2UW1_R0004.
DR   EnsemblGenomes-Gn; CAP2UW1_R0005.
DR   EnsemblGenomes-Gn; CAP2UW1_R0006.
DR   EnsemblGenomes-Gn; CAP2UW1_R0007.
DR   EnsemblGenomes-Gn; CAP2UW1_R0008.
DR   EnsemblGenomes-Gn; CAP2UW1_R0009.
DR   EnsemblGenomes-Gn; CAP2UW1_R0010.
DR   EnsemblGenomes-Gn; CAP2UW1_R0011.
DR   EnsemblGenomes-Gn; CAP2UW1_R0012.
DR   EnsemblGenomes-Gn; CAP2UW1_R0013.
DR   EnsemblGenomes-Gn; CAP2UW1_R0014.
DR   EnsemblGenomes-Gn; CAP2UW1_R0015.
DR   EnsemblGenomes-Gn; CAP2UW1_R0016.
DR   EnsemblGenomes-Gn; CAP2UW1_R0017.
DR   EnsemblGenomes-Gn; CAP2UW1_R0018.
DR   EnsemblGenomes-Gn; CAP2UW1_R0019.
DR   EnsemblGenomes-Gn; CAP2UW1_R0020.
DR   EnsemblGenomes-Gn; CAP2UW1_R0021.
DR   EnsemblGenomes-Gn; CAP2UW1_R0022.
DR   EnsemblGenomes-Gn; CAP2UW1_R0023.
DR   EnsemblGenomes-Gn; CAP2UW1_R0024.
DR   EnsemblGenomes-Gn; CAP2UW1_R0025.
DR   EnsemblGenomes-Gn; CAP2UW1_R0026.
DR   EnsemblGenomes-Gn; CAP2UW1_R0027.
DR   EnsemblGenomes-Gn; CAP2UW1_R0028.
DR   EnsemblGenomes-Gn; CAP2UW1_R0029.
DR   EnsemblGenomes-Gn; CAP2UW1_R0030.
DR   EnsemblGenomes-Gn; CAP2UW1_R0031.
DR   EnsemblGenomes-Gn; CAP2UW1_R0032.
DR   EnsemblGenomes-Gn; CAP2UW1_R0033.
DR   EnsemblGenomes-Gn; CAP2UW1_R0034.
DR   EnsemblGenomes-Gn; CAP2UW1_R0035.
DR   EnsemblGenomes-Gn; CAP2UW1_R0036.
DR   EnsemblGenomes-Gn; CAP2UW1_R0037.
DR   EnsemblGenomes-Gn; CAP2UW1_R0038.
DR   EnsemblGenomes-Gn; CAP2UW1_R0039.
DR   EnsemblGenomes-Gn; CAP2UW1_R0040.
DR   EnsemblGenomes-Gn; CAP2UW1_R0041.
DR   EnsemblGenomes-Gn; CAP2UW1_R0042.
DR   EnsemblGenomes-Gn; CAP2UW1_R0043.
DR   EnsemblGenomes-Gn; CAP2UW1_R0044.
DR   EnsemblGenomes-Gn; CAP2UW1_R0045.
DR   EnsemblGenomes-Gn; CAP2UW1_R0046.
DR   EnsemblGenomes-Gn; CAP2UW1_R0047.
DR   EnsemblGenomes-Gn; CAP2UW1_R0048.
DR   EnsemblGenomes-Gn; CAP2UW1_R0049.
DR   EnsemblGenomes-Gn; CAP2UW1_R0050.
DR   EnsemblGenomes-Gn; CAP2UW1_R0051.
DR   EnsemblGenomes-Gn; CAP2UW1_R0052.
DR   EnsemblGenomes-Gn; CAP2UW1_R0053.
DR   EnsemblGenomes-Gn; CAP2UW1_R0054.
DR   EnsemblGenomes-Gn; CAP2UW1_R0055.
DR   EnsemblGenomes-Gn; CAP2UW1_R0056.
DR   EnsemblGenomes-Gn; CAP2UW1_R0057.
DR   EnsemblGenomes-Gn; CAP2UW1_R0058.
DR   EnsemblGenomes-Gn; EBG00001268070.
DR   EnsemblGenomes-Gn; EBG00001268071.
DR   EnsemblGenomes-Gn; EBG00001268072.
DR   EnsemblGenomes-Gn; EBG00001268073.
DR   EnsemblGenomes-Gn; EBG00001268074.
DR   EnsemblGenomes-Gn; EBG00001268075.
DR   EnsemblGenomes-Gn; EBG00001268076.
DR   EnsemblGenomes-Gn; EBG00001268077.
DR   EnsemblGenomes-Gn; EBG00001268078.
DR   EnsemblGenomes-Gn; EBG00001268079.
DR   EnsemblGenomes-Gn; EBG00001268080.
DR   EnsemblGenomes-Gn; EBG00001268081.
DR   EnsemblGenomes-Gn; EBG00001268082.
DR   EnsemblGenomes-Gn; EBG00001268083.
DR   EnsemblGenomes-Gn; EBG00001268084.
DR   EnsemblGenomes-Gn; EBG00001268085.
DR   EnsemblGenomes-Gn; EBG00001268086.
DR   EnsemblGenomes-Gn; EBG00001268087.
DR   EnsemblGenomes-Gn; EBG00001268088.
DR   EnsemblGenomes-Gn; EBG00001268089.
DR   EnsemblGenomes-Gn; EBG00001268090.
DR   EnsemblGenomes-Gn; EBG00001268091.
DR   EnsemblGenomes-Gn; EBG00001268092.
DR   EnsemblGenomes-Gn; EBG00001268093.
DR   EnsemblGenomes-Gn; EBG00001268094.
DR   EnsemblGenomes-Gn; EBG00001268095.
DR   EnsemblGenomes-Gn; EBG00001268096.
DR   EnsemblGenomes-Gn; EBG00001268097.
DR   EnsemblGenomes-Gn; EBG00001268098.
DR   EnsemblGenomes-Gn; EBG00001268099.
DR   EnsemblGenomes-Gn; EBG00001268100.
DR   EnsemblGenomes-Gn; EBG00001268101.
DR   EnsemblGenomes-Gn; EBG00001268102.
DR   EnsemblGenomes-Gn; EBG00001268103.
DR   EnsemblGenomes-Gn; EBG00001268104.
DR   EnsemblGenomes-Gn; EBG00001268105.
DR   EnsemblGenomes-Gn; EBG00001268106.
DR   EnsemblGenomes-Gn; EBG00001268107.
DR   EnsemblGenomes-Gn; EBG00001268108.
DR   EnsemblGenomes-Gn; EBG00001268109.
DR   EnsemblGenomes-Gn; EBG00001268110.
DR   EnsemblGenomes-Gn; EBG00001268111.
DR   EnsemblGenomes-Gn; EBG00001268112.
DR   EnsemblGenomes-Gn; EBG00001268113.
DR   EnsemblGenomes-Gn; EBG00001268114.
DR   EnsemblGenomes-Gn; EBG00001268115.
DR   EnsemblGenomes-Gn; EBG00001268116.
DR   EnsemblGenomes-Gn; EBG00001268117.
DR   EnsemblGenomes-Gn; EBG00001268118.
DR   EnsemblGenomes-Gn; EBG00001268119.
DR   EnsemblGenomes-Gn; EBG00001268120.
DR   EnsemblGenomes-Gn; EBG00001268121.
DR   EnsemblGenomes-Gn; EBG00001268122.
DR   EnsemblGenomes-Gn; EBG00001268123.
DR   EnsemblGenomes-Gn; EBG00001268124.
DR   EnsemblGenomes-Gn; EBG00001268125.
DR   EnsemblGenomes-Gn; EBG00001268126.
DR   EnsemblGenomes-Gn; EBG00001268127.
DR   EnsemblGenomes-Gn; EBG00001268128.
DR   EnsemblGenomes-Gn; EBG00001268129.
DR   EnsemblGenomes-Gn; EBG00001268130.
DR   EnsemblGenomes-Gn; EBG00001268131.
DR   EnsemblGenomes-Gn; EBG00001268132.
DR   EnsemblGenomes-Tr; CAP2UW1_R0001-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0002-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0003-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0004-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0005-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0006-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0007-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0008-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0009-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0010-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0011-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0012-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0013-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0014-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0015-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0016-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0017-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0018-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0019-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0020-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0021-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0022-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0023-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0024-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0025-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0026-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0027-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0028-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0029-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0030-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0031-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0032-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0033-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0034-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0035-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0036-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0037-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0038-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0039-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0040-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0041-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0042-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0043-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0044-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0045-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0046-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0047-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0048-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0049-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0050-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0051-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0052-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0053-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0054-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0055-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0056-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0057-1.
DR   EnsemblGenomes-Tr; CAP2UW1_R0058-1.
DR   EnsemblGenomes-Tr; EBT00001800059.
DR   EnsemblGenomes-Tr; EBT00001800060.
DR   EnsemblGenomes-Tr; EBT00001800061.
DR   EnsemblGenomes-Tr; EBT00001800062.
DR   EnsemblGenomes-Tr; EBT00001800063.
DR   EnsemblGenomes-Tr; EBT00001800064.
DR   EnsemblGenomes-Tr; EBT00001800065.
DR   EnsemblGenomes-Tr; EBT00001800066.
DR   EnsemblGenomes-Tr; EBT00001800067.
DR   EnsemblGenomes-Tr; EBT00001800068.
DR   EnsemblGenomes-Tr; EBT00001800069.
DR   EnsemblGenomes-Tr; EBT00001800070.
DR   EnsemblGenomes-Tr; EBT00001800071.
DR   EnsemblGenomes-Tr; EBT00001800072.
DR   EnsemblGenomes-Tr; EBT00001800073.
DR   EnsemblGenomes-Tr; EBT00001800074.
DR   EnsemblGenomes-Tr; EBT00001800075.
DR   EnsemblGenomes-Tr; EBT00001800076.
DR   EnsemblGenomes-Tr; EBT00001800077.
DR   EnsemblGenomes-Tr; EBT00001800078.
DR   EnsemblGenomes-Tr; EBT00001800079.
DR   EnsemblGenomes-Tr; EBT00001800080.
DR   EnsemblGenomes-Tr; EBT00001800081.
DR   EnsemblGenomes-Tr; EBT00001800082.
DR   EnsemblGenomes-Tr; EBT00001800083.
DR   EnsemblGenomes-Tr; EBT00001800084.
DR   EnsemblGenomes-Tr; EBT00001800085.
DR   EnsemblGenomes-Tr; EBT00001800086.
DR   EnsemblGenomes-Tr; EBT00001800087.
DR   EnsemblGenomes-Tr; EBT00001800088.
DR   EnsemblGenomes-Tr; EBT00001800089.
DR   EnsemblGenomes-Tr; EBT00001800090.
DR   EnsemblGenomes-Tr; EBT00001800091.
DR   EnsemblGenomes-Tr; EBT00001800092.
DR   EnsemblGenomes-Tr; EBT00001800093.
DR   EnsemblGenomes-Tr; EBT00001800094.
DR   EnsemblGenomes-Tr; EBT00001800095.
DR   EnsemblGenomes-Tr; EBT00001800096.
DR   EnsemblGenomes-Tr; EBT00001800097.
DR   EnsemblGenomes-Tr; EBT00001800098.
DR   EnsemblGenomes-Tr; EBT00001800099.
DR   EnsemblGenomes-Tr; EBT00001800100.
DR   EnsemblGenomes-Tr; EBT00001800101.
DR   EnsemblGenomes-Tr; EBT00001800102.
DR   EnsemblGenomes-Tr; EBT00001800103.
DR   EnsemblGenomes-Tr; EBT00001800104.
DR   EnsemblGenomes-Tr; EBT00001800105.
DR   EnsemblGenomes-Tr; EBT00001800106.
DR   EnsemblGenomes-Tr; EBT00001800107.
DR   EnsemblGenomes-Tr; EBT00001800108.
DR   EnsemblGenomes-Tr; EBT00001800109.
DR   EnsemblGenomes-Tr; EBT00001800110.
DR   EnsemblGenomes-Tr; EBT00001800111.
DR   EnsemblGenomes-Tr; EBT00001800112.
DR   EnsemblGenomes-Tr; EBT00001800113.
DR   EnsemblGenomes-Tr; EBT00001800114.
DR   EnsemblGenomes-Tr; EBT00001800115.
DR   EnsemblGenomes-Tr; EBT00001800116.
DR   EnsemblGenomes-Tr; EBT00001800117.
DR   EnsemblGenomes-Tr; EBT00001800118.
DR   EnsemblGenomes-Tr; EBT00001800119.
DR   EnsemblGenomes-Tr; EBT00001800120.
DR   EnsemblGenomes-Tr; EBT00001800121.
DR   EuropePMC; PMC2918947; 20601516.
DR   EuropePMC; PMC3001079; 20716518.
DR   EuropePMC; PMC3473371; 22923697.
DR   EuropePMC; PMC3834850; 23887171.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001715.
DR   SILVA-SSU; CP001715.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635729
CC   Source DNA available from Katherine D. McMahon
CC   (tmcmahon@cae.wisc.edu)
CC   Contacts: Katherine D. McMahon (tmcmahon@cae.wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Candidatus Accumulibacter phosphatis Type
CC                            IIA UW-1
CC   GOLD Stamp ID         :: Gi03328
CC   Isolation Site        :: enhanced biological phosphorus removal
CC                            (EBPR) wastewater treatment bioreactor
CC   Collection Date       :: 6/30/2004
CC   Isolation Country     :: USA
CC   Latitude              :: 43.078418
CC   Longitude             :: -89.386482
CC   Altitude              :: elevation: 263m
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sediment, Sludge
CC   Phenotypes            :: EBPR, Polyphosphate-accumulating
CC   Energy Source         :: Chemoheterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5058518
FT                   /organism="Candidatus Accumulibacter phosphatis clade IIA
FT                   str. UW-1"
FT                   /strain="UW-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:522306"
FT   gene            239..1660
FT                   /locus_tag="CAP2UW1_0001"
FT   CDS_pept        239..1660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: dar:Daro_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33376"
FT                   /db_xref="GOA:C7RIB6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIB6"
FT                   /protein_id="ACV33376.1"
FT                   /translation="MSSFWSSCLSQFEQELPPQQFNTWIRPLRLEGEEDFARGLRLLAP
FT                   NGFILKWVKERYLARIEELGSEYFAAPVGITLTLGGRAAPPKDLAPDSPSKDSPSGDGK
FT                   TAAKVNAVNRHTSLLKNGSLVDRDRPSYEKTRLIPTFTFENLIVGKANDLARAASRQVA
FT                   ISPGEATYNPLFIYGGAGLGKTHLIHAIGNHILECFPDRIVRYVHAEDYYSDVVRAYQQ
FT                   KSFDVFKRYYRSLDVLLLDDVHFFNGKNRTQEEFFFVFNALSEAKKQLVISSDTYPKNI
FT                   SGLEDRLVTRFDWGLTVQIEPPETEMRVAILKKKAELEGVLLDDEVAFYVAKHLRSNVR
FT                   ELEGALKKVLAYSAFHGREIALDLAKEALKDVIGSVNRQITVDNIQKTVADYFKIKVAD
FT                   LFSKKRTRVIVRPRQIAMWLTKNLTSQSYPSIGEAFGGRDHTTVLHAVRTIDDLRAKDN
FT                   ELNHDVHVLLQVLKG"
FT   gene            1869..2999
FT                   /locus_tag="CAP2UW1_0002"
FT   CDS_pept        1869..2999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dar:Daro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33377"
FT                   /db_xref="GOA:C7RIB7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIB7"
FT                   /protein_id="ACV33377.1"
FT                   /translation="MLLIKTRRDTLLGPLQAVSGIVERRHTLPILSNVLLEKRGDVLTL
FT                   LATDIEIQITTWSTGAVGEGDGAVTVGARKLQEILRSLPESADVSLILDDKRLQLTAGK
FT                   SRFSLQTLPADDFPCMALSEGETKKFTVSQKQFRHLLAQTQYSMAAQDVRYYLNGLLLI
FT                   VDGSELRAVATDGHRLAYSSMPLDDAAQAPREPGAARQELIVPRKTVLELSRLLTDTDE
FT                   PLSIEMLATQIRFQFGHVSLVSKLIDGRFPDYERVIPATLRNVVSVSRGLLLQSMIRAA
FT                   ILTNEKFRGVRLILSAGSLKIMAANAEQEEAQEEIEVEYNGEPLDVGFNVAYLLDVLNN
FT                   TVDDTIEWGFNDANSSALLTIPGNDRFKYVVMPMRI"
FT   gene            3062..5530
FT                   /locus_tag="CAP2UW1_0003"
FT   CDS_pept        3062..5530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: azo:azo0003 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33378"
FT                   /db_xref="GOA:C7RIB8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIB8"
FT                   /protein_id="ACV33378.1"
FT                   /translation="MIEENEESAYDESSIQQLEGLEAVRKRPGMYIGDTSDGTGLHHMV
FT                   FEVVDNAIDEALAGHCDEIVITIHADNSISVTDNGRGIPTGIKFDDKHEPRRSAAEIVM
FT                   CVLHAGGKFNQNSYKVSGGLHGVGVSCVNALSRWLRLIIRREGKKYLLEFNRGTVVDRL
FT                   LEVQKGVEVSPLRVVAATEKRGTELHFMADEEIFGQIEFHYEIIAKRLRELSFLNNGVK
FT                   IRLNDQRTGKEEDFAFLGGVRGFVEYINRTKSVLHPNIFYASGDSAGGNGVISVEVAMQ
FT                   WNDSYAEQVLCFTNNIPQADGGTHMTGLRAAMTRVINRYIEENEIAKKAKVDITGDDMR
FT                   EGLACVLSVKMPDPKFASQTKMKLVSSEARPAVEEVVAAKLSEYLQERPVDAKVITGKI
FT                   IEAARARDAARKAREMTRRKGLLDGVGLPGKLADCQEKDPALCELYLVEGDSAGGSAKQ
FT                   GRDRKFQAILPLKGKILNVEKARFDKLISSQEIATLITALGTGIGKDEYKPEKLRYHRL
FT                   IIMTDADVDGAHIRTLLLTFFYRQMPELVESGHIYIAQPPLYKVKHGKTERYIKDDQAL
FT                   KQFLLTLALEGAVLIPVAGAPEISGSTLEQLARQYLLAEAVINRLSHLINPEVLHALID
FT                   ANLAIDLADEASAMASADALMKAVGSKLDINIVARFDTAQERWQLRLEKILHGNLKLGV
FT                   IDDDLLVSGDYAQLRKTAEMLAGLFGPGGVVVRAEKKQAVSSFAETMQWLLSEVERSVS
FT                   KQRYKGLGEMNPEQLWETTMDPKVRRLLKVQIEDAIGADEIFTTLMGELVEPRRNFIET
FT                   NALAARNIDV"
FT   gene            complement(5543..6364)
FT                   /locus_tag="CAP2UW1_0004"
FT   CDS_pept        complement(5543..6364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0004"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: azo:azo3659
FT                   orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33379"
FT                   /db_xref="GOA:C7RIB9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIB9"
FT                   /protein_id="ACV33379.1"
FT                   /translation="MNFIHALRAAWRGRNSLLCVGLDPDPARFPAHLQQSPNAILDFCR
FT                   TIVDATADLVCCFKPQIAYFAAHRAEDQLEALIDHIHQRHPATPVILDAKRGDIGSTAE
FT                   QYAIEAFERFKADAITVNPYLGRDSVEPYLAYQDKGIILLCRTSNPGGNDLQFLDVGGE
FT                   KLYERVARLVNEEWNQNGQCALVVGATYPNEIARVRGLTGEMPLLVPGIGAQGGDIEST
FT                   VRAGCTSAGYGLMINSSRAILYAGSGEDYADAARRVALATRADINRYRPLV"
FT   gene            6533..7168
FT                   /locus_tag="CAP2UW1_0005"
FT   CDS_pept        6533..7168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33380"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC0"
FT                   /protein_id="ACV33380.1"
FT                   /translation="MLSRRGDSVKKLDNDAFVNMRSGASVLEADSYGDKVLLLADGTIV
FT                   KLFRRKRWLSSAAWYPYAKRFADNAASLRRLGIRVPEILDLFRIPSIERDAVRYQPLPG
FT                   RTLREIRREALDAGIEQELKEAFTRFVVSLHDSGVYFRSLHLGNVVYTPDHEFGLIDIS
FT                   DARIVDRPLRKYERARNLKRLQGIEGESEWVDLTSVVDAHRKRREARV"
FT   gene            complement(7183..7329)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0006"
FT   gene            complement(7353..8054)
FT                   /locus_tag="CAP2UW1_0007"
FT   CDS_pept        complement(7353..8054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0007"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: dar:Daro_4042 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33381"
FT                   /db_xref="GOA:C7RIC1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC1"
FT                   /protein_id="ACV33381.1"
FT                   /translation="MDNKPTSSGGKPAVVLLSGGLDSATTLAIARADGFACHCLSIDYG
FT                   QRHRAELAAAALLAEALGAREHRQLRLTLEVFGGSALTDERIAVPVDGVHSGIPITYVP
FT                   ARNTVMLSLALAWAEVLGSRDIFVGVNAVDYSGYPDCRPEYIAAYEKMANLATRAAVQG
FT                   ASLTIHAPLMGLGKAEIIQRGITLGVDYGLTVSCYQADRDGRACGVCDSCRLRRAGFSA
FT                   AGMADPTRYAG"
FT   gene            8309..9679
FT                   /locus_tag="CAP2UW1_0008"
FT   CDS_pept        8309..9679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0008"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: nmu:Nmul_A0008
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33382"
FT                   /db_xref="GOA:C7RIC2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC2"
FT                   /protein_id="ACV33382.1"
FT                   /translation="MPPANHRQPPFFLTGTANPLVRLVMLRRIEVLMQAIVLVLAVTWL
FT                   GIPLEVVPMSALIALLAAVNLITQWRLDKGAPVSENEILLHLAFDAGILGLLLYFAGGS
FT                   ANPFVSLFLLPPTLAAAMLPARHAWAMAAITLAAYTSLIFWNLPLPSPRGDLAELDALL
FT                   ARATAGGEHAGHSNSFALHVLGMWLNFVISVGVVVFFLTRMAAALKDRERQLAAAREAT
FT                   LRNEQILALGTLAAGAAHQLGTPLGTMAIVIRELQLSHENDPEIREDLTLLREQVDRCK
FT                   QTISQILASTGQSRDESLRSMTLDAYLHRLLDEWQIIRPHALLSVALQGTQPAPLIAAD
FT                   RTLEQAILNLLDNAADANGASQEALRFAANWDGETCRIEILDCGPGLNVDAAERLGDMY
FT                   FSTKAITPERPGGIGIGLFLSNATVERFGGKVELFNRTDRRGGACTRVTLPMSRLKA"
FT   gene            9685..10251
FT                   /locus_tag="CAP2UW1_0009"
FT   CDS_pept        9685..10251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0009"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: psa:PST_1004 probable two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33383"
FT                   /db_xref="GOA:C7RIC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC3"
FT                   /protein_id="ACV33383.1"
FT                   /translation="MPERNLKQPDDERSTLLLVDDDDAFRRVLARALERRGYAVSVAAS
FT                   VEAALVKAQAQAPEYAVVDLKMPGESGLRLIDKLMELDPNTRIVMLTGYASIATAIEAI
FT                   KLGAVHYLAKPCDADEIVAALNKSSEGDAAMAVADSPLSIDRLEWEHIQRILGEHQGNV
FT                   SATARALKMHRRTLQRKLGKRPSRE"
FT   gene            10254..10658
FT                   /locus_tag="CAP2UW1_0010"
FT   CDS_pept        10254..10658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0010"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   tbd:Tbd_0509 RNA-binding S4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33384"
FT                   /db_xref="GOA:C7RIC4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC4"
FT                   /protein_id="ACV33384.1"
FT                   /translation="MTTSGHPAIEYIRIDKWLWTARFYKTRSLAAQAIAAGHVRLAGHP
FT                   VKPARDLRCGDSLEIAIGDTIWSVVVRGLNEQRRPAVEAQQLYEETRASSERRATQRET
FT                   RLLAPVPGSDLRGRPTKKARRQIRGFNEGF"
FT   gene            10666..11022
FT                   /locus_tag="CAP2UW1_0011"
FT   CDS_pept        10666..11022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33385"
FT                   /db_xref="GOA:C7RIC5"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC5"
FT                   /protein_id="ACV33385.1"
FT                   /translation="MVNRLLADGIVVLHFLFIAFVVLGGVLARRWPRLAWVHLPAACWG
FT                   AAIELSGWICPLTPLENRFRQAAGEAGYAGSFIDHYLLPILYPVGLTREIQYGLAAVVI
FT                   VVNVAVYGCLLRRR"
FT   gene            complement(11079..12407)
FT                   /locus_tag="CAP2UW1_0012"
FT   CDS_pept        complement(11079..12407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0012"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: cvi:CV_0231 probable hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33386"
FT                   /db_xref="GOA:C7RIC6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC6"
FT                   /protein_id="ACV33386.1"
FT                   /translation="MDIVLLLFLILLNGVLAMSEIAVVSSRQSRLQKLADDGNRGARSA
FT                   LALSHEPSIFLSTVQVGITTVGILNGAIGETALAVPLAERLAAWPLLAPHAEGISLTVV
FT                   VAGLTYFSVVVGELVPKRLGLLSPERVASVIAPPMNLLARLARPLVWLLSSSSNLFLRL
FT                   LGARRTQESSVTDDEIKVLMGQGAQSGVFHASEQAIVANVLRLDEQRISAIMTHRKDIY
FT                   LLDLNESEEEIRERLAESPYKRVVVCRDGPDQIVGVLRTSDLLKGALAGEPLSIEPFVR
FT                   PALYVPAGVTTTQLLETFRRARQQCALMVDEYGELQGLVTLSDVLTAIVGDLPTSETPE
FT                   EQDIVIREDGSWLVDGSVPVERVKGFLTISGDWPGEDENAFNTLGGFIMYALGRIPSAS
FT                   DHFELADWRFEVVDMDGNRVDKVLIAKREHGSETAASAHVSAR"
FT   sig_peptide     complement(12348..12407)
FT                   /locus_tag="CAP2UW1_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.470 at
FT                   residue 20"
FT   gene            complement(12457..13248)
FT                   /locus_tag="CAP2UW1_0013"
FT   CDS_pept        complement(12457..13248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0013"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: eba:ebA234 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I; PFAM:
FT                   dehydroquinase class I"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33387"
FT                   /db_xref="GOA:C7RIC7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC7"
FT                   /protein_id="ACV33387.1"
FT                   /translation="MGDLGMSKGIDVRGQPLAGGKEPLICTPLVARDEPSILREVAVVC
FT                   AKCPDLIEWRVDFFAGIADSARVVALAREIRKQAGSVPIIFTRRSTREGGEPIGIEEEQ
FT                   VLSLYRAVCETGCVDFVDYEINNEPQHFQAARQAAHHSGAQLIASFHDFQQTPPAAEIV
FT                   AKLVTMEEAGADIAKVAVTPRAIDDVLTLLGATLAGSRQLRLPIISVSMGPYGSLSRLF
FT                   GWTFGSSVTFAVGDKASAPGQVAIEDLRIVLDILRRSLAGK"
FT   gene            complement(13249..14010)
FT                   /locus_tag="CAP2UW1_0014"
FT   CDS_pept        complement(13249..14010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0014"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   pol:Bpro_3668 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33388"
FT                   /db_xref="GOA:C7RIC8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC8"
FT                   /protein_id="ACV33388.1"
FT                   /translation="MDVMSLLASPQAWLAFATLTALELVLGIDNIIFISILVDRLPPAT
FT                   REKARKLGLFLAMFLRIALLLLLSVIVGATAPLFSAFGQAISPRDLILIGGGVFLIWKS
FT                   TQEIHQLLEGQEGHASTAVRATFSAIILQIIVIDIVFSLDSIITAVGMVDEVAVMIAAV
FT                   VASVGLMMLFAAAIGRFVSGHPTIKMLALSFLMVVGVALVAEGFGHKVPKGYIYFAMAF
FT                   SVTVEMLNIRLRRKSVPPVHLHQPYTRRESD"
FT   gene            14455..15138
FT                   /locus_tag="CAP2UW1_0015"
FT   CDS_pept        14455..15138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0015"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   dar:Daro_3533 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33389"
FT                   /db_xref="GOA:C7RIC9"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIC9"
FT                   /protein_id="ACV33389.1"
FT                   /translation="MSATISLKSITGRRTDATLSFIQHSMMIVGLMLLLGAVKPLFGGR
FT                   SDTDAQQAAEVATVSEAAEAEPVKAAPEALPPHLQRVLDFVSRRYRVAPEALVPVFEAA
FT                   QTVGRERRVDPLLIIAIIGIESRFNPFAESAFGAKGLMQVIPGYHMDKVPQGAGEQPFL
FT                   DPVTNIQVGVHVLEEAIRWRGGLTAGLQHYGGAPDDPETGYANKVLAEKQRLEQAARRG
FT                   PGARV"
FT   gene            complement(15192..17663)
FT                   /locus_tag="CAP2UW1_0016"
FT   CDS_pept        complement(15192..17663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0016"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   hch:HCH_05086 glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33390"
FT                   /db_xref="GOA:C7RID0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID0"
FT                   /protein_id="ACV33390.1"
FT                   /translation="MAEFFKVSDWFIPLARRLLYLWVRTTVFPASVQELGLDPGKPVCY
FT                   VLQDRHLSNLLVLFEESRQAGLPRAEAPMAIGGQRLPRSFFFLNRDRRLAGRARDGGAH
FT                   SPLLASLLGQAVADPQVDVQLVPVLILWGRSPDQQDSILKALFSETWRPPGAWRQLLAI
FT                   LLHGRHVLVRYNAPISLRELLQGGLAEEPALRKLSRVLRVHFRRQRQMAIGPDLSHRNT
FT                   QVNAVLAGEQVRLAIASEAATQGISPAEARARAARFALEISSDYSYGVVRALELFLNWL
FT                   WTRLYDGIELHNFDVVSRIAAGHEIVYVPCHRSHIDYLLLSYIIHRQGLTPPHIAAGAN
FT                   LNLPLVGSLLRRGGAFFLRRSFKGEPLYAAVFHEYLHLMLARGFPIEYFIEGGRSRSGR
FT                   MLAPKAGILGMTVQSFIREHVRPLVFLPVYIGYEKVMEGRTYLDELAGQPKQRESLWGL
FT                   FMSVRSIKRVFGKVHVNFGAPLALAGFLDVQQPGWRDEPAETLSHWSRRATRHAAAELA
FT                   KRINEAAVLNPVNLVALSLLATPKHTADEHALQRMIEHYQALSSLAPYAPTTIGCALDP
FT                   QQVVGYAERLTLVERFRDPLGDLIRAPREQAPLLAYFRNNVLHLFALPAVIACLVSHNR
FT                   DLDAARVAQAVAGICSLMRAELFLRWSGDELAAASEAIIRVLLARALLRHPEAEGRLAA
FT                   PEPISQEFVELRLLGETIRPLLERHFLTLALLERHGSGHLTRPALEDNCHRLAQRLSLL
FT                   YEFNTPEFPEKVTFAAFIGNLIEGEFLHETEDGLLHFDERLLTPLAHSELVLSVEARQA
FT                   IRRMARAGVAA"
FT   gene            complement(17696..19744)
FT                   /locus_tag="CAP2UW1_0017"
FT   CDS_pept        complement(17696..19744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0017"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain protein; protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; KEGG:
FT                   rfr:Rfer_1382 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33391"
FT                   /db_xref="GOA:C7RID1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID1"
FT                   /protein_id="ACV33391.1"
FT                   /translation="MGQTATSNLRTVALVGHGASGKTTLAESLLAAAGAIASRGAVEKG
FT                   NTVCDFDPQEKEFGHSLSSALASFSWQGVLVHLIDTPGFPDFAGQAIGALAAADTALVV
FT                   INAQNGIELSSERMMKLAEARGVCRMIVINKIDADNVNLPALVGEIRERFGRECMLLDL
FT                   PAKHGSEVVELLGHDAGESDFESVAAAHRALIDQIVEEDEDLLARYLEEGVDPSPDELH
FT                   VPFEKALRAGHLIPILFVSAKTGAGIPQLLDVLARLAPNPHEGNPPPFYRGEPGGPAEA
FT                   FAAVPDPHKHVLAHVFKVVSDPFIGKVGVFRVHQGTIRKDSQLFVGDGKRPFKVGHIYR
FT                   LQGKEYVEVESLAPGDLGAIAKVDEIEFDCVLHDSHDEDQIHLKPLEFPQPMQGLAVQA
FT                   RRKADEQRLFEILRKLEVEDPCFRLERHPTTNETVIRGLGEMHLRAKLNRLSQQYKLEL
FT                   DTKPPQIAYREAITGSAEGHCRHKKQSGGAGQFGEVALRVEPLERGAGFEFVDIVKGGV
FT                   IPGVFMAAVEKGVRQALADGVVAGFPVEDLRVTVHDGKSHPVDGKDIAFFTAARKATVE
FT                   AIRGAKPIILEPVVDIEILAPEAMTGDLTGDLSSKRGHLTGTQPRGPGVMAITGEVPLA
FT                   ELDGYQSRLKSLTGGQGSYSIAFSHYAQVPPATQQHLASQHKVVEEE"
FT   gene            19993..22290
FT                   /locus_tag="CAP2UW1_0018"
FT   CDS_pept        19993..22290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0018"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   dar:Daro_3943 malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33392"
FT                   /db_xref="GOA:C7RID2"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID2"
FT                   /protein_id="ACV33392.1"
FT                   /translation="MENDQPDQRQADLREAALEYHRYPTAGKISVQPTKALSNQLDLAL
FT                   AYSPGVAYACHAIVDDPGSVSLYSSRANLVGVITNGTAVLGLGNIGPLAAKPVMEGKGC
FT                   LFKKFAGIDVFDIELAESDPDRLIDMIAAMEPTLGGINLEDIKAPECFYIEAKLKERMS
FT                   IPVFHDDQHGTAIISAAAILNALKVTGKPIGDVTVVCSGAGAAAISCLNLWCDLGFRRE
FT                   NIVVCDSKGVIYVGRDADMEPTKARYARETGVRTLAEALVGADVFLGLSAAGILQPEML
FT                   ATMAEQPIVFALANPTPEIMPELAREVRPDVIMATGRSDYPNQVNNVLCFPFIFRGALD
FT                   VGATGINEQMKMACVKALAAMAHQEVSDEVAMAYPGQELSFGPEYLIPKPFDPRLITTI
FT                   APAVAEAAMLSGIATRPLGDLTAYREKLREFVYRTGVGMRAVFSAAKRGRKTRIVYPDG
FT                   EEERMLRAAQTILDEGLTRPILIGRPDVIASRLERIGSKLRVGKDFELVDPNSDGRYKE
FT                   CWTAYHQLRKRQGVTIDIAKTRLRNNNTIIAAMLLRLGYADGMICGLSGRFGHHLRQVD
FT                   EIIGKAPGCNTMAAMTHLLLPGRALFLCDTHVNADPDTNQLVEIALMAADAVRRFKIKP
FT                   KVALLSHSNFGSSQTPSARKMAEAVAIIRARAPELAIDGEMHGDSALSQAIRRQADPES
FT                   PLVGEANVLVMPNLDAANISHHLLKMTGGDGMAVGPILLGAARPVHVLSPTSTVRRVVD
FT                   MTALVVVDAATK"
FT   gene            22372..22447
FT                   /locus_tag="CAP2UW1_R0001"
FT                   /note="tRNA-Ala1"
FT   tRNA            22372..22447
FT                   /locus_tag="CAP2UW1_R0001"
FT                   /product="tRNA-Ala"
FT   gene            22473..22548
FT                   /locus_tag="CAP2UW1_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            22473..22548
FT                   /locus_tag="CAP2UW1_R0002"
FT                   /product="tRNA-Glu"
FT   gene            23173..24732
FT                   /locus_tag="CAP2UW1_0019"
FT   CDS_pept        23173..24732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0019"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rru:Rru_A0873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33393"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID3"
FT                   /protein_id="ACV33393.1"
FT                   /translation="MKKFGLSLIALSLLPIPGWGNDIGAEVQSAAAPKTPAIKTITNFT
FT                   QSLRCMDELLYAYGKQGIAITSTGIPDETGKVKTGTKEMLITAVSKMTVKSNAFDFIDF
FT                   HSGADDLGALFAARGDQNRLMPDYYIRGSITQMDDNSVRKNKGVGFSLPFLDLGVSKDD
FT                   AYDLISMDLSIGDAATRKIIPITSTSNTLVLMKGGISGEGGGKIGKVGLSFNIDVSRSE
FT                   GVGAATRTLVELGLIETLGKFTQVPYWKCLDTDLTNPLIREQAREWFDNAKENDRILFV
FT                   QRKLAGMGRYDGPLNGAMNATLKTSISEYQAASGLIADGTINFDLYASLLDNLQNQIAA
FT                   LPAAGGPKSNYVPGVSPASRPPAVTQVVATPAAGPMNAPNPIFKMKLDTDRGSKPAYRV
FT                   GDFLNLTLSMNTQGTAYCYYQDVSATTARIFPNQFRSDSSVPAGAGVRIPSGGFKIRFD
FT                   RPGPERVACIGSDRELVIPGSLRGARDLSPLPVKSVDEVIGQYKQNNPSAVVSMVDITV
FT                   SQ"
FT   sig_peptide     23173..23235
FT                   /locus_tag="CAP2UW1_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.973 at
FT                   residue 21"
FT   gene            24971..25246
FT                   /locus_tag="CAP2UW1_0020"
FT   CDS_pept        24971..25246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33394"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID4"
FT                   /protein_id="ACV33394.1"
FT                   /translation="MNSPNVVIINGVNNGVGGNDWSATGSPAANSAAHNKRRATENRVF
FT                   LGDDAPTPAVVVVPSGQNAAPYYGSPAEESASRNAARANAYRQRND"
FT   gene            25285..25611
FT                   /locus_tag="CAP2UW1_0021"
FT   CDS_pept        25285..25611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33395"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID5"
FT                   /protein_id="ACV33395.1"
FT                   /translation="MRFPAAVFLFGFSQLTAAQVSIDLPGVSVKTGAGSSVSKSGNTVA
FT                   NEKGVISPDADVEGVVIINDALSIDGVPIARGVTEYVSKKTRKVYSIRWGKKGEGVTVT
FT                   EKTR"
FT   sig_peptide     25285..25341
FT                   /locus_tag="CAP2UW1_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.602 at
FT                   residue 19"
FT   gene            25654..26559
FT                   /locus_tag="CAP2UW1_0022"
FT   CDS_pept        25654..26559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_2861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33396"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID6"
FT                   /protein_id="ACV33396.1"
FT                   /translation="MRLPQFVNRVVLVLGLAAGLLGSAFVGAFEVKEGDLKTIFYAKTD
FT                   VPVVWRYTPNSEVMILDMPGLELLGRTFNRVTQLTEQQYTEAYPRVLTSQELSRYIGNA
FT                   HRTFANFAAGHDLRISDLVQFFNLADRDKVELFPEEYALRDFLLQQGLIKEWRGFYQAQ
FT                   KPHSIILSIPQVQDRRGNEPALTSQARYAILLHELSHAEFHTNAAYNKYCRGFWASGLT
FT                   ESQREAFRKFLAGMRYSVENEELVINEMQAYLVFTPDAGAFSAARLGVSESSLAGMREA
FT                   FVRGRPPVQLPLRVKAGELP"
FT   sig_peptide     25654..25740
FT                   /locus_tag="CAP2UW1_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 29"
FT   gene            26556..26867
FT                   /locus_tag="CAP2UW1_0023"
FT   CDS_pept        26556..26867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33397"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID7"
FT                   /protein_id="ACV33397.1"
FT                   /translation="MSKRFSMGWCAVFLVGAGIPLSCLAQKTTRIQGNTEINASSNNTT
FT                   AVAVGSNVVAKNRVGVVQGDKKGNTRINVSTSNVTTVVSGRNKKACTNIGAIVSDECK"
FT   sig_peptide     26556..26633
FT                   /locus_tag="CAP2UW1_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            26854..27159
FT                   /locus_tag="CAP2UW1_0024"
FT   CDS_pept        26854..27159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33398"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID8"
FT                   /protein_id="ACV33398.1"
FT                   /translation="MNASKPILAQYLVAAIFCATTGVASAVQNLNASSQTKVNNAMAKA
FT                   WQKGGNPNDPALQKRVVNIGSKKAGTCDVNVGTVQPGQRAPKDIVVTTKEVINVCK"
FT   sig_peptide     26854..26934
FT                   /locus_tag="CAP2UW1_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.885 at
FT                   residue 27"
FT   gene            27168..27776
FT                   /locus_tag="CAP2UW1_0025"
FT   CDS_pept        27168..27776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0025"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rru:Rru_A0870
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33399"
FT                   /db_xref="GOA:C7RID9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7RID9"
FT                   /protein_id="ACV33399.1"
FT                   /translation="MKTNLYRVALVAAFVTLTGGATVLPAAAADDETSSLDELRRAMTE
FT                   PSEAPKKKRTRAIVFDGDSAQAPASAAPAAAGGALDCAALPPDVRATAVQFPIQFRPGS
FT                   ANITPASGNTLIEIAKILSLTPDRCIIVEGHTDAEGNADRNMALSRDRANSVVKFISDK
FT                   GAVERRRLVPVGKGSTDPLKDLDPRDSRNRRVVFKVVAG"
FT   sig_peptide     27168..27254
FT                   /locus_tag="CAP2UW1_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 29"
FT   gene            27825..28115
FT                   /locus_tag="CAP2UW1_0026"
FT   CDS_pept        27825..28115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33400"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIE0"
FT                   /protein_id="ACV33400.1"
FT                   /translation="MRTISTLIIAAAFAASPAFAQKTEVKGKTEIDAKQENVAAVAIGK
FT                   DNTAKNTAGAIKGDTKVQGNTKIKAEQKNAAAVAIGKGNTAANEAGVIGGK"
FT   sig_peptide     27825..27887
FT                   /locus_tag="CAP2UW1_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            28440..28934
FT                   /locus_tag="CAP2UW1_0027"
FT   CDS_pept        28440..28934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33401"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIR5"
FT                   /protein_id="ACV33401.1"
FT                   /translation="MFRTGMHNTIPVTVAKGVFCLFLLHTGTARAAEPGAPGAPIWGAQ
FT                   VKVSRGVVSIERDGQRYPGIVGARLKEKDVIQTGGNGSVGIMFNDNSTLSLGPDAEVLL
FT                   QRYAYDSTTYMGAFDAYIKRGTVSVQAGNIAKQAPEAMRMVTPKAEVTGTAKNYVVSVG
FT                   E"
FT   sig_peptide     28440..28535
FT                   /locus_tag="CAP2UW1_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.982 at
FT                   residue 32"
FT   gene            28938..29534
FT                   /locus_tag="CAP2UW1_0028"
FT   CDS_pept        28938..29534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0028"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: dar:Daro_3597
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33402"
FT                   /db_xref="GOA:C7RIR6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIR6"
FT                   /protein_id="ACV33402.1"
FT                   /translation="MKRLAITLALSLMTTACAHRDTYVLLPDGSGQAPGALTIKPAEGG
FT                   NALKLDQPYQTARSTMGGGLEAGRTDEQEVRKRYGAAIDASPPPLVRFTLYFLEGSDEL
FT                   TAASKTELVAILAEIKARPVPDIVIVGHTDRVGMVADNDRLALRRADSFRKKLLQQGIA
FT                   DEAIQTAGRGEREPLVNTPDETPEPRNRRVEILVR"
FT   sig_peptide     28938..28994
FT                   /locus_tag="CAP2UW1_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            29557..32550
FT                   /locus_tag="CAP2UW1_0029"
FT   CDS_pept        29557..32550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0029"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: WD-40 repeat protein; peptidase C14 caspase
FT                   catalytic subunit p20; KEGG: glo:Glov_1608 peptidase C14
FT                   caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33403"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIR7"
FT                   /protein_id="ACV33403.1"
FT                   /translation="MITRVLHALVLFGLVVGQLVGGEAQGQVSVEPILRIETGGHQSLV
FT                   TRVSTDAQGRWVLTASEDKTARLWDAATGKLLSVLRPPIGPEGVGAIYAAALSPDGKQI
FT                   ALGGNAAFDGKTHSLYLFDRASGRLPAKSTLSGLEAPLTQLAWSKDSQLVAVGLRQSGL
FT                   RVFQRNLGFVGSDPEYNEAIYGADFSTDGRLVTCSLDGSVRLYRVDKKGLVRTARKQLA
FT                   SGRPYSVAFSPDGSLIAVGYQDAGHIDVLDAASLTPVYATPSSKEGNLGRVAWTGDGRV
FT                   LIGAGTARANERFAVFAFGDAGRGPARELAGFTNIVTALAPLRDGVIVATAEPSWASFD
FT                   AAGNRRLLARPQTGDFRDAGDRFKVSVDAQLVSFPTIPGGESLVFDLVKGDLRRPGSEA
FT                   KVEPPRQPGWGGGPSNWKNSTTPKLGSRQLQLRPGEVSRSVALSPDKQRFVLGTEWYLR
FT                   AFDSEGSQVWEQRTPAAVWATNISGDGRWVLAALGDGTVRWYRMQDGREQLSLFVHVDG
FT                   KRWIIWSPAGFYDTSLDGEDLVGWHLNRAMNQASDFFSVGRFRDRFYRPEIIQSIIQTG
FT                   DEGEAIRQAQAAAAALAATEPPALPATAGASKGAGSLPPRPAVAVEKTAVATVLPPVID
FT                   LQTESQIESSASTVPVRFVLRSPSDAPVSEVKVRVNDKLVRSLDNRALRSARGEAQEVQ
FT                   VAVPPVDSQIRLFAANKYGKSEPVVINIRRSAAPSGKVAETRFETLYLLIIGVSKYPEE
FT                   WKLDLAEKDARDFNHHMVRQAGQLYGTAQPRLLINEQASREKILEGLRWLRESVGEKDA
FT                   GVVFMAGHGDRVGSAYYFIPGDPDVLPSRSEFKSTQEFDAWKQKNAPKRWVPGEEISRT
FT                   LLGLKGRAAFFIDTCHSGINARPGQSTNPDLTKALNEINEERGVIVFASSTGKELSQED
FT                   PAWGNGAFTKAIIEGIRGGADFRKDGLIRPSTLQSYVTDRVMELTKKEQRPVIFTVGID
FT                   EPIAVRGQ"
FT   sig_peptide     29557..29622
FT                   /locus_tag="CAP2UW1_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.333 at
FT                   residue 22"
FT   gene            32575..33258
FT                   /locus_tag="CAP2UW1_0030"
FT   CDS_pept        32575..33258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0030"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG:
FT                   bur:Bcep18194_C6770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33404"
FT                   /db_xref="GOA:C7RIR8"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIR8"
FT                   /protein_id="ACV33404.1"
FT                   /translation="MTNSRFTLRRSAAALASVILVTACATNPDGSTRMDDRATGALIGA
FT                   AAGCAVGAAVNGGKGCLVGAAAGAAVGFLIGWYFESKKIASANDVNAEYKKKKGQVVPK
FT                   DDVKPAKFDTVVKPGVPEKDGQREVQVTSNTDLIGYGDKAPEVTQKYAIYDENNKLVEE
FT                   KSERVAAVDGAGRYQTDSKFKLPASAKGKKYTVKTSLVANNQTYKENSYKVSVLDDGFM
FT                   IAMAN"
FT   sig_peptide     32575..32652
FT                   /locus_tag="CAP2UW1_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.875 at
FT                   residue 26"
FT   misc_binding    33502..33601
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 45.16"
FT   gene            33698..35614
FT                   /locus_tag="CAP2UW1_0031"
FT   CDS_pept        33698..35614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0031"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   dar:Daro_3921 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33405"
FT                   /db_xref="GOA:C7RIR9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIR9"
FT                   /protein_id="ACV33405.1"
FT                   /translation="MNANDKFIATDAHVDQAAIKPLPNSRKVYVTGSRPDIRVPMREIS
FT                   QSDTDTAFGGEKNPPIYVYDCSGPYSDPLAKIDIRQGLPALRARWIAERGDSEPLADLS
FT                   SDFGRVRAADRALDEMRFPGLQRRPQRARAGANVSQMHYARRGIITPEMEYVAIRENNN
FT                   RRTYVEQLRASGPQGARLAEILCRQHRGQSFGASLPEEVVPDFVRSEVARGRAIIPCNI
FT                   NHPESEPMIIGRNFLTKINANIGNSALGSSIQEEVEKMTWAIRWGGDTVMDLSTGKNIH
FT                   ETREWIIRNSPVPIGTVPIYQALEKVDGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGV
FT                   LLRYVPLTAKRLTGIVSRGGSIMAKWCLAHHKESFLYTHFEEICEIMKAYDVAFSLGDG
FT                   LRPGSIYDANDEAQLGELKTLGELTEVAWRHDVQVMIEGPGHVPMHMIKENMDLQLDSC
FT                   REAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPDKDDVKEG
FT                   IITYKLAAHAADLAKGHSGAQIRDNALSKARFEFRWEDQFNLGLDPEKAREFHDETLPK
FT                   DSAKVAHFCSMCGPHFCSMKITQEVRDFAVAQGLTASEALTRGMEVKAVEFVKAGAEVY
FT                   HKL"
FT   gene            35676..38537
FT                   /locus_tag="CAP2UW1_0032"
FT   CDS_pept        35676..38537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33406"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS0"
FT                   /protein_id="ACV33406.1"
FT                   /translation="MDRQDLAEWSCELDDEEFVVALAALGVLAASGRARELASAVDARA
FT                   REGETPSLVAATRDLSSRFVALDAAGDGLLNWRAPPRRMGRGGGLAKWPPAPVLLMAWG
FT                   DYLAQVAKWRRPGLAGGPRLAVHDGKRQPGRTLSFAQALASPGAGLASVFVADMFAADG
FT                   RTNWRWPFTVASLVDDPLAPELAVALGGGLPAGSPYRFVTVERSDAEVEVLVVGASLGQ
FT                   ALARVLTRDIRLRCCVVIVCGFAQDSPAEAAPLLRSLVSRLAAEGVAVVGAVSEVRELV
FT                   ACVGKFAAGLAANQPIDLALCSAFGGKVLPLLNQDLLALARPERSLDALSHRLRCLPPE
FT                   MRLDLAAESAQQLGVAEKEFAPRARGGRSGGGELGTVRGVPVGAGSLSDLAAQLRAAEA
FT                   QIPNSRYVQQKSFRRIRDRFVAERRGYVVGEPVRVRVLIGPRKAGVSAAPSAFPEDKLE
FT                   RDRSTHRLQLVLHEPQQFATPLLGEILLPRDGDSSEAQFVFTPRAPGDFAARLTVLHRG
FT                   RVLQTVMLCTRVVERAELLAGLRGGIRLEDESRLRQDWSDLGARRRFDMALVFNHTAAE
FT                   QPRLTGVAGQRAWATDLSSIEEPVRSINDLISAVASKVADHEEGLDQGDNPALLVQLAR
FT                   IGADVYSKLYLDQLQQLTAGGLDVGSDAVTHIQVVSTRSDALVPIEFFYDLPPPDADAQ
FT                   VCRQHLQALRDGRCPANCEGAGAPARHVCPMGFWGLKKVIERHFYSAVLGKPDGAELVI
FT                   QAEPTAQRNRLDVRTGALLGYSREVSAEEVQALLETMKGALGGEVGVAEDWAEWKQQVA
FT                   GGPGLLLAFPHNEGRKQDVRLEIGGSFLSTLRLPAEYVRAPGAPAPLVFLLGCDTSSTA
FT                   EDYASHVRYFRQAGAAAVVSTIATVFGRHAVIVGEKIVARLLGAGGEQRLGEIIRDAKR
FT                   EAMRESVPMALCVVAFGDADWRL"
FT   gene            38558..39709
FT                   /locus_tag="CAP2UW1_0033"
FT   CDS_pept        38558..39709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33407"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS1"
FT                   /protein_id="ACV33407.1"
FT                   /translation="MAGEFMRIEMLAALHGDCLLVEYGDVRRTRRILIDSGPVGAYEAL
FT                   RGRIERLPKGDRRFELMVLSHVDTDHIEGLIKLFANPRPWPFVVKDVWFNGWRHLEQAH
FT                   GLLGGRQGEFFSALLAKRLDEGCWNGAFKGQAVVVGDAGALPEHVLPGGLKLTLLSPTL
FT                   AKLERMREAWRKDLGDALDPGDLEAAWALLGQQKKYLPGKGLLGSSAQLDSLIEKQSRP
FT                   DDAAANGSSIAFLAEYAGNAGMAASGNEMPGGKSRSCLFLADAHPDAICASVKRLLQAR
FT                   GLARLRVDAVKVAHHGSKANTTDELMSLIESPRFLFSTNGQQFGHPDEEAVGRVIGRSS
FT                   HPSPTLYFNYLSEHNRVWQERQEQFGYKAVFNDGSGSPMVIAL"
FT   gene            complement(39686..40495)
FT                   /locus_tag="CAP2UW1_0034"
FT   CDS_pept        complement(39686..40495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0034"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   dar:Daro_0043 cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33408"
FT                   /db_xref="GOA:C7RIS2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS2"
FT                   /protein_id="ACV33408.1"
FT                   /translation="MARTQPTATSASQWLNVISILTLLCLSAATPRAAEVALDVGHTLS
FT                   QPGATSARGRPEFAFNAALARRLAAELQARGLAVRPINFDGAIDSLVTRPLQAAGADFF
FT                   LSIHHDSVHADLLQEWRWQGKVQTYTDQYAGFALFVSHDNPDLHTSLSCASAIGARLRR
FT                   TGFLAATHHAEPLAGKPRQPADAANAVYYYDNLVVLYRTTLPAVLFEAGVIKHRAEELA
FT                   LLDPQRQTRMADAIATGIAACLYPCATARRDSPAAGGASASQCNDHR"
FT   sig_peptide     complement(40394..40495)
FT                   /locus_tag="CAP2UW1_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.649 at
FT                   residue 34"
FT   gene            complement(40497..40829)
FT                   /locus_tag="CAP2UW1_0035"
FT   CDS_pept        complement(40497..40829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0035"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   cti:RALTA_A0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33409"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS3"
FT                   /protein_id="ACV33409.1"
FT                   /translation="MLVKFTSSTSGQIMMFAPVARQLLEIVGKDCNARGVITTEQLPDA
FT                   IHRLREASADAKNPDHAEAVSPDENEDAKESVHVGLGQRAYPLIELLEWTRKEDGYVLW
FT                   EASGDF"
FT   gene            41001..41717
FT                   /locus_tag="CAP2UW1_0036"
FT   CDS_pept        41001..41717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0036"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bmu:Bmul_0808
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33410"
FT                   /db_xref="GOA:C7RIS4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS4"
FT                   /protein_id="ACV33410.1"
FT                   /translation="MELERLLRSQGFGSRAECRGLVCTGRVSVEGRVCNDPLAQFEPEG
FT                   LSFAVDGQPWAYRRFVYLALNKPAGHECSRRPIHYPSVFSLLPIPLVRRGVQAVGRLDA
FT                   DTTGLLLLTDDGAFIHACTSPRRMVPKVYEVSTRHAVDDGQVAALLSGVVLHDESQAIM
FT                   AAACDRQGERSLRLTVTLGKYHLVKRMVAAAGNRVEALHRVAIGGLALPATLAAGRWTW
FT                   LEAADLALLAPRSLPG"
FT   gene            41831..42742
FT                   /locus_tag="CAP2UW1_0037"
FT   CDS_pept        41831..42742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0037"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: eba:ebA2966 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33411"
FT                   /db_xref="GOA:C7RIS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS5"
FT                   /protein_id="ACV33411.1"
FT                   /translation="MTLTELRYIVTLARERHFGRAAERCHVSQPTLSVALKKVEQRYGV
FT                   VLFERSSADVRLTMIGEQIAGQAERVLEEADRLKEIVVQGKDPLQGPLRLGVIYTIAPY
FT                   LLPQLIPALHARAPRMPLFLQENFTVSLAAQLRRGDLDVIVVALPFGEPGIVSRVVYEE
FT                   PFCVVMPSGHPLAQQSLIDVEQMAAHNLLLLGNGNCFRDQVVQACPQLSAPGGTEGALE
FT                   GSSLETVRYMVASGAGISVVPASAAASWPQDDSLLQSRRFSPPAPVRQVVIAWRATFPR
FT                   PEAIDVLRAAILDAPPPGVLAA"
FT   gene            complement(42825..45422)
FT                   /locus_tag="CAP2UW1_0038"
FT   CDS_pept        complement(42825..45422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0038"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: dar:Daro_0018 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33412"
FT                   /db_xref="GOA:C7RIS6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS6"
FT                   /protein_id="ACV33412.1"
FT                   /translation="MSKKLIITEKPSVAADVARALGGFVRHDDYYEGDEYVLSSAIGHL
FT                   LELACPEEYEVKRGKWSFAHLPVIPPHFALQPIAKTESRLKLLVRLIKRKDVAGLINAC
FT                   DAGREGELIFNYINQHAGNAKPVERLWLQSMTPQAIREGFSRLRSGTEMQGLGDAAVCR
FT                   SESDWLVGINGTRAMTAFNSKTGGFHLTTVGRVQTPTLALMVDREDRIRKFVARAYWEL
FT                   DGVFACAAGDYRGRWFDENFKGKDDDEHARADRLWDESRALALQNKCADQDGDVSEESK
FT                   ASTQLSPLLFDLTSLQREANGRFGFSAKATLGLAQALYEKHKILTYPRTDSRALPEDYR
FT                   QTVLSTLSMLTGEGVGKGHDEQTLARYAPFAGRILASNWVVPNKRIFNNAKVSDHFAII
FT                   PTLQAPKHLSEPEMKLYDMVVKRFLAVFHPAAEYLITTRITRVAGEPFKTEGKVLVNPG
FT                   WLAVYGREGQEGEEGNLVAVQAGERVHASEMLLSAHQTRPPARYSEASLLTAMEGAGKA
FT                   MDDEELRAAMAGRGLGTPATRAQIIENLLAEQYLQREGRELQPTAKAFSLMTLLNGLGI
FT                   PELTAPELTGEWEWKLARMERGELARTAFMKEIAAMTQRIVDRAKSYDSDTIPGDFGEL
FT                   STPCPKCGALIKETYKKFQCQACDFSLWKIVAGRQFEASEIEELLTRRRIGPLSGFRNK
FT                   MGRPFNAIIQLNADNSPEFDFGQGSAGADGPAEEVDFSQSETLGPCPKCGASVFEHGMA
FT                   YVCERSQGSAKTCDFRSGKVILQQTVEAEQMQKLLSSGRTDLLRNFVSARTRRKFSAYL
FT                   VRGADGKVGFEFEKREPRTPAKKSRATPTSEPSDAATPTSGTTTRSRKKASSS"
FT   gene            complement(45566..46015)
FT                   /locus_tag="CAP2UW1_0039"
FT   CDS_pept        complement(45566..46015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0039"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   eba:ebA2962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33413"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS7"
FT                   /protein_id="ACV33413.1"
FT                   /translation="MIDILVYLFANYHDFSARPKTRTLRRRLSAVGFNDEAIGVALRWL
FT                   DGLKGAPLLDWPDGHRAMRIYVPEEQRKLGADCLGFIAFLEASGLLSPGMRELVVERAM
FT                   MLDDDPVPIGKFKIIVLMVLWSREQDLEPLIVEELLDAGDAHPLH"
FT   gene            complement(46028..47119)
FT                   /locus_tag="CAP2UW1_0040"
FT   CDS_pept        complement(46028..47119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0040"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: dar:Daro_0019 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33414"
FT                   /db_xref="GOA:C7RIS8"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS8"
FT                   /protein_id="ACV33414.1"
FT                   /translation="MDAAESSAGWLRLTLVPGVGGESQRKLLKAFGLPEAIFTAGRSAL
FT                   GDVIGDRTARLLLDTDNRAAVDRALAWANGTNQHLVCLADPEYPQALLQIPDPPTLLYV
FT                   RGRLSLLNQPALAVVGSRNPTPQGRGNAERFAAAFAEAGLGVVSGLALGIDAAAHRGAL
FT                   NATGNTIAFIGTGIDRIYPAANQQLAFDIAARGAIASEFPLATPPAAANFPRRNRLISG
FT                   ISRGVLVVEATTESGSLITARLAAEQGREVFAIPGSIHSPQSRGCHRLIKQGAKLAEAV
FT                   ADVIEEIGWASAPADRPASATADAAEAGSLLLAMGFDPCSLDELTQRSGLTADAVSVIL
FT                   LHLELDGQVACLPGGHYQRISQA"
FT   gene            complement(47122..48141)
FT                   /locus_tag="CAP2UW1_0041"
FT   CDS_pept        complement(47122..48141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0041"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   dar:Daro_0020 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33415"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIS9"
FT                   /protein_id="ACV33415.1"
FT                   /translation="MTRIMFAFILAMASAALSSVSAQELQLAAGAPERHVVLPGDTLWA
FT                   ISGKFLKEPWRWPEIWRMNREEIRNPHRIFPGDVIVLERDARGDPRLRLQRARLVPQVY
FT                   SEAIEESIPAIPPNVIRPFLSDPLIVEANALDSAARIIATQQDRVFIGNGDLAYVVNAD
FT                   PDKVAWQIYRSGKPLNDPETNEVLGYEAYYLGTARQLEPGNPATFQVISMKEEIGRGDR
FT                   LLPAIRPPLVAYVPHKPDFSVDGRVISVYGGVDAAGRGSIVSINRGAADGIEIGHVLAL
FT                   QRNRTAVAREENDRKETVQIPVLRVGLLFVFRTFQRISYGLIVQSEGTVEVNDFARTP"
FT   sig_peptide     complement(48073..48141)
FT                   /locus_tag="CAP2UW1_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 23"
FT   gene            48319..48822
FT                   /locus_tag="CAP2UW1_0042"
FT   CDS_pept        48319..48822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0042"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: dar:Daro_0021 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33416"
FT                   /db_xref="GOA:C7RIT0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT0"
FT                   /protein_id="ACV33416.1"
FT                   /translation="MSLLPILRFPDPRLRKVAARVDKIDDGIRRLARDMAETMYEAPGI
FT                   GLAATQVDVHARVIVVDASETRDQLLTLINPEILQQDGLQVCEEGCLSVPGVYDKVERA
FT                   EHVVVRYQDLDGAEQTVDATGLLAVCLQHEIDHLQGRVFVEHLSQLKQLRIRNKLAKQA
FT                   RITA"
FT   gene            48819..49745
FT                   /locus_tag="CAP2UW1_0043"
FT   CDS_pept        48819..49745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0043"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: dar:Daro_0022
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33417"
FT                   /db_xref="GOA:C7RIT1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT1"
FT                   /protein_id="ACV33417.1"
FT                   /translation="MRLVFAGTPEFAALALRQILAAGHQVVLVLTQPDRPSGRGMALRA
FT                   SPVKELANAAGLEVFQPPTLRDALVQQRIRAAGAEAMVVAAYGLILPQAVLDMPSHGCI
FT                   NIHASLLPRWRGAAPIQRAILAGDQETGVSIMQMEAGLDSGPVLLSASVPISDTDTAAS
FT                   LHETLALLGARLVVDVLARLPLPASPQPEVGITYAAKIDKAEASLDWHRPAWQLARQVR
FT                   AFNPFPGSTCCLDDVPLKVWRAEAVAGDGRPGMVLRVERDGVVVACGEQALRLGELQKA
FT                   GGRRLSAAQYLAGTALSPGACCALSGS"
FT   gene            49818..50666
FT                   /locus_tag="CAP2UW1_0044"
FT   CDS_pept        49818..50666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0044"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: dar:Daro_0023 heat
FT                   shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33418"
FT                   /db_xref="GOA:C7RIT2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT2"
FT                   /protein_id="ACV33418.1"
FT                   /translation="MFANWLKTSILMAAIVALFGVIGGFVGGKSGMLLALLFGGAMNVF
FT                   AYWFSDKMVLKMYNAREVDASSAPQFYGMVRELAQRAGLPMPRVYLIDEGQPNAFATGR
FT                   NPDNAAVAATSGILQLLSAREIRGVMAHELAHVRHRDILISTISATMAGAISALANFAV
FT                   FFGGRDSEGRPSNPLAGILVALLAPLAASLIQMAISRAREFEADRGGAEICGDPNALAD
FT                   ALAKIDAYARGIPMAPAEAHPETAQMMIMNPLSGGGIAGLFSTHPATAERVARLRAMGR
FT                   G"
FT   sig_peptide     49818..49904
FT                   /locus_tag="CAP2UW1_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.692 at
FT                   residue 29"
FT   gene            complement(50709..51671)
FT                   /locus_tag="CAP2UW1_0045"
FT   CDS_pept        complement(50709..51671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33419"
FT                   /db_xref="GOA:C7RIT3"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT3"
FT                   /protein_id="ACV33419.1"
FT                   /translation="MTARPCRRTWRLRFGACLLLLVAAPALAWNAAGHRISAMIAWESM
FT                   DAGTKSAVGQLLRQHPDYERWQARAHGGDPELTAFLEASTWPDDIRKDRRFYTTGREEP
FT                   TATLPGFPDMERRLHWHYVDRPVNPGAGTGPAAGVIDRQLAVLARIVGDRQATMAERAY
FT                   ALPWLIHLVGDAHQPLHAASRYGPDGQSDNGGNLVSIVNPFAARYTSMSLHRYWDDLPG
FT                   PPWLRDGRLASAARSLAALHRPPTSPGTPEQWLDESWRLARERVYPPGDDAVPTISATF
FT                   HEDALAIAGRRVAEAGYRLADLLQRLLHSGPRREDRNDR"
FT   sig_peptide     complement(51585..51671)
FT                   /locus_tag="CAP2UW1_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 29"
FT   gene            complement(51661..52569)
FT                   /locus_tag="CAP2UW1_0046"
FT   CDS_pept        complement(51661..52569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0046"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   tbd:Tbd_1114 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33420"
FT                   /db_xref="GOA:C7RIT4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT4"
FT                   /protein_id="ACV33420.1"
FT                   /translation="MRRMTSSSLKPFAWLSIGAALATIALKGLAWMMTGSVGLLSDALE
FT                   SLVNLAGGAMALAMLSIAERPEDEGHAFGHGKAEYFSSGFEGLLILFAALAIAFAAIER
FT                   LLYPKPLEQLGLGLVVSTLASLINLVVGSVLLRAGKRHRSITLEADAHHLLTDVWTSVG
FT                   VIVGLTAVALTGWLWLDPTLALLVATNIVWTGWRLLQRSAVGLMDGSLPPEEHALVLAI
FT                   LERYRALGIEFHAVRTRESGTRRFISLHVLVPGSWTISRGHQLVEELEREVRQTLSHAS
FT                   VFTHLEPLEDPVSQEDIALDR"
FT   sig_peptide     complement(52477..52569)
FT                   /locus_tag="CAP2UW1_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.655 at
FT                   residue 31"
FT   gene            52693..54021
FT                   /locus_tag="CAP2UW1_0047"
FT   CDS_pept        52693..54021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0047"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; KEGG: dar:Daro_0028 Fmu, rRNA SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33421"
FT                   /db_xref="GOA:C7RIT5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT5"
FT                   /protein_id="ACV33421.1"
FT                   /translation="MRVRKPAAVVKGPPRRKPGPPPSRLPADSLGLSLLLAARVIAAVR
FT                   AGQSLTQALRPLSAAAPAARAAAQDVAYGTLRRYGCGEFILARLLTKPLSHTETEALLL
FT                   AALFRLHTRPEAAYMVVDQAVAAAGEMTGGVFKGLVNGLLRSYLRQRESLAAAMAGDDE
FT                   AVQQHPAWWLARLRRAYPEHWQEIVAAGNGPPPMTLRVNRRRATSEAYAARLLEAGSSA
FT                   RQVAANALLLAKPVTVDALPGFADGLVSIQDAGAQRAAQLLLPVAGERILDACAAPGGK
FT                   AAHLLEAADIDLLALDIDATRTRRIEDNLRRLGLVAKVGVADCRASGDWWDGLPFDAIL
FT                   ADVPCSASGVVRRHPDIKYLRRESDIRRFALLQADLLDQLWPLLKPGGRLLYATCSVFP
FT                   EENEGQIDAFLVRQPTARRLVEERLLPREEHDGFYYALLRKAP"
FT   gene            53996..54616
FT                   /locus_tag="CAP2UW1_0048"
FT   CDS_pept        53996..54616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0029 probable proline rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33422"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT6"
FT                   /protein_id="ACV33422.1"
FT                   /translation="MRCCGKLLSSFLVGLFILIASSSTQAADISIRNPQLSAGDEGYVL
FT                   SADFTINLNARLEEVVAKGVALYFVVDFELSRSRWYWLDEQVVGRSQSYQLSYHALTRQ
FT                   YRLSSGALHQSFATLDEALRILTRLRNWPVLDKGSLAAGQTYQLALRMRLDLTQMPKTF
FT                   QVNALANRDWNLTSEWARWNLTPGDVSSLGVAATLAPATGESK"
FT   sig_peptide     53996..54076
FT                   /locus_tag="CAP2UW1_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            54613..56766
FT                   /locus_tag="CAP2UW1_0049"
FT   CDS_pept        54613..56766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0049"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; KEGG:
FT                   dar:Daro_0030 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33423"
FT                   /db_xref="GOA:C7RIT7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT7"
FT                   /protein_id="ACV33423.1"
FT                   /translation="MKSLIVAAASFGGILLFLLASASANTALFARHYPWLLGLNAIVAL
FT                   SLLALIAWQLRILWGEHRARVFGSRLKLRLMLMFGLMAVVPGVLIYAVSVQFVTKSIDT
FT                   WFDVRVEKALEAGLNLGRSALDSLLADLAAKGQSMALELADRSEAQRRLELNRLREQHG
FT                   VQSAALFSTTGTLVATATGELATLLPAQPAPEQLRRALAERRLAVIESHSEKDLTLRVL
FT                   VAVTPPGLGIETRILQLTDPVPTSLAQNADSVQAVYADYQELSLGREGLTRIYAMTLTL
FT                   TVLLALFTAIALAFVLARRLSAPLSILAEGTQAVAAGDYTPRQAVYSRDELGVLTRSFK
FT                   QMTSQLDEARRDNERHRAELEAARAYLESILANLSAGVLVFDHRFVLRTFNEGALTILD
FT                   DDFSDLLGHPVDAWPRQETLGQAIRSAFDTHASSEWQEQIELDHSGGLPQILLLRGTQL
FT                   PAGSHGGYVVVFDDVTRLIAAQRSAAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADR
FT                   LAGADAQMLARSTQTIITQVQAMKRMVNDFSDYARLPAPELAAVDLNALISEVLGLYET
FT                   SRATIKLKLAPRLPLVWGDVTQLRQIIHNLLRNAEDAQEALESPCIGISTQCTDSMAEM
FT                   VVTDHGPGFPPEILARVCEPYVTTKARGTGLGLAIVKKIVDEHHGRIRINNRQRVGAEV
FT                   SIMLPLVSQPSARRHPSKLSSEA"
FT   sig_peptide     54613..54687
FT                   /locus_tag="CAP2UW1_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.471 at
FT                   residue 25"
FT   gene            56769..58025
FT                   /locus_tag="CAP2UW1_0050"
FT   CDS_pept        56769..58025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0050"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dar:Daro_0031 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33424"
FT                   /db_xref="GOA:C7RIT8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT8"
FT                   /protein_id="ACV33424.1"
FT                   /translation="MAQVLIVDDEMGIRELLSEILADEGHSVWLAENAAVARRMRAEKR
FT                   PDLVLLDIWMPDTDGISLLKEWSAGGLLTMPVVMMSGHGTIDSAVEATRIGATDFLEKP
FT                   IALQKLLATVKKALKHEAVLQKRPLTLDAFTRSPLLKDLKRRLEQAAAKTSVLLLKSAS
FT                   GSIAEICARTLQTHRTPWLDLSTLSTPLTQEMLQNAGGGIVFIADLAQFGKLQQMNLVF
FT                   AIERLERQNLQLVAASSRSLSALVDSGWDPLLVNRLGEVWVALPQISGHADDVPEIATL
FT                   LLADLAERGEVPLRHFSSGAQNALRLHRWQGEWAELLTTVKNLALSALDEEISADDVAR
FT                   TLQTEASGAATPLAALFFDLPLREAREGFERLYFEYHLSSERGNMTRLAEKTGLERTHL
FT                   YRKLRQLGLNIGRRSDERE"
FT   gene            58063..59493
FT                   /locus_tag="CAP2UW1_0051"
FT   CDS_pept        58063..59493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0051"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: azo:azo3981 potassium transporter peripheral membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33425"
FT                   /db_xref="GOA:C7RIT9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIT9"
FT                   /protein_id="ACV33425.1"
FT                   /translation="MRIVILGAGQVGASVAESLVSENNDITIVDSDQDRLAYLQDRLDL
FT                   RTVTGNAAYPSVLASAGLDDADLLIAVTQSDQTNLVACKVAHSVFNVPARIARLRARDF
FT                   LESEKLLAPENFAVDYALCPEQVITEYIARLVEFPEALQVLNFGDGRLVLVGLRAYAGG
FT                   LLVGSPIKEMRGHLPPEIDGRIAAIYRRDGAITPTGETIIEDGDEVFLLAAEEHIRAVM
FT                   RELRRSVEPVRRVMIAGGGNIGHRVAQALEGKCEVKLIEVSRRRAEFVATSLKAVLVLH
FT                   GDATDEELLQQEAIDEMDLFLALTNDDEDNIMAASLAKKMGSKRVVALINRRAYADLVQ
FT                   GGPIDIAISPAQVSIGTLLTYVRHGDVAQVHSLRRGAAEALEVVAHGDQKTSRVVGRRI
FT                   CDVPTIEGAFIAAVVRDLDKTQDVGFLGLAKKKQRGRVLIAHKDVVIQTDDHVIVFCLD
FT                   KKVVKQVEKLFAVGFHFF"
FT   gene            59503..60957
FT                   /locus_tag="CAP2UW1_0052"
FT   CDS_pept        59503..60957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0052"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: tbd:Tbd_0022 trk
FT                   system potassium uptake membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33426"
FT                   /db_xref="GOA:C7RIU0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU0"
FT                   /protein_id="ACV33426.1"
FT                   /translation="MQRYYPVIRVLSMVIVMFGLTMLVPWGLSWFMHDGAESAFDEAVL
FT                   LTVGTGAGLWYATRKEKRDLTIRDGFLMVALVWTVLPVYAALPLVIQLNASFTDAYFEA
FT                   VSGLTTTGATVFEGLDNLPVSINFWRTQLVWLGGMGLIVLAVAILPLLGIGGRQMFKAE
FT                   TPGPMKDSKMTPRMAETAKGLWVVYTLISVCCVLGYQWAGMTWLDAIMHMFATMGLGGF
FT                   SSHDASYGYFNSPLIEAVAILFMLIAGCNFATHYVVLSGRSLRPYATDPEAGMFLLVTL
FT                   GSVVGIAIFLDVHEVYPTFSEALRFSAFNVVSIATTTGFANTDYALWPFFAPLWMLFLS
FT                   SFATSAGSTGGGIKMIRAIVLYKQVYRELARAMHPNAVHPVKVGNEVVPPNILFAVLAF
FT                   GFMYMVCIASMTLLLSFSGLEIITAFTAVVASINNTGPGLGQVGPANNFSVLTDFQTWV
FT                   CTFAMLIGRLEIFTLLVVLTPAFWRK"
FT   gene            complement(60997..62457)
FT                   /locus_tag="CAP2UW1_0053"
FT   CDS_pept        complement(60997..62457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0053"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: eba:ebA2824 cation
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33427"
FT                   /db_xref="GOA:C7RIU1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU1"
FT                   /protein_id="ACV33427.1"
FT                   /translation="MIKRFAPVLFVLGILILGFGFLMLVPLSLSWLSADGAHGAYDEAV
FT                   LITMASGALLSLSVRRQKREIRVRESFLLVALIWSLLPAFGALPLYLHIKELSWTDAYF
FT                   EAVSGLTATGATVLSGLDTLPLSINFWRTFMHWIGGLGVVVLAVAILPMLGFGGRGMLK
FT                   AETPGPMKDAKITPRITETAKGLWVVYVILTISCGVSLYQVGMEPWDALMHAFSIMGLG
FT                   GFSTKDASLGHFDSLDIELVVIFFALLAGINFSTHFLVLSQRSLRAYRFDIEAHYFLGF
FT                   LALSSVALALYLWPDDVYEDFLTTLRYVAFHSVSLATSLGFATTDYAQWPLFAQLWILF
FT                   LGSFVACSGSAGGGIKMIRAVVLYKQVSRELMRAMHPRGLQTVRFGATVVPDPVLHSIL
FT                   GFMFIYVVTIVILTLLLIATRLDVITAFSAVVACINNTGPGLNLVGPSTTYAVLTDFQT
FT                   WVCTWAMLLGRLEIFTLLVILMPAFWRR"
FT   sig_peptide     complement(62365..62457)
FT                   /locus_tag="CAP2UW1_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.366 at
FT                   residue 31"
FT   gene            62931..64430
FT                   /locus_tag="CAP2UW1_0054"
FT   CDS_pept        62931..64430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0054"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   sun:SUN_1865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33428"
FT                   /db_xref="GOA:C7RIU2"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU2"
FT                   /protein_id="ACV33428.1"
FT                   /translation="MGSLLRIARELMREAARDLAPTLVVVAIFQVFFIQRMPDSPAGLI
FT                   GGFAAVLLGLALFVKGLDAAIFPAGETMAFDFARRGSFLWLMLFAFCISFASVAAEPAL
FT                   MAVAYKAEAVSGGSMGALTLRMVAALGVGLAVVVGVWRIVLGHSIGNYLIPGYLIVIAL
FT                   TVFSPPQLVGLAFDSGGVVASTVTAPLLTALGVGLATSIRGRNPMLDGFGLIAFGALAP
FT                   MIIIQIYGIVFFVPAAAGTAVVMMPTDDQHQYAALELLFDFLIMVRNLLPIIVVVLFSS
FT                   FVILRRPLADPKGLAVGMVLVAVGLFLFDEGLQVGLFPLGDEMTKGLMGDGVAMWAVYL
FT                   YGFLIGFATTMAEPALIALSIKADEVSLGQLKGIWLRSLVSIGVGIGIVIGCARIIDGI
FT                   NIAYWLIPGYLLVLAMTKVAPRFIVPIAYDCGGVTTSTVTVPLVTALGVGLAERTPGRD
FT                   PMIDGFGLIAFASLLPMIIVMSYGILASWLMSRKSAKEKTR"
FT   gene            64427..64774
FT                   /locus_tag="CAP2UW1_0055"
FT   CDS_pept        64427..64774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33429"
FT                   /db_xref="GOA:C7RIU3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU3"
FT                   /protein_id="ACV33429.1"
FT                   /translation="MKFSAVVLIIPEEDENRAVGILKHAGATGLTILKGKGLRHNERKT
FT                   FLGLGLERKESVLLCVVEKQLAMRILRSVKTEMKLDEPGGGLAFSLPLGSVVGIGLAQM
FT                   QAFRREVEEDL"
FT   gene            64849..65244
FT                   /locus_tag="CAP2UW1_0056"
FT   CDS_pept        64849..65244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0056"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   aeh:Mlg_0661 putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33430"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU4"
FT                   /protein_id="ACV33430.1"
FT                   /translation="MLVAGIMKKDVVTISPLATVREALMMMKARGVRSLVVEKRHSGDA
FT                   YGLIAYRDVAKSVIAEDGDIDLLNVYDIAQKPALQVSQHLEIRYLARLMIQYSVKRVLV
FT                   IDNNELQGFVSDTDVVTSLIERALRDR"
FT   gene            65257..65694
FT                   /locus_tag="CAP2UW1_0057"
FT   CDS_pept        65257..65694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33431"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU5"
FT                   /protein_id="ACV33431.1"
FT                   /translation="MEKIVRRYAAHFPRWCQAFGDHLPDPGGEGRAVEWLVGEGCVGVI
FT                   VLPEVRRLLMHELLGPQKPHLEFRQRSLSLNRYDYDEVEVLGHSGYAALRELLLAGDET
FT                   HMFLTYHLIYPPGTRIITVSLKPPLPLLYKEMAPLAVSVCA"
FT   gene            65845..66924
FT                   /locus_tag="CAP2UW1_0058"
FT   CDS_pept        65845..66924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0058"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: dar:Daro_0032 uroporphyrinogen decarboxylase
FT                   HemE; TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33432"
FT                   /db_xref="GOA:C7RIU6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU6"
FT                   /protein_id="ACV33432.1"
FT                   /translation="MTRPSNDSFLRALLKEPTAYTPVWLMRQAGRYLPEYCETRKRAGS
FT                   FLQLCKNPALACEVTLQPLARYDLDAAILFSDILTIPDAMGLGLYFTDGEGPRFERPLR
FT                   EEWAIRDLTAPDPWDHLRYVMDAVAEIRRALHNSVPLIGFAGSPYTLACYMVEGASSSD
FT                   YRCIKGMLYERPDLLHRILSVTADAVTAYLNAQIESGAQAVMIFDSWGGSLSAAAYEEF
FT                   SLQYMQRIVGNLLRERGGERVPSIVFTKGGGLWLEAIADIGCDAVGLDWTIDIGEARRR
FT                   VGDRVALQGNIDPAVLFASPEKVAAEARRVLESYGAGQNTGHVFNLGHGISQFTPPENV
FT                   TALVEEVHAHSVLLRTRSE"
FT   gene            67267..69291
FT                   /locus_tag="CAP2UW1_0059"
FT   CDS_pept        67267..69291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0059"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: dar:Daro_0033 replication restart DNA helicase
FT                   PriA; TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33433"
FT                   /db_xref="GOA:C7RIU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU7"
FT                   /protein_id="ACV33433.1"
FT                   /translation="MPQIVRVALDVPLRRFFDYCVPKGECLSVDDIGCRVRVPFGQQRK
FT                   IGIIVGLPSESAVPLAQLRSCEVVLRDLPPLPADWFRLVEFCAAYYQAPVGQVMLSTLP
FT                   AGLRSTTPAKPRPVRRLPDDTRAIAAPALTAEQEMSLAAIAAGGPGFHAYLLHGVTGSG
FT                   KTEIYLRLIERTLAAGRQSLLLVPEINLTPQLEARVMARFPAAGLVSLHSELGESARNR
FT                   NWRAALSGAARIVLGTRLAVFAPLPEPGLIVVDEEHDASFKQQDGIRYSARDLAVFRAR
FT                   QCGIPIVLGSATPSLESWANAAGNGAGNGARARYRLLSLHARAVEGARLPVVRRVDTRV
FT                   DKPIDGLSGALLEAIEKRLERGEQSLLFLNRRGYAPVLACMACGWTSGCRRCAAHLVLH
FT                   LADRCLRCHHCGYAAAVPKACPTCGNQDLSAFGRGTQRLEVVLGERFPQARVLRVDRDS
FT                   ASSRTHWEALVARIHAGEVDILVGTQMLAKGHDFPKLTLVGVVSPDAALFAADWRAPER
FT                   LFAQLMQVAGRAGRADRPGEVLIQTQFPDHPLYAALVDHDYPAFAAAHLKERQQAGFPP
FT                   YTHQAMLRAEAPRMADALSFLNTARACPPPGCENAVTFYDAVPMRLSRRASRERGQLLV
FT                   ESSSRRVLQQFLAGWVVQIEAIKAPGSLRWHLEVDPLEF"
FT   gene            69634..71172
FT                   /locus_tag="CAP2UW1_0060"
FT   CDS_pept        69634..71172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0060"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: abo:ABO_2461
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33434"
FT                   /db_xref="GOA:C7RIU8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU8"
FT                   /protein_id="ACV33434.1"
FT                   /translation="MSSDFVAAIDLGSNSFHMIVARIANGRVQVLDRLREMVQLAAGLD
FT                   SRNRLSPQSQQRALDCLARFGQRLRHIPPTRVRIVGTNTLRQARNSAEFVARAEQVLGH
FT                   KVEIVAGQEEARLIYLGVAHSVGDVPGQRLVVDIGGGSTELIIGEQFDPLHLASLRMGC
FT                   VSISRHCFGNGRVTAGRLREAELLVQLNLEPVREEYLARGWEVVTGASGSIKAIQDVVV
FT                   SEGWCREGISLDALRRLRTALLEVRDTAEIASRWQLDPARARVFFGGFVILHGLCETLG
FT                   VQQLEVSEGALREGLIYDLLGRIRHEDVRDRTIADVIGRFGLDEAQAGRVSGTALELHR
FT                   QVRAKWQLTGKEARHVLERAARLHEIGLLLTHDQYHRHGAYVLEHSDLPGYSRDDQRLL
FT                   SALVGRHRRSFPADAFSHLPKDWARPARRLCVLLRLAVVLHRGRSSEPLPAISLRVDRQ
FT                   RLVLRLPAGWLDQHPLTRADLEIEARQLRKAGFDLEIGRSGPVTLPPAPAAGLP"
FT   gene            71275..72513
FT                   /locus_tag="CAP2UW1_0061"
FT   CDS_pept        71275..72513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33435"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIU9"
FT                   /protein_id="ACV33435.1"
FT                   /translation="MRFLAWLAASLLLSLLVVFFLLVAALEPAPLVTRGETISPASIAQ
FT                   AKLLLARNDPRRLARGDERTADLPAALIDDGVNHLANRLLHGRGAFVMGEDSAQIRLSV
FT                   RVPGLPGPRFLNLGAVFKEAEGEPHVASATLGSLPVPAALIELLMASAIKLAGFGDDWQ
FT                   LARQSIRRLMFEPGRGVVVITYVWEPEILDRALALAFTPEDLLHLEAAQRALAGLLDHH
FT                   GPRARVPLPEILGTLLAHTGDGSLVQRRAALLVLATHQSGQSLVRLLPQARQWPRPRPV
FT                   KLILLGRGDSAQHFAISAALAAWAGEPAANAIGVYKEVEDARHGSGFSFADLAADRAGT
FT                   RFGQLVADASPRLNAALGRTLTDADLAPALGGLPEYLSESEFQRRFGGSGNAAYAQVMA
FT                   EIERRLAALPLYR"
FT   sig_peptide     71275..71352
FT                   /locus_tag="CAP2UW1_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.645 at
FT                   residue 26"
FT   gene            complement(72557..73756)
FT                   /locus_tag="CAP2UW1_0062"
FT   CDS_pept        complement(72557..73756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0062"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dar:Daro_0035 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33436"
FT                   /db_xref="GOA:C7RIV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV0"
FT                   /protein_id="ACV33436.1"
FT                   /translation="MLWLKLFLPFAGAYFLSYLYRTANAVIGPILTAELALGAGSLGLL
FT                   TSAYFLSFAAAQLPLGMLLDRFGARRVESGLLLIAATGAATFAIGKSIGDLAFSRALIG
FT                   LGVSACLMAAFKAFSLWFPADRQASLTGWIMTSGGLGALAATAPLEAALQVAGWREIFV
FT                   GLAGLTLLVAIWLFLSVPERTDGAKPEPLAAQWAGVRQVFASAHFWRFAPLGLTLVGGF
FT                   MAVQSLWSVSWLMQVNGYARAVAADHMAGMSAAMLIAYLLIGLLATGLARRGIKPLMLL
FT                   AAGLGLSLLTLALIVTQAVEHTHLLWIAYGSFSSFGTLAYSQAAAGFAVALSGRANTAF
FT                   NLMVFVGAFGVQWGLGLLIDLLQAQGQTAAMAHRNALLSLLGAQLAAYLWFLLAGRRVR
FT                   "
FT   sig_peptide     complement(73679..73756)
FT                   /locus_tag="CAP2UW1_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.617 at
FT                   residue 26"
FT   gene            complement(73781..74719)
FT                   /locus_tag="CAP2UW1_0063"
FT   CDS_pept        complement(73781..74719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0063"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: dar:Daro_0037
FT                   N-acetylglucosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33437"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV1"
FT                   /protein_id="ACV33437.1"
FT                   /translation="MATQRTRTRLFRRLRIGIDLGGTKIELVALDESGNVLRRRRRPTP
FT                   QGDYLATIRVVTELVAAAEDDLGGRGSVGIGIPGTESVAAGHIKNANSTCLIGRPLRDD
FT                   LQRLLQREVRLANDANCFALSEAIDGAGRGAEVVFGVILGTGVGGGIVVNQRVLTGVNR
FT                   IAGEWGHNPLPSAEEEGLPPPACYCGRSGCVETWLSGPALSLDHWRHHGESLTAEAVGA
FT                   RAGAGDLAANASLQRYERRLAKALAQVINILDPDVIVLGGGLSNLERLYRSVPMLWTAH
FT                   VFSDEVRTRLLPNVHGDSSGVRGAAWLWDEA"
FT   gene            74953..75201
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0064"
FT   gene            75257..76315
FT                   /locus_tag="CAP2UW1_0065"
FT   CDS_pept        75257..76315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0065"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   cvi:CV_4127 probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33438"
FT                   /db_xref="GOA:C7RIV2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV2"
FT                   /protein_id="ACV33438.1"
FT                   /translation="MRNYPTITGRKIRLALVGCGRIAANHFAAMEQHAEDVEIVDVCDV
FT                   DRNALDKAVQRTLAHGHLSMTEMLKASTADLVVLTTPSGLHPEQTIEIAESGRHVMTEK
FT                   PMATRWHDGLHMVKACDEAGVRMFVVKQNRRNATLQLLKRAVEQKRFGRIYMVNINVFW
FT                   TRPQEYYDSAKWRGTWEFDGGAFMNQASHYVDLLDWLIGPIESIQAYTATLGRDIQVED
FT                   SGVLSVRWRSGALGSMNVTMLTYPKNLEGSITILGEKGTVRVGGVAVNEIQHWDFAEKM
FT                   PEDDKISAANYETTSIYGFGHPLYYDNVIKVMRGEAEPETDGREGLKSLETLIAAYLAA
FT                   RDGKRVALPLDY"
FT   gene            76318..76893
FT                   /locus_tag="CAP2UW1_0066"
FT   CDS_pept        76318..76893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0066"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: aav:Aave_0951 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33439"
FT                   /db_xref="GOA:C7RIV3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV3"
FT                   /protein_id="ACV33439.1"
FT                   /translation="MVLSIHPSAIVDEGAQIGDGSRVWHFAHICAGARIGTDCSFGQNV
FT                   FVGNDVAIGNNVKVQNNVSIYDAVQIEDDVFCGPSMVFTNVYNPRSAVTRKDEYRPTTI
FT                   KRGATLGANSTIVCGVTVGRFAFVAAGAVVTRDVKPYALMAGVPARQIGWISKHGERLR
FT                   LPLEGDGVAQCPVTGETYKLTGTTLAVE"
FT   gene            76890..77960
FT                   /locus_tag="CAP2UW1_0067"
FT   CDS_pept        76890..77960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0067"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   aba:Acid345_3314 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33440"
FT                   /db_xref="GOA:C7RIV4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV4"
FT                   /protein_id="ACV33440.1"
FT                   /translation="MKVAVIGGGINGVMTAWAFARRGDSVDLFEKGRLMSATSHSSSKM
FT                   LHGGLRYLEHGHLRLVREALQERSWWIRQAPEFARPLELLIPIYRNGERAKWLVGAGIR
FT                   LYDLLAIGSGFPRGRWYSADEVVERFPGLKRDELLGAYGYWDARMDDYRLGLWAAERAG
FT                   ESGARLHEFTAVLKVHPATGEVALDGSSARYDRIVNVAGPWAETLLARSGVASAYRLDL
FT                   IRGSHIVVPGKLEHGCVLQVPGEKRILFVLPHGENTLLGTTEVSQADPDHCLPSDEEID
FT                   YLTTNYNRCFFEVVARQDIISSFAGIRPIVASKTDFSAASRESVIERQGRLINVFGGKW
FT                   TTSRALAEAVVTKSQY"
FT   gene            78315..79904
FT                   /locus_tag="CAP2UW1_0068"
FT   CDS_pept        78315..79904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0068"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: glo:Glov_1506
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33441"
FT                   /db_xref="GOA:C7RIV5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV5"
FT                   /protein_id="ACV33441.1"
FT                   /translation="MDVNTHKQTDIQLVFDTNVLVDALTARGQYFACAVDLLEMVRNGK
FT                   VEGWYAHHTLTSVYYLLERAFAAETQNRKTATDLAQTLLRELLQFLRPLPQVGDELRRI
FT                   HSMPGDDLEDLLIVHLASSYLPNPLVVTRDKWFLQHSSLAAAHPKEIIERGLTAWQSRG
FT                   QPIPFADLTTQQHCIRPQLERNMHRVLHHGQYIMGPEVAELEGKLAAYTGAKHCITVAS
FT                   GTEALLIALMALGIKPGEEVITTPFTFVATAEVIVLLGAVPVFVDIEPDTCNIDASKIE
FT                   AAITSKTRAIIPVSLYGQPADMDEINAIAARHGLTVIEDAAQSFGAEYKGRKSCNLSTI
FT                   ACTSFFPSKPLGCYGDGGAIFSSDENLAKAMREIRVHGQEKRYVHTRIGVGGRMDTLQC
FT                   AVVLAKLERFDWEVEQRLKIGARYNALFAGKVQTVTQRPDRTSVFAQYTAFIENREQVQ
FT                   ERLKAAGVPTAVHYPVPLHLQPAYRGGCQVHGGVKTAERMAQRVMSFPMSADLSVEDQE
FT                   RVVAAALEVVRN"
FT   gene            80182..81180
FT                   /locus_tag="CAP2UW1_0069"
FT   CDS_pept        80182..81180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0069"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bav:BAV0086 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33442"
FT                   /db_xref="GOA:C7RIV6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV6"
FT                   /protein_id="ACV33442.1"
FT                   /translation="MYKNCSVAVVVPAYNEETQIAVVIESMPDIVDVIVIVNDCSKDQT
FT                   SQVVRRHSEFGSGRIVLLEHAENQGVGGAIATGYKWVRDNNYDVAVVMAGDGQMAPDDL
FT                   PAILDPVVDGEADYTKGNRLVTGEAFKKIPKIRFFGNSALSLLTKIASGYWHVADSQTG
FT                   YTAISQSALQAIDWDNMYKRYGQPNDLLVKLNVANMRVVDVPIEPVYNVGEKSGIKVRK
FT                   VIFTIGSLLVRLFFWRLKEKYIIRNFHPLVFFYAMGLGGLALSSILFVRMLSMWIGSGN
FT                   VPEITFLGSLFSFSLSVNSLFFAMWFDYDENKHLNPPLKHRETRRKSTQAE"
FT   gene            81177..82502
FT                   /locus_tag="CAP2UW1_0070"
FT   CDS_pept        81177..82502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0070"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bav:BAV0084 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33443"
FT                   /db_xref="GOA:C7RIV7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV7"
FT                   /protein_id="ACV33443.1"
FT                   /translation="MIRPLIAQALHSLRHQKLSQDIAFSLGSFAVLAISGIVINIVITV
FT                   FRDAAALGVFNIAYAVYIVASQVAVWGLHYSVLRHAAYHASDQEARGHMLLTAAVCSIA
FT                   MGLGAGAVVFQAEPLFAVAFNSETTGAAIRNTALGLTVFPLNKVLIAYLNGLREMRAYA
FT                   VLQALRYLMIMALVALVAASSLPIEVSTFCFFVAELLTLVTACLYIASRRLVGTLGFRR
FT                   SWVVRHYQFGTKALAAGLFTEVNSRVDVLMIGIFLSDRATGIYSFAAMLVDGVYHVLAM
FT                   VRINFNPILVAAIRDRDWRTVLNLRRQARRIVLPVTIVLALGLIATYYVFTAWVMPSEK
FT                   GLLEGLPSLAILLGGLTLICFLVPFDNLLMVSGHPGYQTLQQLVLVVTNITVAVLLLPL
FT                   LGIEGAALGTAVSYVAGVLTMAIFANRLLGWNLFTNTIRSAE"
FT   gene            82499..84817
FT                   /locus_tag="CAP2UW1_0071"
FT   CDS_pept        82499..84817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0071"
FT                   /product="Spermidine synthase-like protein"
FT                   /note="KEGG: ade:Adeh_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33444"
FT                   /db_xref="GOA:C7RIV8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV8"
FT                   /protein_id="ACV33444.1"
FT                   /translation="MSNTRFISGLLGAAILLSGFAALCYQVTWQRALTQSIGADAIAVV
FT                   LVVTIFMTWLGVGAALARSLLRRSRRRIAFNYAVVEMVISMCGLVSVPVLRAANGAFAL
FT                   TGIDSVWADFALNLLVLAIPIIGMGMTTPLIVHAARQALDNFGRTVGYIYGLNILGAAA
FT                   GALISGLVLLEWLGLQGVTQLAAVLNMLAACAVLLALRKFPPDAADPAPEGQLPFGRID
FT                   LAAILFGFGTLAMQVLYFRILHAYLTLSTLVFPIVLSAYLLLMSLGQWLGGWLADRFQR
FT                   RLAAIAAALFAAGSLLMVAALNMPPNWAIPFGALRFTAFNGSLLLENRHLIGDPPVLGA
FT                   LSFSLLFMMSVAAWSALFPVLLKVATRHIDEAGASFGHLYGMYTVGNVAGTFLTGALIL
FT                   AWVGTTGAAACAIVVVGAGAWLLLGGRGEAEPEPALGRGLAAVGLLAALLVPANFYGKF
FT                   QLDNYSISDVFEGRVGVATVSPTTRFYHIVDMSRTASASAMVREPGPGDSYEAWRWNHS
FT                   ELMALDPSFRPRRVLVIGIGHAYLPHALLDLPSVQEIVVVDLSPEIVGAVKKHTATSAR
FT                   RVFSDPRVRIVIADGRRYAQSALKRGERFDLVQIKINEPWHAGSGNLFSVEFFRMIKGL
FT                   LAEGGYLGVRPLVGHLSDGMQVFDGALYPGYYHLFFKNGEIPLVEQAVVTPDIADAWRR
FT                   ELPGAAALGPSRNGALEIMQFDARSPRPQIDLNTDDRPTFEYYWLRQRLGTWISPRDGL
FT                   DNPRFNEYRRTVPVLTPLE"
FT   sig_peptide     82499..82579
FT                   /locus_tag="CAP2UW1_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.439 at
FT                   residue 27"
FT   gene            84825..86879
FT                   /locus_tag="CAP2UW1_0072"
FT   CDS_pept        84825..86879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0072"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   bav:BAV0087 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33445"
FT                   /db_xref="GOA:C7RIV9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIV9"
FT                   /protein_id="ACV33445.1"
FT                   /translation="MCGIFGIALRQGADMLPDTVRKLLTNLYVFSESRGKESAGLHLYL
FT                   PDAASAWTLKGAQAATELLRTKAYKEALSQGLTLAYGSSKDSLAQPLIVMAHSRLVTNG
FT                   TAALDRNNQPVRWGGVSMIHNGIVVNVDKLWQTNPDLKRAAEVDTEVMAAVIDRSLRQE
FT                   FDPIKATRTVFSAIKGAASVAWVHEEASTVTLATNTGDLYVATLPEEMGLVFASERYIL
FT                   TEALAKTLGREGAASIMSNLEWLQAGNGLVFDLNAAGSARHFGLAPDADLVAMACMRHL
FT                   AARQHDIGAASSNPAPVGFSNQVDEKLVRYGEERIRGLRRCTCCVLPETFPFIEFDEKG
FT                   VCNYCRSYKPRYAGMHPTETRKTFIDSLVKYRRNGKEPDVLVPFSGGRDSSYGLHLIHE
FT                   EFGLRPITFTYDWGMVTDLARRNVARMCGQLGIPNILVSADIKAKRENIRKNVAAWLKK
FT                   PDLGMVPLFMAGDKHFFRVVNQLKRQTGIALDLWCANPLENTDFKSGFCGVRPDFDKSR
FT                   VDYLSIGRKAQMAAYYGARFLRNTGYLNASLLDTFGAFVAYYFEPRRDFYFIFDHFIWN
FT                   EDEVNKTLLSTYDWELSPDSPSTWRIGDGTAPFYNYVYMTARGFSEFDTFRSNQIREGM
FT                   ITREMALESIAVENRPRMESLRWYLATIGLDFNETIRRVNELDTMGLHR"
FT   gene            86876..88057
FT                   /locus_tag="CAP2UW1_0073"
FT   CDS_pept        86876..88057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33446"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW0"
FT                   /protein_id="ACV33446.1"
FT                   /translation="MRPAHARWAAKSLLLGMVVASLAACSKVDEAALLKAELPLMWVRM
FT                   AGPSPGKGLVDYPSDGPADIPKAYAMILLAAVDAQRAGRGFPEAGTVSGLWLLDHADEN
FT                   RNGITGWGVPVAWDAYGDGSENPASTEYTIATAIAVHALLDWAGEPGTAPRDRIMEVVL
FT                   AASQPYFDASMRTPAGLLPYSLSPPDRRYDTFNPAAYMAGQMQRLSRLVNDPGQAELLR
FT                   QAADQTMQALLDHRKVNPATGSWYWNYSVQEDSSNDLPHASYVVDGIRTYIRHGGRLAA
FT                   AFDREKVLAHLDEFLGEKTPDIRAWPRLRPDVTLAARSYDIGMALHVACTEPAMAGLRT
FT                   RLIAATPAYKDPDGQYLKYPAASKERNFVVREYETYLLRGFETCLAHPVGGAK"
FT   sig_peptide     86876..86956
FT                   /locus_tag="CAP2UW1_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.584 at
FT                   residue 27"
FT   gene            88054..91224
FT                   /locus_tag="CAP2UW1_0074"
FT   CDS_pept        88054..91224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33447"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW1"
FT                   /protein_id="ACV33447.1"
FT                   /translation="MSWRMFAVPAAMVVSLLLASCGGQAENPQARAPVAPPEDIKLEAS
FT                   TPLSAYRKPLVEDAVVTPRIRGAVEVPFVVLRAGKAAATVELDIAANQSTLRMDNGQRI
FT                   PLARPGVPVVLLDLGEARTGAIVRSLPDSELWLADWTNAAKGMRFTKVKRPGVEFLMFR
FT                   AALFHEGVLNLVLYDNHAAKNYLRRLRLEGNQWVAAGPELELPTMEDPAGTHYEMEPPV
FT                   FLFGEKDGLRILAGTLNAKAGAEWIEVKRIEDCAKVLEAIATPTGVGILCNRKNVDTLG
FT                   AYTVVHPAGEPPEVLPLSQGIPWKLSWDEAAARLAWRKATDTQSYGEMMEHDIQRGQNG
FT                   GMLELGSNNIEGRIAWSQIYYLNGFMDAVHLARREQQAFDVFYPLLEKLRLRIELEVRL
FT                   IDRQLGAPEGLRTRAFTKDRSLALFGVQTSRALLLLTRYLEEFPGAPPLANLGKFEREV
FT                   KALQGHIEVMANAGEAEKWLAPGTRHLRWPKGSAFYYDGMPVPYNHQNEWAYGVLDAHR
FT                   AAGGKTDDPAVEAQREIIRHFISRLGKDGRFPEPLAWDYWWGHAYDGYDEASARSLNTP
FT                   SYVGDKSAAWISFRTIDLMSVLGARGYVAEAGGEGFAVSARDLIMRGEVYPFAARSLDM
FT                   DGARAGYHSTVAHKYARSGAPWEIANVPWALATLPAGKEAEDPHSYRLNEKVVGRLPSI
FT                   ASAGADRRQADQLLLDYLAIALPYNASMATREAGRELGGKYVAWNLAYDMRAAVLAYER
FT                   TKDGRFLALFERAADRLIAMRDDRLGVVDDLRGRPAKSWGSNRYSANKQKWVAWDAFAG
FT                   MAVYPLVKYCVVARGMPSAARLCAQYRKVAEEALAEYGPYWRDDEASGGGFYVDPYLED
FT                   IAPLNHMLTLGLVHIELQKLGASGHKDRAIKLARFFRHHWKDRNNGSVEWEYWAGAQQA
FT                   KHKSATAEDVTHAQINVHFAYESYKVGNVITKDDMAKLAKTLLLNVRKNQGDWAADLAG
FT                   GGQIIGSGLHEGLTGWVILDEFDGGVARLIARFVMEHPAAFPLGNFSYATGPIAMAYGL
FT                   PGLLKRAP"
FT   sig_peptide     88054..88131
FT                   /locus_tag="CAP2UW1_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            complement(91329..91778)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0075"
FT   gene            complement(91775..92359)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0076"
FT   gene            complement(92375..93289)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0077"
FT   gene            complement(93366..93563)
FT                   /locus_tag="CAP2UW1_0078"
FT   CDS_pept        complement(93366..93563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_p0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33448"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW2"
FT                   /protein_id="ACV33448.1"
FT                   /translation="MKRRRLSLFPDGLSDESAAAISEFLHQLAAACEARYLVQLRRHRS
FT                   RQMNLYDPEAPWRIPPGEPF"
FT   gene            complement(93560..94354)
FT                   /locus_tag="CAP2UW1_0079"
FT   CDS_pept        complement(93560..94354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0079"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: gka:GK1917 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33449"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW3"
FT                   /protein_id="ACV33449.1"
FT                   /translation="MYLQHFGLRHPPLGKDAAELWDDGALAQLAERFQWLLQSPGLGLL
FT                   TGEAGVGKTAALRLVTAKLNPHRYQVIYHAETDFGRADLYRCLAQSLGLQPSYRRAQLW
FT                   RDIKAHIHHLADAKQLLPVWILDEAQNLPPEFFRDFPAFLNFAFDSRDLITVWLVGHPI
FT                   LAQTLERASYAALAGRIQARVHLRPVLERERFAQLVGHALKSAGCAHALLTDSGLELLR
FT                   QASKGLPRHAGRILRTAMRLAVPRALNHLPDDLLQAALEELR"
FT   gene            complement(94357..99037)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0080"
FT   gene            94953..95249
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0081"
FT   gene            95416..95883
FT                   /locus_tag="CAP2UW1_0082"
FT   CDS_pept        95416..95883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_2789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33450"
FT                   /db_xref="GOA:C7RIW4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW4"
FT                   /protein_id="ACV33450.1"
FT                   /translation="MAPPSKPDSKPLSLAESGTVNPHAQDVQDAAFIDSDFFDPRDLVQ
FT                   VRYEMLRRVRTEGQTIVDIATRFGVSRPTFYKAQADFEREGLAGLLPVKRGPHGPHKIT
FT                   DEVMAFIEAARAQEEGLDAQGLVERIAQHFGLAVHRRTVERALARSKKKRR"
FT   gene            95880..96164
FT                   /locus_tag="CAP2UW1_0083"
FT   CDS_pept        95880..96164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33451"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW5"
FT                   /protein_id="ACV33451.1"
FT                   /translation="MKPTGMTDGQTLTEGYESLRQESAEWPGGCHRSPGRALFLFKGMA
FT                   AWMRCVGETAPSPAAAALRKESRLPAGIEQNLINLVASMALATARERTP"
FT   gene            96161..98239
FT                   /locus_tag="CAP2UW1_0084"
FT   CDS_pept        96161..98239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0084"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: regulatory protein MerR; Resolvase domain;
FT                   Recombinase; KEGG: bpt:Bpet1409 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33452"
FT                   /db_xref="GOA:C7RIW6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW6"
FT                   /protein_id="ACV33452.1"
FT                   /translation="MMGEHHAKIQARHLKRNAYLYVRQSTLRQVLENTESTKRQYDLRE
FT                   RAMALGWRLDQVVVIDSDLGQSGASAVDREGFQRLVSEVGLGRAGIVMGLEVSRLARNS
FT                   TDWHRLLEICALADTLILDEDGVYDPAHFNDRLLLGLKGTMSEAELHVLRARLRGGILN
FT                   KARRGELEIRLPIGFDYDPAGRVRLDPDVRVQESVRQFFRTFRRTGSATATVKAFRAEG
FT                   LSFPHRIHRGPQTGELLWTDLEHSRALWLLHHPRYTGAFCFGRTRVRKQPDGSHRHQRL
FT                   PSEEWIALIRDAHAGYITWDEYEQNLQILRDNAQAPAAGRDRGPPREGPALLQGLAICA
FT                   KCGDRMTVRYHVTGARRVPDYVCQRRGVEHAEPICQQIVGGELDAAIGRLLVEVVTPVT
FT                   LGVALAVQKELESRSEDSDRLRRQAVEWARYESDLARRRYMRCDPDNRLVADSLEAEWN
FT                   QALRAQTAAQEHYDKQRQRETGLDDQQRVSILALARDFPRLWNDPHTPDRERKRMARLL
FT                   IADVTLLKEVDIRAQVRFSGGATHTLHLPLPKPAWMLRQTPSTVVAEIDRLLEDHTDSE
FT                   IADWLNDQGLISGDGKPFHRPMVRRIRIDYALPSRHDRLRARGLLTPQELAERLNIATA
FT                   TLKNWRRAGLLKAHRYDDKGGYLFEPPGPGTPIKHQHQGKTAGRATTREESLPAHTA"
FT   gene            complement(99167..99691)
FT                   /locus_tag="CAP2UW1_0085"
FT   CDS_pept        complement(99167..99691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33453"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW7"
FT                   /protein_id="ACV33453.1"
FT                   /translation="MQRIVAGITTLEQHVETTQKAAEVYRPKSCPHCGLGVVHQHGHYE
FT                   RKADRRAVPPRLNPIPILRYRCAGCRRTCSRLPECIAPRRWYDWSVQQQVLQQRLNGAA
FT                   EHPGGPPDRHTGARWWNWLQERGKDFVFHLRVRFAELGRAVDTHGFWHQVFNSLGLPRA
FT                   MFWLDQEMSVP"
FT   gene            99957..101045
FT                   /locus_tag="CAP2UW1_0086"
FT   CDS_pept        99957..101045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0086"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:p2A281
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33454"
FT                   /db_xref="GOA:C7RIW8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW8"
FT                   /protein_id="ACV33454.1"
FT                   /translation="MITKEVYVEIEVLRKHGFSLRKIAAEVGCAVNTVRSHLAQGKQPR
FT                   YQRQKKRATKLSTHETYLCERQAAAQPQWIPATVLFREIRALGYAGGVSQLRAFMRTIR
FT                   PQGAADPVVRFETAPGEQLQIDWVEFRKGADPLYAFCATLGYSRASYVEFVTDMKVSTL
FT                   IDCHQHAFEALGGVARRLLYDNMKTVVLERDVDGPGEHRYHAGFLDYAKHCGFVINLCR
FT                   PYRARTKGKVERFNGYLRRSFYVPLISRLKQAGLPLDAVTANAEVRRWLKEVANVRIHA
FT                   STQVQPAQRLQEEQAHLQGIPPPWRGDIAAARPLDAPPPVEGATVRPTVAERIALPTPE
FT                   QHPLAVYAQLLTQLQAAAEMQP"
FT   gene            101042..101827
FT                   /locus_tag="CAP2UW1_0087"
FT   CDS_pept        101042..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0087"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p2A369 transposase/IS protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33455"
FT                   /db_xref="GOA:C7RIW9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW9"
FT                   /protein_id="ACV33455.1"
FT                   /translation="MNLQYERMLALCDSLNLPFVAQNYVGAAQEAAAQESAYSDFLEAL
FT                   LKAEVAGRQVRKQSMLTRLAGFPAIKTLEEFDYAFAAGVKRSQIDELAGLAFVERNENV
FT                   VLVGPSGVGKTHLAIALGYRAAQAGIKTRFTTAADLLLTLSAAHAQNQLKAVMHRAIAA
FT                   YRLLIIDEIGYLPMSREQANLFFQVIAARYEKGSLIVTSNLSFGQWDATFAQDATLTAA
FT                   LLDRLLHHAQIVPIAGESYRLKRQRQTGMVQARKAIAGG"
FT   gene            102147..102467
FT                   /locus_tag="CAP2UW1_0088"
FT   CDS_pept        102147..102467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0088"
FT                   /product="conserved hypothetical protein, possibly
FT                   transposase fragment"
FT                   /note="KEGG: eba:ebD46 hypothetical protein, possibly
FT                   transposase fragment"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33456"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX0"
FT                   /protein_id="ACV33456.1"
FT                   /translation="MDKAGEREAYWRRHVGAWRESGATQKAYCDEHGLRSHSLSYWHVR
FT                   LAEGSGARKGGGPLTLVPAVRVPDAGASLPSLLLHGPQGWRLEFATLPPVGWLMALWGE
FT                   HA"
FT   gene            102464..102817
FT                   /locus_tag="CAP2UW1_0089"
FT   CDS_pept        102464..102817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0089"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: eba:ebB55
FT                   transposase, fragment"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33457"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX1"
FT                   /protein_id="ACV33457.1"
FT                   /translation="MSAPIGAAPERIWLAVEAVDMRLGIDGLSVRIQASLGRSPCDGTA
FT                   YAFTNRRRSRLKLLVWDGTGVWLSQRRLHRGYFTWPSASDPVFALTAAQWRWLTAGVDW
FT                   QRRDAPAPANWQV"
FT   gene            complement(103348..104151)
FT                   /locus_tag="CAP2UW1_0090"
FT   CDS_pept        complement(103348..104151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0090"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:ebA3781 transposition helper
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33458"
FT                   /db_xref="GOA:C7RIX2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX2"
FT                   /protein_id="ACV33458.1"
FT                   /translation="MNPMLPLEPLLKQLRLSGILDSLEARNRQAIEAKLAYTDFLALLV
FT                   EDEVARRDQRQFAQRLRKAQVVGDKTLERFDCSHSPSVNHALIAELATCRFVLEQAPVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHAKLLAQLHAARATDSFERKLRQLARVD
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTTLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDRAYQIILDGETRRKPRPLPEVRSPVQATAGRDASKPPPAAR"
FT   gene            complement(104207..105733)
FT                   /locus_tag="CAP2UW1_0091"
FT   CDS_pept        complement(104207..105733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0091"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33459"
FT                   /db_xref="GOA:C7RIX3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX3"
FT                   /protein_id="ACV33459.1"
FT                   /translation="MYEIRQMIQRLRLGESNRAVARAQGVGRDTVARVRDIAAAQNWLE
FT                   ATSPLPDDATMARYYQTAGGGAVKNASHLSTVEPFRENVLEWHRQGIAVSSIRQALARR
FT                   YGYGGSVHAVYRFLRSEAAPAPVATVMLDFAVGEQAQVDFGSGPLITDRHSGEVFKTWF
FT                   FVMTLSWSRHQYAEVVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRACYYEP
FT                   TVQRAYAELALGYAFVIDPCPVADPAKKGRVESGVKYVKGNFMPLREFHSLAHANAQLE
FT                   AWIQGEAGNRLHGSTRERPLMRFNETEQALLQPLPAVAPTCPTWAKAKLHGNGHVQHAY
FT                   CHYSAPFRLIHQTLWLEITPDVVRLYHEHELVAIHPRLFKAGTRSTVADHLPPDAQAYF
FT                   MRDPQWCLTQATAVGPACRAVVESLFAKRVLDQLRAVQGLLRLADQFGRNRLDAACSRA
FT                   LNFGTPSYRTIKQILQTGLDQQPELIDAPTLEAPYLSGGHFRRQPSDLLH"
FT   gene            105978..107375
FT                   /locus_tag="CAP2UW1_0092"
FT   CDS_pept        105978..107375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0092"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: eba:ebA5523
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33460"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX4"
FT                   /protein_id="ACV33460.1"
FT                   /translation="MKFGVKSESLAAGSRGLFDETLAADLAACEARLAEKRQAAEMGPP
FT                   LPPPEKPKRERAGRQPLPDQLPRVEHLHEPNTCTCGRCGQALVRIGEDVTEKLSIVPAE
FT                   FFVERHIYPKYACRPCETLTAAPAVASIIDGGLAAPALLAWVMVSKYADHLPLYRLERQ
FT                   AARAGVTLSRSTLADWVGRTGVALEPLWQRLAEVLRQGTVLHADETPVQQLDPGRGKTK
FT                   RAYLWAYRSNALAGDPSIVVFDYQPGRGGKYVAAFLRDWQGALMVDDFAGYDALFRGHV
FT                   IELACLTHARRKFFDLHQANGSPVAAEALDRFAALYAIEATAKGKTVEERARRRKETSQ
FT                   PLLDALHLWLLSTRTTVAHGSALAKAIDYSLRRWPAIARYVTNGFYPIDNNPVENAIRP
FT                   IAIGKKNWLFAGSEAAGQRAAAIQSLLETARLNGIEPMAWLIDTLEKLPSWPNSRIDEL
FT                   LPLKKRE"
FT   gene            complement(107399..108052)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0093"
FT   gene            complement(108090..108425)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0094"
FT   gene            108884..111463
FT                   /locus_tag="CAP2UW1_0095"
FT   CDS_pept        108884..111463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bav:BAV0082 lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33461"
FT                   /db_xref="GOA:C7RIX5"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX5"
FT                   /protein_id="ACV33461.1"
FT                   /translation="MACLLMLAMIILASLAGYSLSRLLPWSSEARRAGVCVAAGLALGP
FT                   FLLGAGGVLTLGILAGALPSTHLVAVVVGLLGVALLALWRGRGIPQKEDDCRRAPRQFG
FT                   ELLVSGLLTLWIVALLVNVIFLPLTANDSLEYATVARLLYETRDLVSYPAIQPELSTSG
FT                   FFGPWTHPPLYVSLSYLTQIIQGHADEPGFMRFVSPWFAVCSTLLIITLGSLLKRLFGL
FT                   ISALIFLSTPLLFSGADSASIDALPVLAIGLIVASVVCLEARPFVRGLFSGCAVALGLW
FT                   THSQAILFFPLALGAIALQNGLARWRTTTIESVALCASALLLGGWPYWRNVRIFGNPIS
FT                   DSPAVFALPSLDWTGYFSYARGLDNWAAVLQYGLLKGWFSFQSFGWAFWLMTLGVVLAI
FT                   KPLRHPTWRATLLCGGRQALDSGSQLLWVSLGLISIYLGGVFASTLIGIDLMIKNDRYS
FT                   LVILPCVSLLGGYGAHVLLCRGASSLADTETGSVKRDFLAGVGFFLGVALLVQFVVQGV
FT                   YYRWRYVPAAVQISEADTPAAEAIKRSKLDKPLSQRRLEYFPNMAAMFWTRGNLPENAL
FT                   LLSLRPADMYYAQRKMVSYLDERLLPVYRETSPPRAAQMLRDLGITHLHVPDYGLPVMY
FT                   NSVLDRIIDDPALSRLMYSASGTQVFQLASEGNAGRALLSFEFTDFTPATTDWTQYRQL
FT                   NLGGQRLASALGFLSKRLPKDGISSSEWHVPLFHRDFSTMVANGRGRPLAVARHDLLPS
FT                   IRGGEEYRVTFDLAGNAFVKLWLVQFDEKGRLLLSGEYSSGVDRIAEVVLNHPDETRRV
FT                   SRRFLALPDAAYVRFGVEHLGYSEIQVRRAVLEHLGRPDSAVGGKGR"
FT   sig_peptide     108884..108949
FT                   /locus_tag="CAP2UW1_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.909 at
FT                   residue 22"
FT   gene            111917..113871
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0096"
FT   gene            112554..113657
FT                   /locus_tag="CAP2UW1_0097"
FT   CDS_pept        112554..113657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0097"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33462"
FT                   /db_xref="GOA:C7RIX6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX6"
FT                   /protein_id="ACV33462.1"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT   gene            complement(113917..114774)
FT                   /locus_tag="CAP2UW1_0098"
FT   CDS_pept        complement(113917..114774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33463"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX7"
FT                   /protein_id="ACV33463.1"
FT                   /translation="MKPYCGRQFTLDELQTLRHLIEANPSASRAQLSRQVCALLDWFKP
FT                   NGELKDMTCRVAMLRMQADGLLTLPAAQRCAPRQPEYLATAATDPQSLLVRPVHELPPL
FT                   HLRQVSGSAHSRLWNEYIARYHYLGYTPMAGSQSRYFVFAGEHRVALLSFGASAWKLAA
FT                   RERFIGWQEDERQRNLPLVVNNARFLILPWIQSKGLASKILAIIHRQLPNDWLARYGYR
FT                   PVLLETFVETPRHRGTCYQAANWIKVGQTTGRGKKCPTSKPILPIKDIWLHPLHRNFRS
FT                   ILCR"
FT   gene            complement(114771..116271)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0099"
FT   gene            116701..119960
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0100"
FT   gene            118321..119646
FT                   /locus_tag="CAP2UW1_0101"
FT   CDS_pept        118321..119646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0101"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33464"
FT                   /db_xref="GOA:C7RIX8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX8"
FT                   /protein_id="ACV33464.1"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARHGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDCVVGLQFMREAAPG"
FT   gene            complement(120376..121629)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0102"
FT   gene            121819..123165
FT                   /locus_tag="CAP2UW1_0103"
FT   CDS_pept        121819..123165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0103"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ajs:Ajs_3022 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33465"
FT                   /db_xref="GOA:C7RIX9"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX9"
FT                   /protein_id="ACV33465.1"
FT                   /translation="MRSVLVLVGGTAFAHAITGLALPILTRLYTPADFSILAVFASLLS
FT                   IVAVAACLRFDIAIPMPGRDSEAFNLLALAIGCAVVVSVGAGALVLLAPSWLPEITGRL
FT                   DLQPYLWLLPFGILLASAYSALQNWFVREKEFSLIARSRVAQSAASAGMQIGMAGFGAG
FT                   PVGLMFGYLLNTGSACVILAFRLVRHERFRQNIEGLTCSSLKQAWLNFSRFPKYSTLEA
FT                   LANSAAIQLPVIMIAALAAGPEAGYLLLAMSVIQAPMALFGTAIGQVYLSHAPEAHREG
FT                   GLGSFTTDVFGRLVRAGVGPLLAVGIIAPVIFGALFGEGWERAGWLVTWMTPCFIMQFL
FT                   ATPISMALHVTGKQRAALLLQVFGVVLRVCAVWAAAQFPNGSISEAYAISGLLFYLFYI
FT                   WTILYCVKCHCGEILQKALGGIWVSLAWVGVAIVFVLVWTTIMPMQPDR"
FT   sig_peptide     121819..121869
FT                   /locus_tag="CAP2UW1_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.671 at
FT                   residue 17"
FT   gene            complement(123548..124651)
FT                   /locus_tag="CAP2UW1_0104"
FT   CDS_pept        complement(123548..124651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0104"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33466"
FT                   /db_xref="GOA:C7RIX6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX6"
FT                   /protein_id="ACV33466.1"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT   gene            124915..125892
FT                   /locus_tag="CAP2UW1_0105"
FT   CDS_pept        124915..125892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0105"
FT                   /product="transposase"
FT                   /note="KEGG: eba:ebA3230 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33467"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY1"
FT                   /protein_id="ACV33467.1"
FT                   /translation="MLGWEHWGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPS
FT                   ACSGWSETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSI
FT                   DGLGPLSYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWIE
FT                   GYERVAELAAEVPDTRLVYVADRESDMIELMARAGELDTPADWLLRAQHDRALPNGEKL
FT                   WQTVTSGEELGGISFTLPARDGQKARVVRQQLWARVVDLPHGKNQTIRATCVVAKEIDP
FT                   PAGSTPVDGLSGDLTDRVGAIAQVGEKNDRVPTGRRRGHWRAEN"
FT   gene            126411..127658
FT                   /locus_tag="CAP2UW1_0106"
FT   CDS_pept        126411..127658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0106"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rxy:Rxyl_0689 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33468"
FT                   /db_xref="GOA:C7RIY2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY2"
FT                   /protein_id="ACV33468.1"
FT                   /translation="MAIKVLYIDGEGAFGGSSRSLFEAVKAFPEGAVLPYFLATRGTAL
FT                   DFYKQLAVDIITTRGMPRFDNTRYGYYRGVRWLILLRELFYFPFVIVALVRARLRWKDI
FT                   DLVHVNEFVYVLPGLIGKWLFHVPLVVHVRALARFGDGSIRTRVLNSMFSRYVDSVVAI
FT                   DGNVRATIPSDWPVTVINNSFTPGLASSPEKPLVDKLGSLPSGSFKVGFVGNLHRSKGV
FT                   FEIVDAAKLIKTSGREVDFLMVGGVTMDDVGLKAWVLSKMGFAQNVRADLARRVDQEGL
FT                   GGFFHFLGPTLNIKYVYDRLDVLLFPSHFDAPGRPVFEAGFSGVPSIVAVKKPMPDTFI
FT                   PGETGLAVSGRCPAELAKAILYLEANRSEQKRMGSNARRLAEENFDPCKNSKRLLGVYH
FT                   GIVGGKSSAQILRKRG"
FT   gene            127860..129017
FT                   /locus_tag="CAP2UW1_0107"
FT   CDS_pept        127860..129017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0107"
FT                   /product="LPS biosynthesis protein WbpG"
FT                   /note="KEGG: pap:PSPA7_1978 LPS biosynthesis protein WbpG"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33469"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY3"
FT                   /protein_id="ACV33469.1"
FT                   /translation="MTEKPVRSSSWKICAHCVMDTSDPSIAFDESGVCEYCNNYKNEIL
FT                   PNWHTDAQGATELAALADKIRAEGRGKDFDCIIGLSGGLDSSYAAHVAKERMGLRPLLF
FT                   HVDAGWNTNQAVGNIEKLVDGLGLALYTEVINWEEMKDLQLAFLRSQIADQDLPQDAAF
FT                   FSALYMFARKHRIKYVITGANFSTECCREPEEWGGYPGIDTTLFQSIHSRFGQRALKTF
FT                   PLVDIFVYKILYQKLMGMTVVKPLNLVPYIKKDAEAELERRFGWQRFQHKHHESRFTRF
FT                   YEDYWMPRKFGFHKRRAHFSSLILTGQMTRDEALDRLSRPEMDEHFLKQEFEYVANKLD
FT                   LTVAELQEIFEGPNKTYRDYKNKRWAIGVGADVMRRLGLERRLFR"
FT   gene            129014..129628
FT                   /locus_tag="CAP2UW1_0108"
FT   CDS_pept        129014..129628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0108"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: bba:Bd1691 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33470"
FT                   /db_xref="GOA:C7RIY4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY4"
FT                   /protein_id="ACV33470.1"
FT                   /translation="MIHIVDYGLGNTQAFVNMYKRLGIEAVRAASGAELRGASKLILPG
FT                   VGAFDHAMELLDASGMCQPLEWLVREDKVPVLGICVGMQLLAGSSDEGVSAGLGWVDGR
FT                   VRSFAGNPASVALPMPHMGWNDVIPAAGSPLFKGLEEDARFYFLHSFYFECSDPASVAA
FT                   RADYGFQFHCAVQNGNVFGVQFHPEKSHHWGAALLKNFADL"
FT   gene            129630..130427
FT                   /locus_tag="CAP2UW1_0109"
FT   CDS_pept        129630..130427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0109"
FT                   /product="histidine biosynthesis protein"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   gur:Gura_1692 imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33471"
FT                   /db_xref="GOA:C7RIY5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY5"
FT                   /protein_id="ACV33471.1"
FT                   /translation="MLRPRIIPCLLVHQGGLVKTVEFKDPKYVGDPINAVKIFNEKEAD
FT                   ELVVLDIDASVNGAEPDYRMIANLAAECRMPLCYGGGVHTPKQAKTIIGLGVEKVAMSA
FT                   AAADDATLVTRTADAIGRQSVVVVLDVRRKNGLFAKGYEVFTHNGKRSTKTDPFELAQA
FT                   MQAAGAGEIVINSIDRDGQMKGYDLTLAARMRRELRIPLSFLGGAGSYQDIEALLGECG
FT                   VVGASAGSLFVFKGPYRAVLINYPNPEQKNGICRSGLAAYSSK"
FT   gene            130438..131466
FT                   /locus_tag="CAP2UW1_0110"
FT   CDS_pept        130438..131466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0110"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; Polysaccharide
FT                   biosynthesis domain protein; KEGG: pen:PSEEN1500
FT                   polysaccharide biosynthesis protein; O-antigen biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33472"
FT                   /db_xref="GOA:C7RIY6"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY6"
FT                   /protein_id="ACV33472.1"
FT                   /translation="MFKNKTLLITGGTGSFGNAVLRRFLDSDLREIRIFSRDEKKQDDM
FT                   RKRYHDAKLMFYMGDVRDYQSVLNAMRSVDFVFHAAALKQVPSCEFHPLEAVKTNVLGT
FT                   ENVLEAAINCGVKRVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRGSSETVICGTRYG
FT                   NVMASRGSVIPLFIEQIRAGKPITITDPNMTRFMMTLDSAVDLVLYAFKHGNSGDIVVQ
FT                   KAPAATVATLAKALTWMLGVPNHEICVIGTRHGEKLYEALLSREERVAAEDMGGYYRVP
FT                   PDLRDLNYGKFVEEGEPKISVSEDYNSHNTERLEVEELKQLLLRLRFMQAIVRGENAHP
FT                   EE"
FT   gene            131470..131740
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0111"
FT   gene            131743..131952
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0112"
FT   gene            131982..133094
FT                   /locus_tag="CAP2UW1_0113"
FT   CDS_pept        131982..133094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0113"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ppg:PputGB1_1374 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33473"
FT                   /db_xref="GOA:C7RIY7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY7"
FT                   /protein_id="ACV33473.1"
FT                   /translation="MTMRVLVTGSKGFVGTNLTVRLGELACYEAIGFAREDSLDDLAER
FT                   VGRADAVVHLAGVNRPKDIKEFAEGNANLTAELCDLIAATGRRIPLIISSSVQADLDNP
FT                   YGESKRGAEVAGETLAERTGNPVSIYRLPGVFGKWCRPNYNSVVATFCHNIANDLPIQI
FT                   SDTAFALSLVYVDDVVGEFIRALDAMPAGLSRGEVSTVYGITLGDLAAQIEAFKNCRES
FT                   LVSERVGAGLVRALYATYVSYLPPAKFAYDLPKYGDERGVFVEMLKTQDSGQFSFFTAH
FT                   PGITRGGHYHHTKTEKFLVIKGSARFGFRHIVTNEPYEVFTSGDRPQVVETVPGWTHDI
FT                   TNIGGEEMVVMLWANEIFDRAQPDTIACKV"
FT   gene            133096..134229
FT                   /locus_tag="CAP2UW1_0114"
FT   CDS_pept        133096..134229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0114"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   pen:PSEEN1502 UDP-N-acetylglucosamine 2-epimerase Wbjd"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33474"
FT                   /db_xref="GOA:C7RIY8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY8"
FT                   /protein_id="ACV33474.1"
FT                   /translation="MKKMKVLTVVGTRPEIIRLSRVLAKLDEHCEHVLVHTGQNYDYEL
FT                   NQIFFDDLGIRRPDHFLNAAGATGAETIGKVIIAVDGVLGVENPDAMLVLGDTNSCMAV
FT                   IPAKRRKIPVFHMEAGNRCFDMRVPEEINRRIVDHTADINLTYSTIARDYLLREGLAPD
FT                   TVIKTGSPMFEVLTYYRQGIEESDVLTRLQLEAGRFFVVSAHREENVDSEKNFGKLVGV
FT                   LNRIAEHYGYPVIVSTHPRTQKRVDAMGVVFHSLVRLLKPLGFKDYNKLQMMAKAVLSD
FT                   SGTITEESSILGFAALNIREAHERPEGMEEAAVMMVGLEEVRIMQALQILEAEFSSSSA
FT                   RSVRPIADYSMPNVSEKVVRLIHSYADYVGRVVWKRY"
FT   gene            134242..135489
FT                   /locus_tag="CAP2UW1_0115"
FT   CDS_pept        134242..135489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0115"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pap:PSPA7_1983 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33475"
FT                   /db_xref="GOA:C7RIY9"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIY9"
FT                   /protein_id="ACV33475.1"
FT                   /translation="MRILVVSQYFWPENFRVNDLVSELGTRGHQVTVLTGYPNYPSGEV
FT                   FPEFRSNPADYSEYAAAKVVRVPLLPRGSGGLRLLLNYLSFALSASVLGAWRLRGQIFD
FT                   VIFVFEPSPITVGLPAVLLRALKRAPVAFWVLDLWPETLEALGVVRSPAVIKLVGRLVS
FT                   FIYNRCDLVLAQSRSFIPQIRKYCAGDKRVEYFPSWSDSDFALSAVQPAAEVPAAEGVF
FT                   SVMFAGNMGDAQDFPAILDAAEIVKHDRKVRWLIVGDGRASGWVKAEVERRGLGESFLL
FT                   LGRHPVERMPSFYKHADALLMSLQDKPIFAMTIPGKLQSYLAAGIPVLAMLNGEGADIV
FT                   RRCGAGVACPAGDGRALAAAVRELAGRQRQELMAMGARGAVLSQTEFDRATLISRLLSA
FT                   FTCLAEGRPEWQEVSE"
FT   gene            135486..136451
FT                   /locus_tag="CAP2UW1_0116"
FT   CDS_pept        135486..136451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0116"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: pol:Bpro_3986 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33476"
FT                   /db_xref="GOA:C7RIZ0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ0"
FT                   /protein_id="ACV33476.1"
FT                   /translation="MILVTGATGFVGRALCAALIRSGSIRIAVRNTAGESPADGVDVVR
FT                   GELSATADWSAAMAGVVAVVHCAARVHVMNDDAVDPLAEFRRINVEGSLQLARQAAAAG
FT                   VRRFVFLSSIKVNGEQTDPGRPFTADQAPGPLDPYGISKMEAEAALRALARETGMAVVI
FT                   IRPPLVYGPAVKGNFLAMMRALWRGIPLPLGAVTANRRSLVALDNLVDLIVTCIAHPAA
FT                   ANQTFLVSDAEDLSTAALLRRMGQALGRPARLLPVPVGILRLAATLLGRPGIAQRLCGS
FT                   LEVDIDKTRHLLGWSPPLSVDQGLQRTAAHWMTAPQSARR"
FT   gene            136473..137039
FT                   /locus_tag="CAP2UW1_0117"
FT   CDS_pept        136473..137039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0117"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: pna:Pnap_3481 sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33477"
FT                   /db_xref="GOA:C7RIZ1"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ1"
FT                   /protein_id="ACV33477.1"
FT                   /translation="MSMKRFFDLLLGLCTATVLALPILIVAVLVRLTSRGPALYWSDRV
FT                   GKGNAIFRMPKFRSMRVGAPTVATHLLQNPEAYLTPIGSFLRRSSLDELPQLWSILVGD
FT                   MSFVGPRPALFNQQDLVALRTEYGVHRLLPGLTGWAQVNGRDELPIPEKVRLDVEYLQR
FT                   ASLTFDIHILWLTAVKVLRREGVSH"
FT   sig_peptide     136473..136535
FT                   /locus_tag="CAP2UW1_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.514 at
FT                   residue 21"
FT   gene            137151..139082
FT                   /locus_tag="CAP2UW1_0118"
FT   CDS_pept        137151..139082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0118"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: mms:mma_2254
FT                   nucleoside-diphosphate sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33478"
FT                   /db_xref="GOA:C7RIZ2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ2"
FT                   /protein_id="ACV33478.1"
FT                   /translation="MMKAFLSLSRGRKQAVAIVTDFALLLLALWSALALRFETWTPSFA
FT                   TYGWQVLAAPLLAIPIFIRLGLYRAVIRFMEDRVVFVVTGGVALSVVLLAAGIALTHTP
FT                   GLSRGVLGIYCMLAILYVGTARFLARSYFLRAERAEDSRKRVAIYGAGSAGTQLAYALR
FT                   AGREYLPVAFVDDNAALQRIEVAGLRVQSPDQLMPMMAAGRIEEVLLAIPSASRSRRAE
FT                   IIGSLEGLHCKVRLVPGMADVVSGNVTADAIREVEIEDLLGRESVAPDAALLGRCVTGK
FT                   VVMVSGAGGSIGAELCRQIVQLRPSRLVLMERSEFALYSIEQELATLCVGGSACVELVP
FT                   VLGSVLHQKRNEMVMKSFGVQTVYHAAAYKHVPLVEHNPIEGLRNNAVGTRRMAEAALA
FT                   AGVGTFVLISTDKAVRPTNVMGASKRLAELILQALARSGGGTRFCMVRFGNVLGSSGSV
FT                   VPLFRRQIAAGGPITLTHAEITRYFMTIPEAAQLVIQAGSMGEGGEVYVLDMGKPVRII
FT                   DLARRMVHLSGLEVRDEEHPDGDIAIEVVGLRPGEKLYEELLIGENVEGTTHPLIMRAH
FT                   EHELPWALLAERLAVMDDACQRFDYEQALALLVSLVKEYSPAPHGDGDGELLWNAMTRP
FT                   GRGEVVVH"
FT   gene            139104..139529
FT                   /locus_tag="CAP2UW1_0119"
FT   CDS_pept        139104..139529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0119"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   xac:XAC1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33479"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ3"
FT                   /protein_id="ACV33479.1"
FT                   /translation="MSQIQRAQDWEMTAFDLWQKLRAGWRRGVGGAAIGLLVAGLAIAR
FT                   TPPQYEAVAVVQVGPIGQIGQQNGPLRLVPSLPVEPPANAVERIKTAASQSSVAEHPGN
FT                   QAWIDALRASPSVCAAYLSAQVAQDDRQSAGVGIRVD"
FT   gene            139629..140015
FT                   /locus_tag="CAP2UW1_0120"
FT   CDS_pept        139629..140015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33480"
FT                   /db_xref="GOA:C7RIZ4"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ4"
FT                   /protein_id="ACV33480.1"
FT                   /translation="MARMQVALALARAKLASAEMETESLNRFVANAGIKDDRFTQLSLL
FT                   TSLRLQKESEFFNQGPIVSMLEAALNPPATQSSEAIEPVFVSDKPVSPTKGLLLALGLI
FT                   GGLFAGVVSVCLPAMPGGARELNA"
FT   gene            140097..141995
FT                   /locus_tag="CAP2UW1_0121"
FT   CDS_pept        140097..141995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0121"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver;
FT                   Metal-dependent hydrolase HDOD; KEGG: tbd:Tbd_2023 response
FT                   regulator receiver modulated diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33481"
FT                   /db_xref="GOA:C7RIZ5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ5"
FT                   /protein_id="ACV33481.1"
FT                   /translation="MNTIEQLRLSGRLPSPKGVALAIMEITRREETTLDEVARVVQSDP
FT                   ALSSRLLRLSNAAARGRPVVSISEAVMRLGMATVRRLAMAFSLVDQYLEGPCPSFDYPG
FT                   FWSHSLFMAVASQELGRLLPAASPDELFACGLLAQVGSLALVTVYPADYARLLTESCHG
FT                   VALMELERRRLGVDHSEFTVAIMADCGIPKALTEPVYYHEVPETSGFAEGSRPYQLVNL
FT                   FFQARRMADLGRSAVTEPHGSISELMLLGGKIGLDATALGEVFDQVVRQWQEWAELLKV
FT                   PVGHLPSFDAMANAPVPRPEQEAAATGTRQVVLLVEDDPTTRMMTEGVLSHLLGCTVHT
FT                   AENGREALALALEVTPQIVVTDWLMPVMDGLEFCRALRATDWGQSMYVIMLTGEETEEK
FT                   IIEAFEAGVDDYVTKPVNVRALSARMRAALHYVKLLDAWERDRAQLKQFAAELATSNRR
FT                   LEHAAMTDLLTDLPNRRAGMESLARFWSASMRTGQPVAALMIDVDFFKSVNDRHGHAVG
FT                   DRVLQEVARAIQSAARKDDSVSRIGGEEFLLVCHDADPRAALLAAERLRRMVKALKISV
FT                   GGVDIQVSVSVGVASREAGMESEDDMLRAADKALYAAKNAGRDRVCLFALGKARCA"
FT   gene            142173..143582
FT                   /locus_tag="CAP2UW1_0122"
FT   CDS_pept        142173..143582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0122"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: dar:Daro_3211 exodeoxyribonuclease VII large
FT                   subunit; TIGRFAM: exodeoxyribonuclease VII, large subunit;
FT                   PFAM: Exonuclease VII large subunit; nucleic acid binding
FT                   OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33482"
FT                   /db_xref="GOA:C7RIZ6"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ6"
FT                   /protein_id="ACV33482.1"
FT                   /translation="MSDIPSPATGLPAFVPVIAVSLLNRLARERLEAAFPLCWVAGEVS
FT                   NLSHAASGHVYFSLKDAAAQVRCVMFRSRTQLLGWRLENGQHIEARVLVTLYEARGDFQ
FT                   LNVEAARRAGVGNLYEKFLRLKEKLESEGLFASAGKRPLPGFPRRIGIVTSLQAAALRD
FT                   VLSTLARRAPQVGIVVYPTLVQGEGAASQIAESIRIAGERRECETLIVCRGGGSMEDLW
FT                   AFNDELVARAIRACPIPVVSGIGHETDFTIADFAADQRAPTPTAAAELAAPEQLVLLAR
FT                   LAARQLALRRSVDQQINQRGQQLDWLTRRLQHPAQYLAHQREVLRNQQRQLAAALLQAS
FT                   ARARTALADLSRRLLLARPETSRRTGQVEALAARLRGAWQQAAQRQGADLARLTASLAH
FT                   LNPAAVLARGYCVALDERGRIVRDSRSVEPSQRIAVFFERGRADAAVLAVFPDGGLAPA
FT                   VAAIASKAGPE"
FT   gene            143673..144260
FT                   /locus_tag="CAP2UW1_0123"
FT   CDS_pept        143673..144260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0123"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   dar:Daro_3212 manganese and iron superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33483"
FT                   /db_xref="GOA:C7RIZ7"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ7"
FT                   /protein_id="ACV33483.1"
FT                   /translation="MEHQLPQLPFAMDALAPHMSRETFEYHYAKHHQAYVTNLNNLIKG
FT                   TEYEALDLEAIIRKAPAGGVYNNSAQVWNHTFFWNCLTPNGGGAPGGALAAAIDAKWGS
FT                   FAEFSKAFQTSAVGNFGSAWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLCIDVWEHA
FT                   YYIDYRNLRPKYVETFLASLANWRFAEQNFAG"
FT   gene            complement(144337..144816)
FT                   /locus_tag="CAP2UW1_0124"
FT   CDS_pept        complement(144337..144816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0124"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: azo:azo3385 single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33484"
FT                   /db_xref="GOA:C7RIZ8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ8"
FT                   /protein_id="ACV33484.1"
FT                   /translation="MASVNKVILVGNLGADPETRYSANGDAICNIRMATTDRFRDKASG
FT                   ELKDSTEWHRVVFFGKLAETAGQYLKKGRQIYVEGRIRTNKWQDKDGNERYTTEIIANE
FT                   MKMLGSREGMGSPASSESEYGGSMPSSAAPASGAARSAPAKKTPSFDDMDDDIPF"
FT   gene            complement(144867..146072)
FT                   /locus_tag="CAP2UW1_0125"
FT   CDS_pept        complement(144867..146072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0125"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: eba:ebA3858 putative
FT                   MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33485"
FT                   /db_xref="GOA:C7RIZ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIZ9"
FT                   /protein_id="ACV33485.1"
FT                   /translation="MSVSTTDRMSSDEKRAGVSLAAVFALRMLGLFLILPVFAIYAKEL
FT                   PSGNDVALVGIALGAYGLTQACLQIAYGAASDRFGRKPVIVFGLIVFVIGSFVAAFAGD
FT                   IYIVIAGRVLQGAGAISAAVTALAADLTREQHLTKVMAMIGSSIGLVFAISMVGAPLLF
FT                   VSIGMPGIFALTGILALLAIFVVIRVVPAAPAVPRQPTWQSFVEVLAHRQLLRLNFGVF
FT                   ALHLMLTAMWVLLPAELISTGGLPVAEHWKVYLPALLLSFVIMVPAIIVAERFSRMKLI
FT                   FNAAIVLLLLVQFGFGLFSAGLYGLAFWLTLFFVAFNILEATQPSLISRIAPPHAKGAA
FT                   LGVYNTTQALGLFLGGVFGGVLAKYAGPGAVWAGGAALALVWLMLGLSMSIPPLRTRQQ
FT                   AA"
FT   gene            146143..149016
FT                   /locus_tag="CAP2UW1_0126"
FT   CDS_pept        146143..149016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0126"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: dar:Daro_0473 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33486"
FT                   /db_xref="GOA:C7RJ00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ00"
FT                   /protein_id="ACV33486.1"
FT                   /translation="MDETREIRIRGARTHNLKNVSLDLPRNRLIVITGLSGSGKSSLAF
FT                   DTLYAEGQRRYVESLSAYARQFLQRMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTV
FT                   TEIHDYLRLLFARAGTPYCAEHQQPLEAQTVSQMVDHVLALPEGTRLMILAPVVANRKG
FT                   EQLELFAELRAQGFARLRVDGQIHEIDALPKLAKTHKHTVDVVVDRLKVREDLRQRLAE
FT                   SFETALRHADGRAIAYEMDNEHEHFFSAKFACPVCSYSIQELEPRIFSFNSPMGACQKC
FT                   DGLGVIQFFDPKRIVVRPELSLAAGAIRGWDRRNPFYFQMLCSLAEHYGFAVDTPFDAL
FT                   PDNVRQVVLYGSGRQELPFSYVNERGRPSVRQHAFEGIVVNLERRYKETDSNAVREELA
FT                   RLISNRTCPACHGSRLREEARNVRVGVRASARTLHEINRLPLAEARAYFLALQLPGNKA
FT                   QIAEKVLKEIVSRLQFLIDVGLDYLSLDRSAETLSGGEAQRIRLASQIGSGLTGVMYVL
FT                   DEPSIGLHQRDNERLLKTLKRLRDIGNTVIVVEHDEEAIRGADYVVDIGPGAGVHGGYV
FT                   VAEGVPQAIIDNPASLTGDFLAGRRCIAMRAVRRQPEAGRVLQIIGARGNNLRDVSVDI
FT                   PLGLLTCVTGVSGSGKSTLINDTLYTAAARHLYGASSEAAEHDRIVGLEYFDKVINVDQ
FT                   SPIGRTPRSNPATYTGLLTPIRELFAGVPESRSRGYGPGRFSFNVKGGRCEACQGDGVL
FT                   KVEMHFLPDVYVPCDVCHGKRYNRETLEVQYKGRNIHEVLQMTVEVARAFFDAVPVVAR
FT                   KLQTLVDVGLSYITLGQAATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFQD
FT                   IEMLLTVLHRLVDHGNTVVVIEHNLDVIKTADWLIDLGPEGGAGGGRILAVGTPERVAL
FT                   EEESHSGRFLRPLLMRRREASAARLGE"
FT   gene            149262..149546
FT                   /locus_tag="CAP2UW1_0127"
FT   CDS_pept        149262..149546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0127"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: tbd:Tbd_0007 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33487"
FT                   /db_xref="GOA:C7RJ01"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ01"
FT                   /protein_id="ACV33487.1"
FT                   /translation="MNKSELIDAIAARSELSKAAAAKALDAVIETIVDSVAQGETVTLV
FT                   GFGSFKASGRASREGKNPKTGEKIHIPETTVPKFSAGATFKARVAGKDV"
FT   gene            149657..150166
FT                   /locus_tag="CAP2UW1_0128"
FT   CDS_pept        149657..150166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33488"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ02"
FT                   /protein_id="ACV33488.1"
FT                   /translation="MRLCTALATAALALMPLAVSAQQAPAAEALTAVAPGKFAGMIEAK
FT                   VTLVVESIDKATRGVVLKDAKGDQIKIVAGDEVKNFDQIKVGDNVIATYTQGLVITLKK
FT                   GGGALRERIDSGETASAAKGEKPAGYEVKEVTFVALPPIMFRPPERTWEEAVRWQRVSR
FT                   EGGGRV"
FT   sig_peptide     149657..149722
FT                   /locus_tag="CAP2UW1_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 22"
FT   gene            complement(150140..151198)
FT                   /locus_tag="CAP2UW1_0129"
FT   CDS_pept        complement(150140..151198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0129"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dge:Dgeo_3112 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33489"
FT                   /db_xref="GOA:C7RIL9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIL9"
FT                   /protein_id="ACV33489.1"
FT                   /translation="MGKTDKLADEVRFGLEEALPGMRKTILKKLPLAVAAMIQARTPNT
FT                   MELSTLLALNTERADMREQWLRRLLTNRLIRSAGVLEPFARRALEQAAAGGQTILLSMD
FT                   QTDLGDRFAVLMISVRRGDRSLPLVWRIEEGEANIGFAGQQVLLEEVRAWLPEGAAVML
FT                   LADRFYPSVALFEWLLATGWQYRLRLKGNLLVDVGCAGIGTTGELAAGVRERYEANARL
FT                   FEAGIPMAIGVLHEPGHPEPWIIAMDCPPNRAAVRDYGARWAIEPMFSDFKSRGFRLED
FT                   TKLEAPKRLDCLILIMALAMYWCVQAGQEDARCNPTATEKKPVSRPTPTIGVSAKPIAV
FT                   PFPGSNAASAFS"
FT   gene            151551..151626
FT                   /locus_tag="CAP2UW1_R0003"
FT                   /note="tRNA-Ala2"
FT   tRNA            151551..151626
FT                   /locus_tag="CAP2UW1_R0003"
FT                   /product="tRNA-Ala"
FT   gene            151908..153350
FT                   /locus_tag="CAP2UW1_0130"
FT   CDS_pept        151908..153350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0130"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: dar:Daro_1156 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33490"
FT                   /db_xref="GOA:C7RJ04"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ04"
FT                   /protein_id="ACV33490.1"
FT                   /translation="MSDVNSEGHSGDAVAERLAKYVVDALPIPMFAIDAEHRVVFWNAS
FT                   CERITGIPGKFMLRKAGAWSAFYPSRRPVMADLVLTGCRHEDLERYYEGKYRPSVLVEG
FT                   GWECEDFFPQLPAGGKWLAFTAAPLRDGEGRVIGAVETFRDITAQREAERAARDGAVLL
FT                   SEIVQGCPVPMFVIDAEHRVTHWNRACESMAGVPAEQMIGSRQHWWPFYPEPRPVMADL
FT                   VLDAAIGEVEKFYAGKYQPSRLIAGAWEAKDHFPQFPGGGRWLYFTAAPLHGADGRVIG
FT                   AVETLQDISEQKRYEAQLEDQARQDLLTGLANRRVLEERLKQALAQAARDGRVVAVAFI
FT                   DLDHFKPINDEMGHAAGDALLRELATRLTSMVRDVDTVARVGGDEFVVVLSAPESAEAV
FT                   EGVIRRIIDAVGRPVTIAGREVQVGCSVGIALYPDHGTDQAGLLRDADTAMYIAKAAGR
FT                   NGYHVHCQSADVPPPLGDSPAP"
FT   gene            153426..153884
FT                   /locus_tag="CAP2UW1_0131"
FT   CDS_pept        153426..153884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33491"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ05"
FT                   /protein_id="ACV33491.1"
FT                   /translation="MQRPPHFHGLVAGSVLLALASVADAQALFLARRAIGRIEQMAQSS
FT                   PTTGAAYDVATVIVEVTADKVFETVKRLLAQNTQLRVTRSDDAKRSIEFTDGTQIGGIQ
FT                   VNPLNDSLSQMMVSTAHPGIASSTTSTIVARTLAMCRELNVVCEQGQS"
FT   sig_peptide     153426..153503
FT                   /locus_tag="CAP2UW1_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.644 at
FT                   residue 26"
FT   gene            154602..157529
FT                   /locus_tag="CAP2UW1_0132"
FT   CDS_pept        154602..157529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0132"
FT                   /product="transcriptional regulator, putative ATPase,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: mpt:Mpe_A1734 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33492"
FT                   /db_xref="GOA:C7RJ06"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ06"
FT                   /protein_id="ACV33492.1"
FT                   /translation="MIERPASGRPKGEPHPLRVRFDRFELDEANARLLRDGTAVALAPR
FT                   PFAVLCALVRHAGSLLTTNALLDEVWGHQFVTDSVLRTAISELRTVLDDDARKPRYIET
FT                   VSRRGYRFVAAPSALAAAPGVQPSVSGFTAAHVPYFIGRAEPLSRLRRTWDTACSGKRA
FT                   VGWIVGEPGIGKTTLIEQFIARLGNVACARGQCVDHYGTAESYLPVLEALDELCRSDSE
FT                   VPSLLRAVAPTWLLQLPWLSTTDEREALRRELAGVSPDRMLREMGQFLDRYTERRPLLL
FT                   VTEDLHWSDRATIQLIDYIARRRGSARIMWLASFRLAEVVALDHPLNPLRHELRLHDLC
FT                   EEIVLDPFSESEVADYVAARSPAIATDEAFVRALHERTDGVALFVASVMTEVITRAEHA
FT                   GDNASAGSQLAKIAVAEHLAAIIDHYIAKLTGDQRLVLSAAAVCGIEFGIPTISGALER
FT                   DAFWVGQTCDELARAQLWLVAPRPQGGNNAAELPYSFRHALFRQVLYEHTNPSIRSQLH
FT                   RKVGTTLERERAAGASVAAAELAMHFELGREPMAALRHYVAAAEAALARLSPRECMNLT
FT                   EHALTLLGQAPEGTQRNALEIALATFHGVAATHVHGISHPEAKIAFQRAYALLADIPDH
FT                   SMRGRLLHGFAFVLSLRADYAEALAVAERAEALSSAPNDPVLVLVTCIVHGYVAQLQGR
FT                   LRAAGTWIERGLVAAELLELAPVEIFVADPQVTLLGLQGIHLLHSGFVEQARARLERAH
FT                   ARALLLGWPNTRLAALWYAALFEVRLGNAERVAALADEMRALVDESKVAQGRTACRWFR
FT                   GWADARMGRPRDGYRRIREAYEDNTQLGMLAGGSEVLGYATEALVLAGDWDGAQHELED
FT                   ALQVANTLGERVYLPQLFVMQAVIGRARGDRAAADAAIRRAIVEARAQEAPWLELMALI
FT                   ELCERHSATAEDRRALAELVDQLPEALDTPAAARARALLAKAKSG"
FT   gene            157636..157851
FT                   /locus_tag="CAP2UW1_0133"
FT   CDS_pept        157636..157851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33493"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ07"
FT                   /protein_id="ACV33493.1"
FT                   /translation="MTFNTDCKYPTRRAYVVKVRGDAKPDALAGRLENLVTGRQCEFVS
FT                   GRELLESLASDLDATPHEQPSNAQSE"
FT   gene            157905..158240
FT                   /locus_tag="CAP2UW1_0134"
FT   CDS_pept        157905..158240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33494"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ08"
FT                   /protein_id="ACV33494.1"
FT                   /translation="MTEPHDHGQIAWWAENIDELDREIARLCLLCQVRILDPGIIERVL
FT                   EKDASVCGTPNPVAFAKLRDMLMFYFVIREKSVDAVGELQTEQIEAHVIEQIRNRFGDL
FT                   LGKWPPA"
FT   gene            158253..158699
FT                   /locus_tag="CAP2UW1_0135"
FT   CDS_pept        158253..158699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33495"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ09"
FT                   /protein_id="ACV33495.1"
FT                   /translation="MDSAIISAMAGVLGSLVGGSAAFATAWITQKTVSQRELIQGDMRK
FT                   RETLYGEFIGECAKLLIDAFVHTLDDPEKLLPLYALTNRIRLTASQPVLAEAERLLSHI
FT                   TDQYFSRNLTVQEMGQLARSVGADPLKAFGEACRAELKLIRARL"
FT   sig_peptide     158253..158327
FT                   /locus_tag="CAP2UW1_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.668 at
FT                   residue 25"
FT   gene            158788..160290
FT                   /locus_tag="CAP2UW1_0136"
FT   CDS_pept        158788..160290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0136"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bph:Bphy_3507 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33496"
FT                   /db_xref="GOA:C7RJ10"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ10"
FT                   /protein_id="ACV33496.1"
FT                   /translation="MSNPANPSIPFRHFRVLAASVALALAGCTTPVLKPSLDVPDRFGA
FT                   ATAPVDEPEVAWWEGFKDPVLADLIRRAAQENRDVKIAAERLRAARAGETISRSWLFPA
FT                   VGLAGDAFDHKTNYDSVLKSVVPEAANTKAAQIGVGVTWEVDLFGRLRAGAAAAAADTL
FT                   AVENGARGVRLLVLSDVATNYFKLTGALRQLETVRAIAAAQDETLRLVTARQRVGLATA
FT                   FDVERAQTEASRARAAIPPLETLAAVSRHRIAVLIGGQAFRAASITPSTVEATVPPARP
FT                   GQPAALLQRRPDLLAASAQLDAANARRQQAMAEWFPRLVLGAVFGRESIELNGSDLGPA
FT                   RFTNVAAMLAMPIFNAGRTQAINDIAESGQREAVLRYEDAIARALEDVENTLVALADER
FT                   QRAQALNSAAASADAALGRAQSLYDRGQIDLLPLLDAQRVRLSVRVGANDANTQLLLDS
FT                   VQLYKALGGGWQAFEPVAGPAASANPNSPTSSNSVARYKDPS"
FT   sig_peptide     158788..158889
FT                   /locus_tag="CAP2UW1_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.477 at
FT                   residue 34"
FT   gene            160287..161405
FT                   /locus_tag="CAP2UW1_0137"
FT   CDS_pept        160287..161405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0137"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bph:Bphy_3506 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33497"
FT                   /db_xref="GOA:C7RJ11"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ11"
FT                   /protein_id="ACV33497.1"
FT                   /translation="MNPSPSPTLVIVAMIAVAGLSACTSKPPAEALRAVRTAQIRYDRT
FT                   QEMNRYVGTVQSRHEVNEAFRVGGKVVQRKVDVGQNVREGDVLTVLDDTDYRLAEGAAR
FT                   QQLVAATAQAKQAESDRKRLDALKTDGSVSVSDNEKARTAHETASASAEAAARQLELAR
FT                   NRFKYTVLRASRSGVVTAVRFEVGQVVAEGQPVVSIANDGEPEIVADVPEDHLAVFKTS
FT                   RYKAWLASAPEQTFEVALRELSPQAAAQTRTFRARLKPVTPRPLPLGATATLVVERQVG
FT                   EAPAAVIPASAITQNNGQPAVWVVHPAGSESAATVDLINVSVHGYRNDEVLVSGPPAGE
FT                   LVVTAGVQKMAPGLRVALPEAARNAETKQVAR"
FT   sig_peptide     160287..160355
FT                   /locus_tag="CAP2UW1_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.474 at
FT                   residue 23"
FT   gene            161402..164491
FT                   /locus_tag="CAP2UW1_0138"
FT   CDS_pept        161402..164491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0138"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bph:Bphy_3505 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33498"
FT                   /db_xref="GOA:C7RJ12"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ12"
FT                   /protein_id="ACV33498.1"
FT                   /translation="MKSFNLTEWALNHRAVVLFLILAIAIGGVLGFTKLGQLEDPNFSV
FT                   PSMTVIVIWPGATAQQIQDEVLNRMEKKFEQIDHFDKVKTYARQGYGGMTLSVVGGTSH
FT                   ADQREAWYQARKKFSDVKLELPDGVIGPIFNDEYGDVTGLLYAVKGDGISHAELSDTAE
FT                   DIKRRLLKVPMVKKVDIYGKQAKKVYVEFSHQRLAALGITPLAIAESLRSQNSVLASGS
FT                   IDTHGDRVLVRVSGQFTSLDDIRNVPIAAGGRLIKLGDFTTITRGYEDPPMYTVRHNGQ
FT                   QVLMLGITMTNDGNIVEFGHAIAKAVANVQAELPHGIELERVADQPTVVSESIWEFERS
FT                   LMEALAIVLAVSLISLGWRIGIVVGLSVPLVLGVVALVMLAMGWNLERVSLGSLIIALG
FT                   LLVDDGIIAVEMMVVKMEEGWDRLKAAAYSYSATAMPRLTGALITVAAFMPIGFSRSTT
FT                   GEYAGGIFWIVGTAVLFSWVVSGIITPYLAVNMLPKDFGTHHHGADPYDTPSYRRLRGW
FT                   IDLAIARRWWVIATTVVALAVAVVGSRFVPQQFFPNSSRPELVVELRLKEGASFAATTE
FT                   QVKKMEAVLKKDEDVRFFTAYTGAGQPRFYLSLNPELPNPGYAAFIVMTRDMEARERVR
FT                   SRLMTSVNEEFPEVWVRVTRLELGPPVGFPVQFRVVGPDTQRVRSIAREVEAAVASSPK
FT                   VRDVQLDWNDPVRTLRVDLDQDKARALGLAPADVAFVTQTVMNGATVSQLREHEDLIDI
FT                   VARAVPSERLDVDTLKDVNLYTREGTVVPLSQVARVRYELEEPVLWRRNRDMAITVRAD
FT                   VKDGEQGVSVTQEIRPMLKEIEAQLPFGYRIDVGGAVEESDIANRALMAVFPVMLVTIL
FT                   TILMLQLQSFSRMFMVFLTAPLGLIGVVAALLIFQAPLGFVAILGITALCGMIMRNAVI
FT                   LVDQVQAEMAEGRDPWNAVLEAAVHRTRPVALTAAATVLAMIPLTRSVFWGPMAIAIMG
FT                   GLTVATLLTIFFVPALYAAWFKVERASAANPEMPPAAAPA"
FT   sig_peptide     161402..161497
FT                   /locus_tag="CAP2UW1_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.811 at
FT                   residue 32"
FT   gene            164582..165238
FT                   /locus_tag="CAP2UW1_0139"
FT   CDS_pept        164582..165238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0139"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: azc:AZC_0320 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33499"
FT                   /db_xref="GOA:C7RJ13"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ13"
FT                   /protein_id="ACV33499.1"
FT                   /translation="MGNSMKAAVVHELGKPLGLEEVPVPQPNENQVLVRIAATGICHTD
FT                   LHAAKGDCPVKPQTPFIPGHEGVGTVAAVGRAARGVKEGDRVGIPWLHTARGHCPHSRT
FT                   GWETLSGAHGALVTAESPKAFEQAFDRLRSRGTMALVGLPPGKMSPPIFDMVLKRITSR
FT                   GSIFGTRQDLDEALAFAGSGSVSAHFSWNSLESLNDIFARMEDGKIDGRIVANLQ"
FT   gene            165397..167013
FT                   /locus_tag="CAP2UW1_0140"
FT   CDS_pept        165397..167013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0140"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mar:MAE_34290 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33500"
FT                   /db_xref="GOA:C7RJ14"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ14"
FT                   /protein_id="ACV33500.1"
FT                   /translation="MYIARIPNRKSRPAILLRESYREGGKVCTRTIANLTNWAPERIVA
FT                   MERLVKGEFDDWSGEMTSGEIFGVLFALKQLADQVGITRVLGSAAESRLNLFLILARIA
FT                   HGGSRLSAVRWAKQHTVADVLALEEFDEDDLYAALDWLASQQERIERELYRAYVKEQGQ
FT                   PPVLVLYDVTSSYFEGECNELGQYGYNRDGKRGKQQIVIGLLTAEDGEPLAVRVFEGNT
FT                   ADPTTVASQITILKEQFGIAEVVMVGDRGMIKAKGKAALSAQGFRYITALTDAQVRTFL
FT                   KEGVLQTDLFDVPLCEVEHDDKRLIVRRNEIVRVREERRREDKLAQLQAKIADRNAFVK
FT                   NSRRASAATGLAALQRWAKRHKLAAFVTLALNERVIVCTIDQEAKAQDALLDGCYLLET
FT                   DVPQGLMDAKAVDARYRDLQKVERNFRTVKTTFLEIRPIFLRKAERTKAHVFVAMLALK
FT                   ITRRFEAALHRTFGSTVDDPATITPDDALVALGRLTYLYSTDRNGQRHTHLPRPDDQQA
FT                   KILDAIGLSFPLKAKAEKRAV"
FT   gene            167397..168857
FT                   /locus_tag="CAP2UW1_0141"
FT   CDS_pept        167397..168857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0141"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: sfu:Sfum_1455 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33501"
FT                   /db_xref="GOA:C7RJ15"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ15"
FT                   /protein_id="ACV33501.1"
FT                   /translation="MALLVTCGLAGCATRPVNPRIEHFDPATMYTFQRPSENQEDRQHF
FT                   VLLAFSGGGMRAAAFSYGVLETLRDMQITTPSGRKVRALDEVEVITGVSGGSFTALAYG
FT                   LYGDRLFDDYERRFLRRDVQGQLIARVLNPFNWGALVSTGWGRSELAADLYDDVLFNGA
FT                   TYADLKRDGPQIVVSATDLSEGTRIDFNKPTFDMLCTDLGGFRLARAAAASSAVPVVLS
FT                   AITIDNHGGTCDYRPPAWARLLLDNPDPPRPAVRSIKHLNELRVYTDQSRRPYLHLVDG
FT                   GISDNISARGVLDVLSTFASLHALGMPTPVDRLREVFVFVVNSLATPPNDWSLHENPPG
FT                   MVELLIQTAGAPIDRYSYDTVETLKDMQAGWEVLRVVRTDMKPIAEGNPKLDFILRAPD
FT                   INIHVIDVSFAVLKDSAERDYLHRLPTSLVLPSEAVDRLRAAARTAILESPAIRRLMKQ
FT                   DIARMVGSERTSAGAAQMAVAPARAPVD"
FT   gene            complement(168909..170036)
FT                   /locus_tag="CAP2UW1_0142"
FT   CDS_pept        complement(168909..170036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0142"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   min:Minf_0718 predicted permease, member of the PurR
FT                   regulon"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33502"
FT                   /db_xref="GOA:C7RJ16"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ16"
FT                   /protein_id="ACV33502.1"
FT                   /translation="MRNPTDRETPVPPKTMTIKLPTGWFYGALIVILSAWILNSFLQAM
FT                   LAACVTAIASWPLYTRFAARLPRCIGRNSSSLIFTLALTIFVLAPLMFAFGALLSEAHA
FT                   LLSAIAVADKKGIAVPQGLENAPLIGPWLAARWQSQLASPGALLTWTQRTDAAALVPWA
FT                   QSLGQFTVRHAFIIFFTVLLLFFLYQEGESLAAGFRRVLRRCLGEHADGFADLATRAVR
FT                   ASVNSMLVVALFDGLASGVAYAIVGVPHAAVWAAVTGLLALVPFLGYVAVGALALQLAM
FT                   TVTTTPPLLALGLGCFVLFCGDKVVRPVVACNGVRLRFVWVLMGCLGGFEVLGLIGLVI
FT                   GPVVLTLARELWEQRVRDLAVVDVTDSNPQVSQSA"
FT   gene            170446..172335
FT                   /locus_tag="CAP2UW1_0143"
FT   CDS_pept        170446..172335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0143"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   sil:SPO0112 poly(3-hydroxyalkanoate) polymerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33503"
FT                   /db_xref="GOA:C7RJ17"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ17"
FT                   /protein_id="ACV33503.1"
FT                   /translation="MTTPTDDRRAITPSSSNGPSAPSPSQEALEPAAASRQAGALGARP
FT                   GRRIGDRALYESEWLENADRMTNAAIAHATGGISPTSVAMDLFGWMAHLASSPGKQFEL
FT                   GQKAVRKALRLGRYAATCAADPGATPCIEPLAQDHRFEHEAWQRFPYNVIYQAFLLDQQ
FT                   WWHNATTGVRGVSKHNEEAVSFITRQVLDMFSPSNIPFLNPEIVQTTLAEGGANLLRGA
FT                   QNFAEDLRRGIRGEPPAGTETFQVGKNLAVTPGKVVYRNRLMELIQYTPTTASVQREPV
FT                   LMQSAWMMKYYILDLSPHNSLVKYLVDRGHTVFMISWLNPRPEDRDLGLEDYRKLGTMA
FT                   AIDAISNILPDRKIHAVGYCLGGILLTIAAATMARDGDDRLASVTLFTTMTDFTEVGEI
FT                   NVFMDAGEVTMLEDIMWQKGYLDHKQISGGFQLLKSADLIWSKMVREYYLGNREPMFDL
FT                   MAWNADGTRMPYRQHSEVLRRLYVDNELFEGKYMVGGRAISISNIHCPIFAVAAVADHV
FT                   APWHSVYKLHLQSDATELSFVLTSGGHNVGIVNEPGRPRRKFQMATCKEGERCLDAETW
FT                   KAQTPVTQGSWWPAWDQWLTQHSSGGATPPIMGAPDKGYEPLCDAPGTYVHQK"
FT   gene            172546..173379
FT                   /locus_tag="CAP2UW1_0144"
FT   CDS_pept        172546..173379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0144"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bid:Bind_0201 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33504"
FT                   /db_xref="GOA:C7RJ18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ18"
FT                   /protein_id="ACV33504.1"
FT                   /translation="MTQLSATEQFFEDLKKEVKGSAGPLEGKKALIVGIANDQSIAYGC
FT                   ALAFRAFGADIAMTYLNDKTKKYTQPLADHLGVDPALYRPCDVRVEGQLEAVFEAIGKT
FT                   WGKLDIALHSIAFAPREDLHGRVTDCSRDGFLSAMDVSCHSFIRMAKLAEPLMKDGGAL
FT                   FTMSYYGAEKVVEHYNVMGPVKAALEASARYLADELGPKGIRVHPMSPGPIQTRAATGI
FT                   DRFDELMEIAAQRAPSRMLVTIEDVGMATAFLASDFAKLITGDTIHVDGGYHIVG"
FT   gene            173754..174557
FT                   /locus_tag="CAP2UW1_0145"
FT   CDS_pept        173754..174557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0145"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bbr:BB3116
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33505"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ19"
FT                   /protein_id="ACV33505.1"
FT                   /translation="MNQDLLMVLECATVHYQPIVDLDTGAIAGFEALLRTVDADGDAGS
FT                   IGPVIEQIESDPVLLDRLMRRLLGMISRDAVPLFERYPGFYVSVNVPPAILGARTALGE
FT                   PAMRGMLSDFDLEPYLGRLVCEITERQALSAQGRAALELARQVGIRLAVDDVGTGHSGI
FT                   AQMLGLTIDVLKLDRSQVVLLTTDVTAERLVRGIIVLASMIRARVVAEGVESAAQAFFL
FT                   QAAGVDYGQGWFWSPALPAAELPKVFEAGFPNWRRDLVARLNEAR"
FT   gene            complement(174541..175980)
FT                   /locus_tag="CAP2UW1_0146"
FT   CDS_pept        complement(174541..175980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0146"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: dar:Daro_2258 heavy metal sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33506"
FT                   /db_xref="GOA:C7RJ20"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ20"
FT                   /protein_id="ACV33506.1"
FT                   /translation="MRLSGMRSMTFRLTMLFALSSTVVLLLLGYLIAGAVERHFEEQDM
FT                   EVLSGKLKLAQHALEKAHSQADLDALPQQLADSLVGHDGLAVIVLAPDGRTLFATRAAE
FT                   FPRTLLESASQADQARPTVWTTGDKRPLRGISALARTGIKGFHPLIVGVATDVSHHEHF
FT                   MKSFRTTLWSFVILAALLTGVLGWLAVRRGLAPLQAIRREAAAITAHRLHSRLPADAIP
FT                   VELAELTATLNEMLARLEDSFRRLTAFSSDIAHELRTPVTNLLTQTQVTLAKERPAGEY
FT                   GDVLASNAEELERLSRMIADMLFLARADNDLVMPRQEPLDLVDEVKGLFAFYEALAEEK
FT                   TITLTCSGSGRVGGDQLMLRRAISNLLSNALRHTPVGGQVSVHVDDTGDTGVRLSVQNS
FT                   GETIALEHLPRLFDRFYRVDSSRQRASDGAGLGLAITRSIMRAHGGDAAIRSARGMTVC
FT                   ELHFPPELATDRHPICINVPR"
FT   sig_peptide     complement(175873..175980)
FT                   /locus_tag="CAP2UW1_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.530 at
FT                   residue 36"
FT   gene            complement(175971..176654)
FT                   /locus_tag="CAP2UW1_0147"
FT   CDS_pept        complement(175971..176654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0147"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: rfr:Rfer_0422 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33507"
FT                   /db_xref="GOA:C7RJ21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ21"
FT                   /protein_id="ACV33507.1"
FT                   /translation="MKILVVEDEPKTGNYLKQGLLEAGFVVDLARDGEDGMHCALTEAY
FT                   DLVILDVMLPGIDGWSVLRGIRKSGKDMPVLFLTARDHVDDRVRGLELGADDYLVKPFA
FT                   FSELLARVRSLLRRGGKATESEFLRAADLELDLMRRRVNRSGKRIDLTAKEFALLELLL
FT                   RRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIRRLRAKMDDGFEPKLIRTVRGMGYVLE
FT                   VTACA"
FT   gene            176805..178154
FT                   /locus_tag="CAP2UW1_0148"
FT   CDS_pept        176805..178154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0148"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dar:Daro_2263 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33508"
FT                   /db_xref="GOA:C7RJ22"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ22"
FT                   /protein_id="ACV33508.1"
FT                   /translation="MRQPTTASGHDERSQESRRVRPLRVLPCGFLGAQACALGLALAIA
FT                   APAWPQDKAIGRTVESLLVFARETNPEYAAIRSEADAALERVTPAGALADPKFRMELRD
FT                   ITKSGDQNPTLSPSQVGSTRYLLSQDLPWFGKRELKREIAEFEAEGATSRARGTWSDLA
FT                   ARIKAAHAQRYYLSRNEKLTREILELIVRLEKVAQVRYAGGLAAQQDVIRAQVEQTSMR
FT                   SELVTLESESRQVDARLNALLARPAAAELAPPERLPVLPTAARLDYATLEERVRARNPV
FT                   LFAEESRLKAAEKSRELAYRNRYPDFTVGFGPIQYQNAVKEWEVMVELNIPLQLSTRRA
FT                   QERESEAMLSAARSRKEATANQVLADLAENLAGIEAARRIEMLATTSLLPQAELTFRAA
FT                   LAGYENGKVDFATLLEAQRQIRQARQSQIKAQSEAQIRLAAIERLLGEDL"
FT   gene            178151..179500
FT                   /locus_tag="CAP2UW1_0149"
FT   CDS_pept        178151..179500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0149"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: rfr:Rfer_0412 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33509"
FT                   /db_xref="GOA:C7RJ23"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ23"
FT                   /protein_id="ACV33509.1"
FT                   /translation="MKQATGIAIGLVAVTVLAAGSGYWLGSRGAVPPGEGSATMTAAAA
FT                   KGAGEPEKRKVLYYRNPMGLPDTSPVPKKDSMGMDYTPVYADEQDDEPASANQIRISTE
FT                   KVQKLGVRTEAAQRRTLDRTVRAAGRIEPDERRLFTIAPKFEGYVERLYVNVTGQPVGK
FT                   GQPLFEVYSPELVSAQREYTVAAQGVTALKEAGGQAQTGMQDLANASLQRLRNWDVSPE
FT                   QVKALAESSEAKRTLTFRSPVAGIVTEKKAVQGMRFMPGEALYQVADLSSVWVIADVFE
FT                   QDIGLVRTGARAKIRINAYPDKLFEGAVTYVYPTLKSDTRTVPVRVELANPGLLLKPAM
FT                   FAQVELAVSAKGPMVSVPLSAVIDSGTRQVVLIQQGEGRFAPREVKLGARSDDYVEVVD
FT                   GVKDGEQVVVAANFLIDSESNLKAALAGFAPAASADAGKAGSAANPHAGH"
FT   sig_peptide     178151..178207
FT                   /locus_tag="CAP2UW1_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.924 at
FT                   residue 19"
FT   gene            179536..182667
FT                   /locus_tag="CAP2UW1_0150"
FT   CDS_pept        179536..182667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0150"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: dar:Daro_2265 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33510"
FT                   /db_xref="GOA:C7RJ24"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ24"
FT                   /protein_id="ACV33510.1"
FT                   /translation="MLAKIIDWSGGNRFLVLLATLFVTIGGIYAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLSTAMLSVPRSRVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLSFASSRLPRGVTPSLGPDATGVGWVYQYALLARDKTLAELRTIQDWYVR
FT                   YPLSKAHGVAEVASIGGFVQTYQVTVDPVKLRAYGIPLMKIAQVIRDSNRDVGGRVVEM
FT                   AETEYMVRGKGYLRGKSDIERLVVKSDRGTPVLIRDIARVELAPDERRGLAELNGEGEV
FT                   VSGIAMARYGQNALEVIHNVKAKIAEIGPGLPEGVTVETVYDRSELIHRAIETLKRTLL
FT                   EESFIVALVCIVFLLHVRSALVAILMLPVGILIAFIAMRSLGMNSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPAGHSPGDRAEAMLAACREVGPALFFSLLVITVSFLPVFS
FT                   LEGQEGRLFSPLAYTKTFAMAGAALLSITLVPVLMLLFIRGRILPEAKNPVNRFLIWVY
FT                   RPIIAGVMRWKKLTLVLAVLAMALSLYPASRLGSEFMPTLNEGTLLYMPTSLPGMSITK
FT                   AAELMQTQNKIIERFPEVASVYGKAGRANTATDPAPTEMFETVINLKPESEWRAGMTTD
FT                   KLIAELDKALQFPGVANAWTMPIKARIDMLSTGIRTPIGIKVFGKDLDEMETLAKEIEA
FT                   VVKTVPGTTSAFAERITGGFYLNIEPDREQLARYGLAVGELQDVIGSALGGEMVTTTVE
FT                   GRERFGVTIRYPRELRSDPQQIAREVLIPTMNGAMIPLGQLARVVVAKGPPSIRTENAL
FT                   LSAYIYVDIRDRDIGGYVADAKKAVAEQVSFPPGYYVTWSGQFEYMERATEKMKIVIPV
FT                   TLLSIFLLLYLNFKRLTETLIVMLSVPFALVGGIWLLWLLDYNLSVAVVIGFIALAGVA
FT                   AETGVIMLIYLDHAWEAVQAKCRAAGRAPNVDDLYAAIMEGAVERVRPKMMTVVAIMAG
FT                   LLPILWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRLRPGSG"
FT   gene            complement(182674..183585)
FT                   /locus_tag="CAP2UW1_0151"
FT   CDS_pept        complement(182674..183585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33511"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ25"
FT                   /protein_id="ACV33511.1"
FT                   /translation="MNSRSWRVPSLTVLASLMAVTGSVQGGEAGERQAFVSLTPVYQGN
FT                   ADLDRSGDFSVGGAILRGGVSQDLGGGRRAGITLTYDYLDYSFSNSGAFDRVAPWNIVQ
FT                   RYGVSAPLSFEVGDGWSVGVAPSVDWFRENGAKSGDSLIWGATVSGSRRFERGNRLGLG
FT                   IGVFDGIEKTSVFPLLVIDWRFGDHWRLTNPLPSGPTGPAGLELGYYFDGGWTAGVGVA
FT                   YRVLRFRLSETGPVRNGIGEESGMPVFVRVTRNFTDQLALHLYGGVVANGRLRVENSSG
FT                   HLVRKEDFDPAPLFGATFIGRF"
FT   sig_peptide     complement(183505..183585)
FT                   /locus_tag="CAP2UW1_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(183582..183857)
FT                   /locus_tag="CAP2UW1_0152"
FT   CDS_pept        complement(183582..183857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33512"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ26"
FT                   /protein_id="ACV33512.1"
FT                   /translation="MIDPIVEEARKYRAEHARRFNFDLPAIGADLEEIDATCGHTVVSL
FT                   PPRTLDVTTDQLEPSDQGRQAVDVHSLSPRLSLSFGPPDIYKRKSL"
FT   gene            184033..184269
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0153"
FT   gene            complement(184313..185551)
FT                   /locus_tag="CAP2UW1_0154"
FT   CDS_pept        complement(184313..185551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0154"
FT                   /product="serine dehydratase alpha chain"
FT                   /note="PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain; KEGG: bfs:BF1216 putative L-serine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33513"
FT                   /db_xref="GOA:C7RJ27"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJ27"
FT                   /protein_id="ACV33513.1"
FT                   /translation="MKSLRELYRIGLGPSSSHTMGPRFAAQAFKAANPTAARLRVTLYG
FT                   TLAATGRGHLTDRAVSVPFAPTPVDIVWLPDRLLPRHPNGMQFEALDAGGGVLAARVVY
FT                   SVGGGALLDENGQPDGGDDVYPYAGMREILEEAEREGLRIWELVDRHEGPPIWPYLSGV
FT                   WSSMRRAIASGLNAEGRLPGTLNVPRKASAYHARAQSLAGYFGQTALQFAYALAVSEEN
FT                   AAGGEVVTAPTCGACGVLPAVLFFLQQQAQLSDEKIHRALATAGLIGNLVKRNASISGA
FT                   EVGCQGEVGTACAMAAGAAAQLLGGSVRQIEYAAEMGLEHHLGLTCDPIGGYVQIPCIE
FT                   RNAIAAVRAVDCAAYALLSDGHHIVSFDEVVRTMWETGCDMKASYRETARGGLAKIHAL
FT                   RKKGAGSVPGMGS"
FT   gene            185682..185810
FT                   /locus_tag="CAP2UW1_0155"
FT   CDS_pept        185682..185810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33514"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF0"
FT                   /protein_id="ACV33514.1"
FT                   /translation="MLSPGHAVFSNTSVIAGPVTLECQSESGNGLNWLQIAACGRG"
FT   gene            complement(185829..186446)
FT                   /locus_tag="CAP2UW1_0156"
FT   CDS_pept        complement(185829..186446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0156"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   oan:Oant_1991 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33515"
FT                   /db_xref="GOA:C7RJF1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF1"
FT                   /protein_id="ACV33515.1"
FT                   /translation="MSDLVFYTHPQSRGRIVRWMLEECEAPYQTEIVQYGLQMKTPPYT
FT                   DINPMGKVPAIVHQGRVVTECAAIIAYLADVFAAAALAPPAAQRQDYYRWLFFAAGPFE
FT                   QATTNNALGFVVSEEKQRMVGYGNLDLVVNTLARAVSAHPYIAGDHFSAADVYVGSQIG
FT                   YGLQFGTLPDRAEFRDYFARLENRPARLRATQMDDALINKPV"
FT   gene            complement(186629..190363)
FT                   /locus_tag="CAP2UW1_0157"
FT   CDS_pept        complement(186629..190363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0157"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: amr:AM1_5108 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33516"
FT                   /db_xref="GOA:C7RJF2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF2"
FT                   /protein_id="ACV33516.1"
FT                   /translation="MASARPLRLWLALRIALAGMVPLAMVAVLIVGVLLPQRRADLDTG
FT                   YQGLAGALAAQVETHLLGAERQLRAIAEDFRSHPGDHSAPNWSRTLDAHAGTGDGFAAI
FT                   YLADPDGSAYAVGLPRAERGRRRDLVHLDLSERAALREARQQNEEVWSAAFLSTVTGRL
FT                   AVSVAIPLSEQVLVGQIALDRLALLLGRSPAESAMHTIILDAQGQIIAHSAGVQSGAPF
FT                   SVDHLPGIRDALLGHRTTQDFAVDGEMFVGTSVSIPRFGWILLVAQPHSDTLRPFLSTA
FT                   WVLAAGALAALLLTVVMALTMARSLARPIGRYAEQAHAIAGGDYSQPWPVYRIREFDRL
FT                   AGDLERMALAIRQREQELAKSEARYRSVIASAPLAIFQFDERGVFALSEGKGLARVGLV
FT                   AGEAVGQSLFELYRGYPELCDYARRAIGGEPLHFVSRFGDTWFDTCFSPVRDAAGCLQV
FT                   MGVAVDISERLHAEKALRESEARLRTAIESIPFDLFLIGPDGRYVLQNTACRKAWGDVL
FT                   GKYPGDVTDDTAILARWDDNNKRALAGEIVEEDVRLTVGNEERYLHNIIAPIKDGDDIR
FT                   GILGINIDITERKRSAELLELMRLSVEYGSDAIFWMNRDGSIAYVNEQACRSLGYVRAD
FT                   LLQLRLWEVDPNYSTDTWDEAWRALTETGSFHAETRHRRHDGSEFPVEVNAIAITYEGR
FT                   TYAIGFACDITERKRDHEILKRSETDLQLAVEVAGLGHWKWDIRTGELIWSERCKALYG
FT                   LPPDTELTYERFLARVHPDDRARVDALLREALEKRGGYELEKRLVWPDGSVRWTSSMGR
FT                   VICDSDDQPVLMVGVTLDITERKQAEDALRLTQFTVDRTADAVFLIDAESRFKYVNEAA
FT                   CVALDYTREELTSMSIPDIDPDVSDQMASDIFQDLKRQGSLRFETRHRRKDGTTFPVEV
FT                   NANYIAFSGEELNSCFVRNITERKRAEDELERHQEHLEELVTERTAELRQAMEQLVQAE
FT                   KLAALGHLVAGMAHELNTPLGNARVVASSLGAEVRNFAAAVDAGALRRSQVATFLERSR
FT                   EAVELLERNAARAADLISNFKQVAVDQASARRRRFDLRQTVEELLVTLQPQLKRTAHRI
FT                   ELDIPRELELDSYPGPLEQVLANLVGNSLTHGFAGIEAGLIRVRAAPLDGDRVQIDYTD
FT                   DGVGIPDGLLHRIFEPFFTTRLGQGGSGLGLYIVYNLVTGVLGGTIRGFSDVGKGVAFV
FT                   LILPRIASERTLQTDTHEQ"
FT   sig_peptide     complement(190283..190363)
FT                   /locus_tag="CAP2UW1_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.834 at
FT                   residue 27"
FT   gene            complement(190793..193801)
FT                   /locus_tag="CAP2UW1_0158"
FT   CDS_pept        complement(190793..193801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0158"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; GntR domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; KEGG: dvl:Dvul_1149 PAS/PAC sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33517"
FT                   /db_xref="GOA:C7RJF3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF3"
FT                   /protein_id="ACV33517.1"
FT                   /translation="MIRGSWRQQSRKGGSATALTCSLALVAVRGKRLARLLLAVACLTL
FT                   PVASIADERPGHAHVDILVLHSYHQGLPWTDSEQDGLRVGLAEHLPRLGLFIEYLDALR
FT                   FPLRGPDAEAAAAQRLAERYASMHIEYLVATDDPAYRLLLAHRDRLWPGIPILFAGVNN
FT                   IDSRDIAHLDRVAGVAERPDFFANLALIQSLHPKVDRLVVVGDETRTFASNRKALEDAN
FT                   ATLARPFTVEVIVRHSLRDVLAELRSLSGDFVIFLMGRPFDDEDRIGAEAVVAEAVRGA
FT                   TRHAVYSAWSFFLGHGIVGGKLVSGKEQGLALAGLLTDLYAGKALADLPRVIDSPNRYL
FT                   FDYTELDRLGLSGHSLPPGSVVINRPASIWDSYPKTFAASLAVFVFLLALLALQRRNLR
FT                   VKQALSAEIEKELVLVQALMNAAPFPMFFKDVALRYQRINDAFVAFLGKSREEIIGQTA
FT                   SAVAPPAQVSVYRSRDEDLLAEGGRQIYETVVVGPQQAPRDVVFHKAVVRLPDGRVEGI
FT                   VGAMLDVSELRRSERELRELNEHLEQRVAGRTADLAQSNVRLQQAVDSLALAQDELVRS
FT                   EKLASLGSMVAGVAHELNTPIGNALTVSTAMQNKRNALAAELTQGVLRKSSLDQYLSHG
FT                   ESGFAMLVRNLERAARLITNFKEVAVDQTSDRRRRFRLLDTVEECVHTFTAGVGARVPG
FT                   FQVDVAESIAFDAYPGALGQILLNLFENARVHAFADGAPGTIRIGAQALPDGNVQISVG
FT                   DNGKGIAADALPKIFDPFFTTRLGQGGSGLGLAIVYRLVTKKLGGKIRISSEPGQGAIF
FT                   IIELPATAPEVDSGDEVTATHAAWAPPAGMNPAGTGAGDASPLHLRDELLDIRELVESR
FT                   AAAATTRRITDAGRRRLADVFERLDKSFSTEDAEAQVACDLAFHMAIIDLSVDPALQKV
FT                   GAAVIPLMYGHMRRTLTRLMPDPERRDTLRRQHRAIYEAIIAGDPDSASAAAAAHMAYV
FT                   RTQADRREETAAS"
FT   sig_peptide     complement(193718..193801)
FT                   /locus_tag="CAP2UW1_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.407 at
FT                   residue 28"
FT   gene            194205..195233
FT                   /locus_tag="CAP2UW1_0159"
FT   CDS_pept        194205..195233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0159"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: vpa:VPA0790 putative YhfP protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33518"
FT                   /db_xref="GOA:C7RJF4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF4"
FT                   /protein_id="ACV33518.1"
FT                   /translation="MDPLTHALLGATAAQAALGPRLGRQAWMLGALGGVLPDADILIRS
FT                   ASDPLLAIEYHRHFTHALAFIPCGGALAASPWLLQKRYRPDWRPLLAASTLGYATHGLL
FT                   DACTNYGTHLLWPFSPQRVAWHWITTIGPLLTLILLLGLLFSAGRRSRLPAVLSLLLAV
FT                   AYVGGAAWQRERALDVQAEIAAARGHQVARAEMFPTVGNPILWRSVYQSGTTLYTNRLR
FT                   ILGEDNSLWKQGSRLKLFREDDLSAQALADPRIRRDFARFSYFSAGWTALADDDASVVG
FT                   DARYSLRRDGFEPIWGVRFHPGSVAATEWVDYTARNRIPISELWSEISATAAGYRSVRE
FT                   LP"
FT   gene            195461..196687
FT                   /locus_tag="CAP2UW1_0160"
FT   CDS_pept        195461..196687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0160"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   mms:mma_3050 outer membrane cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33519"
FT                   /db_xref="GOA:C7RJF5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF5"
FT                   /protein_id="ACV33519.1"
FT                   /translation="MHCNPQRTLKARLAVKLLSVLLGVTTASAQAETLREVFEKAWASS
FT                   PHGRTAEAKRDEVAASRTVAESWFPAAPKVDAFHRTDRWNSDLGNQESEIGVSVPLWLP
FT                   GQKAARRSLAEAEGGENEGDIQATRLAVAGELRRALWTLIMARSEAEVAAERLKAALAL
FT                   EEDVGRRLKVGEIARSDLLLARQETASARAAAADAQLGVVRSLQRYRVLTGSERLPDDP
FT                   QEPVAVADNRPVDPRVAAGQAVIERARAALKLAQESRREAPSVGVLYRRDRDVSGATPR
FT                   DSIGFAISIPLAVEVRNAPLLASANTALIDAEARYRRLLAEVEAEVREAEAQLDSAGLG
FT                   ATLAVEREHAAAERLALMRRSFELGETSLVELLRAHSQTTEARIEGARSRSRLSAAQAN
FT                   LNQARGITP"
FT   sig_peptide     195461..195556
FT                   /locus_tag="CAP2UW1_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 32"
FT   gene            196684..197256
FT                   /locus_tag="CAP2UW1_0161"
FT   CDS_pept        196684..197256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_2533 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33520"
FT                   /db_xref="GOA:C7RJF6"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF6"
FT                   /protein_id="ACV33520.1"
FT                   /translation="MTRPFFLPTWAAACVAASLLALFSLSAPLIAHEGHDHGAAAKPTD
FT                   VRLAPRFEVRNEDVEVVGVLADKTLLIYLDRVSDNRPVQDAQIEVEGPGIKGVASAMPD
FT                   GVYQLPAAALAPAGRYPLTLTIQAGESVDLLAATLEVGEVPAAASAEENTKRPWWLLAG
FT                   ISLLVLSGGLVAHRLRRQARERAIHHV"
FT   sig_peptide     196684..196779
FT                   /locus_tag="CAP2UW1_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 32"
FT   gene            197249..198451
FT                   /locus_tag="CAP2UW1_0162"
FT   CDS_pept        197249..198451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0162"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: tbd:Tbd_1747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33521"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF7"
FT                   /protein_id="ACV33521.1"
FT                   /translation="MSDYRTSGRHAVVLLLAGVLTVQQVWAHGGEKHDDEKKSTAAPVA
FT                   VAAVSAVKAVKAVNAQGQVTFVEPALRLPDGSVFVPKSAQRQLALRTLAARKGEFPRTI
FT                   ELNGRVVGDPNAGGRVQTFQSGRIEAGPQGLAVLGQRVGKGQVLAWLQPASSAIERGSQ
FT                   QAALAELAAQESILERRVARFRQLEGSVPQKDVEQAQIELAAFKKRKGALGGSLGREAL
FT                   VAPVSGVVSAANAVVGQVVNAREVVFEVIDPQRLAVEALAYDPLLLAGLAGASAPVAGG
FT                   VIDLAFVGIGRTLKEQAMPVLFRVELPKTGELPALAVGQTLKVLAQTRERQSGVAVPVG
FT                   AVVRNAANESVVWLHTSAERFVSRKVRIAPLDGHSVAVTEGLSGGERVVVQGAASLSQI
FT                   R"
FT   sig_peptide     197249..197332
FT                   /locus_tag="CAP2UW1_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.988 at
FT                   residue 28"
FT   gene            198461..201565
FT                   /locus_tag="CAP2UW1_0163"
FT   CDS_pept        198461..201565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0163"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: tbd:Tbd_1746 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33522"
FT                   /db_xref="GOA:C7RJF8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF8"
FT                   /protein_id="ACV33522.1"
FT                   /translation="MFDFIINASLRQRLIVLGVSLLLIIYGALTVRKMPVDVFPDLNKP
FT                   MVTLMTEAGGMAPEEVEQLITFPIESAMNGMPGVTRVRSVSGIGLSVVYIEFAWGSEIY
FT                   RNRQQIAERLNLVREQLPQGIVPQMGPISSIMGEILLIALPADPDKVSPMQVREYADWV
FT                   IRPRLLTIPGVAQVIAIGGQVKQYRVEPDPARLQALAVTLSELEAALKNFGGNTAGGFV
FT                   DAGGREYLIRNIGRSSRLEDLQNQPVALRKGQVILLHQVASVSFAPAIKRGDGSFQGKP
FT                   AVILSVQKQPTADSVALTRAIEKALTEMGRSLPQGVETPQFLFRQANFIEASVNNVEEA
FT                   LRDGAIMVAIILFLFLANFRTTFISLTAIPVSLLITALVFHYFGLSINTMTLGGLAIAI
FT                   GELVDDAVVDVENVLRRLRENRSLPNPRSALEVIAAASKEVRSGVVYATLIVVLVFIPL
FT                   FALPGIEGRLFTPLGVAYIVSILASMAVAMTITPVLCYYLLPKMKHIDHGDSALVKKLK
FT                   AWDERLLNWSFDRGRLLLAGAAITVAVALASIPFFPKSFLPPFNEGTLTVSVLLNPGTS
FT                   LSEANRLGTQAEKLLLTVPEVTEVGRRTGRAELDEHAEGVHSSEIEVDLKASERGREVI
FT                   IADIRQRLSGLPAVVSVGQPISHRLDHLLSGVRAQIALKIFGDDLDTLRGLAGDLRERL
FT                   ARIPGITDLQIEKQVLIPQYKIRVDYDAAARYGVTSGELLQRLEQLLAGERLGQVLEGN
FT                   RRFDLSLRLPEDARGERGLENLLIETPIGRVPLSSLATIEDGDGPNQIGRENTRRRIVI
FT                   SANSDGSDMSRIIAEIRAEIDRQPMPEGYFPLLEGQFQAQEEAARLIAVLALVSLAMIY
FT                   LVLYSRYRSAVLTAIVMGNVPLALVGSVVALWISGEPLSVAALVGFVTLTGIATRNGIL
FT                   KISHYINLCAFEDEVFGRKMIVRGSLERLTPVLMTALVAAFALTPLLLAADAPGKEILH
FT                   PVAVVIFGGLISSTLLDTLLTPVMFWLFGEKPLQRLLAEKAKASF"
FT   gene            201589..202050
FT                   /locus_tag="CAP2UW1_0164"
FT   CDS_pept        201589..202050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33523"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJF9"
FT                   /protein_id="ACV33523.1"
FT                   /translation="MQRTLIFPLTLVAALVSVGNGAFAHDDATLDKLAGPNGGQLRMAG
FT                   AYHFELVVARDSRQARDNPVSVYLSDHDGKKVAAAGASGTATILAEKAKITVPLVPAGD
FT                   NRLTGIGKYASDPQMKVVVSITLADRKTEQARFTPLTMAAADGHGDHRQ"
FT   sig_peptide     201589..201663
FT                   /locus_tag="CAP2UW1_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(202107..203561)
FT                   /locus_tag="CAP2UW1_0165"
FT   CDS_pept        complement(202107..203561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0165"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: gur:Gura_2663 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33524"
FT                   /db_xref="GOA:C7RJG0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG0"
FT                   /protein_id="ACV33524.1"
FT                   /translation="MRRLLVLAATAILLAGCLLGPDYRRPQVAAPEAFQYAPKDAADTA
FT                   DTLWWKQFQDPVLDQLIAEGLAHNSNIAIAAANVEQAAAVLTQTRSQLFPQLGYGASGE
FT                   RQRSLEPAFAALLRDYPNPSTAYQAGLSASWEIDLWGRIRRQSEAALANLLATDEARRG
FT                   VVLSLVASVANSYLQLRGLDAQLAVAKKTLSAYGESVKLFELQYKYGQVSKMNVVQAQS
FT                   QYESAAAQIPLIESQIAQTQNSLAVLIGRDPGPIARGKSVDDLVLPQVPAGVPSALLER
FT                   RPDLLQAEQTLIAANAQIGAAKALYFPSISLTGAFGGASSDLSNLFKGSSRVWNYTGSI
FT                   VGPIFTFGAVSGQVAQAEAGQAAALLNYQLSIRNAFADVDNALVANQKLQEQLAAQKRL
FT                   VVALSEYSRLARLQYEGGYTGYSTVLQAEQTLFPAELNLASIRASLFASSVNIYKAMGG
FT                   GWVSEADQLTAGGGRPVAPGSIPPLF"
FT   sig_peptide     complement(203472..203561)
FT                   /locus_tag="CAP2UW1_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.514 at
FT                   residue 30"
FT   gene            complement(203558..206728)
FT                   /locus_tag="CAP2UW1_0166"
FT   CDS_pept        complement(203558..206728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0166"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   sfu:Sfum_1076 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33525"
FT                   /db_xref="GOA:C7RJG1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG1"
FT                   /protein_id="ACV33525.1"
FT                   /translation="MFSRFFIERPIFAAVVAIILSIAGLVSIFVMPVQQYPAITPVQVT
FT                   VQATYPGADSKTLADSVAAPIEAQINGVDKMLYMTSSSSATGQLLLTVYFALDADPDIA
FT                   QVQVQNRVNLALPQLPSAVTQQGVSVQKKSSTIMMLLGVTGKGGRYSPGYVANYANVYV
FT                   LDALKRVPGAGQAQIMGVADQAMRIWMNPDRMASLAITTSDIANAINTQNALFGAGQIG
FT                   QQPTADAVELSFPVVTQSPFTDPRQYEKIILRANQDGSAIVRVGDVARAEVGLRQYVVN
FT                   TRINGEPTTLIAIYQQPGANGLVVSQAVRAALTEMKSRFPEGLDVVVALDTNDFVRLSI
FT                   EEVLKTLAAAMVLVVLIVYLFLQNLRTTLICAVAIVVALVGTFAGMLALGFSINLLTLF
FT                   GLILAIGMVVDDAIVVVENVERNMAQHHLAAKEATIRSLGEIGSSLVAVVLVMASVFVP
FT                   AAFLAGTTGQLYRQFAITIVISVSISGFVALTLTPAMCALLLKHSPAPQRGFFAWFNRQ
FT                   VDRVTRAFGHAVEWVIKRMLLAFVLLGVFLYSIWHLFHLLPTSFVPNEDQGYAMVAIIM
FT                   PQSASLDRTQAVADRVDAILAQIPGVDRRSMITGYSLIDAGYKANAATFFVTFKDFATR
FT                   YGSLDSARSQNARAILLAFYDQAKHIEEAIVLPIAPPAIPGIGTTGGFEFWIQDTAAGD
FT                   PLKLDALTRAFLDKARTRPELASLNSTFNAQAQQLRADVDRDKATLLGLQVQDVYSAIQ
FT                   AQFGSLTASQFSQFSRVWWVIVQSDASFRQQPADLTRLYTRNNQGKMVPLSAVVTTHWT
FT                   VGPDILPHFNGFPAAKVIGNPAPGFSSGQAIAAMEEVAGEILPAGYTFAWSGLAFEEKK
FT                   SRGTSALAFVFGLLIVFLVLAAQYESWTLPGAVMTAVPFGILGALLTNWARGLENDVYF
FT                   QIGLLVLIGLGAKNAVLRVSAAVDFRKQGKSIMEATVLAGEQRLRPIIMTSLAFAFGCL
FT                   PLALALGAGANARHSIGTGIIGGMIGETTLAMLYVPLFFYLFDRLAERRKGGGAPAAAA
FT                   APPTGQRE"
FT   sig_peptide     complement(206621..206728)
FT                   /locus_tag="CAP2UW1_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.703 at
FT                   residue 36"
FT   gene            complement(206738..207868)
FT                   /locus_tag="CAP2UW1_0167"
FT   CDS_pept        complement(206738..207868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0167"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gur:Gura_2665 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33526"
FT                   /db_xref="GOA:C7RJG2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG2"
FT                   /protein_id="ACV33526.1"
FT                   /translation="MHSATLVLGLAALAACGREPAKPAPPPLEVTTLTIEVRDVPVSAE
FT                   YVAQTQSSQAVNIQARVSGFLDKRVYTEGAVVKAGQLLFQIDPKPFQVQVDGAAAALQR
FT                   NQASLQVATANLKRTKPLVEQDALSQKDLDDAQGQYEQAGAAVAQSKAQLESAKLDLSY
FT                   TRITSPVAGVTSFAAVAEGTYVSSQNSQLTTVSVLTPMWVNFSISENEVERIRNNIRKG
FT                   LLKLPADNKLVVEIELGGGNLFPHTGKITFTDPSYNSQTGTFLIRATVDNPDGLLRPNQ
FT                   YVRARLQGALRPNAILIPQRAVQQGAQGHFVWLVNKEGKAEQRPIVVGDWYREHWFVSE
FT                   GLQAGDQLVVDGGMRLSSGATVTVKPPAPRPAAAGS"
FT   sig_peptide     complement(207815..207868)
FT                   /locus_tag="CAP2UW1_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.796 at
FT                   residue 18"
FT   gene            208045..209055
FT                   /locus_tag="CAP2UW1_0168"
FT   CDS_pept        208045..209055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0168"
FT                   /product="portal protein"
FT                   /note="PFAM: portal protein; KEGG: bph:Bphy_7142 phage
FT                   portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33527"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG3"
FT                   /protein_id="ACV33527.1"
FT                   /translation="MGFLSFLNRLRASSSDRSEWGDFWFELVSVRTSSGMRVSADNALR
FT                   LAAVYASVRILAETMASLPFVFYRQRADGGKDRVTDHWLYRLFAKRPNRYQNPYEWREM
FT                   LQGHLALRGNAYNRIVANGRREIVKLVPIHPDRIRMELTPSGDYRYRVTDRDAQFLELR
FT                   KFRITDIARLFRVPPHIIADLDRATFSNIEQQSLEFEMHTMTSWAERWEASLEAELLFD
FT                   GDDLAVEFGLANLMRSDAAGRSSYYQSRIQDGRLAGRWSHQSLPTARCAKRAGRRPPRS
FT                   PAVGSPSCPCMASSLSVATWSTTCRGRAASARSSLRLCWASRWRMTRSSDPDRHR"
FT   gene            209126..209518
FT                   /locus_tag="CAP2UW1_0169"
FT   CDS_pept        209126..209518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0169"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: bph:Bphy_7143 peptidase
FT                   S49"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33528"
FT                   /db_xref="GOA:C7RJG4"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG4"
FT                   /protein_id="ACV33528.1"
FT                   /translation="MVAIANRLAASGSYWIGCSASEFYVAPGGEVGSIAVWQAYFDYSQ
FT                   AFAAGGVKPTLISAGKYKVEGNPCAPLDEEAQGLMQSRVDDYYTSFTKVVARGRAVPIA
FT                   QVRDGMGQGRVLGADAAYAQRASEIL"
FT   gene            209849..210514
FT                   /locus_tag="CAP2UW1_0170"
FT   CDS_pept        209849..210514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33529"
FT                   /db_xref="GOA:C7RJG5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG5"
FT                   /protein_id="ACV33529.1"
FT                   /translation="MEILIDIILKAGRSAVELAFFVLLPVMVVMLTLMRMLEAQGMLDW
FT                   LAQRLAPALRPFGLGGLGVFAALQINFVSFAAPIATLTMMEQRGASDRHIAATLAMVFS
FT                   MSQANAAFPMMTMGLNFGTTLAFSLVGGLAAASATYYLFGRHLSAAEGVVDETLPHQSA
FT                   DSAKGVLDVINRAGAEAFKIAVGAIPMLVLSLVVVIALKRFGVIDLLTEWLTPPMLPT"
FT   gene            210781..211884
FT                   /locus_tag="CAP2UW1_0171"
FT   CDS_pept        210781..211884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0171"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33530"
FT                   /db_xref="GOA:C7RIX6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX6"
FT                   /protein_id="ACV33530.1"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT   gene            212178..212702
FT                   /locus_tag="CAP2UW1_0172"
FT   CDS_pept        212178..212702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33531"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW7"
FT                   /protein_id="ACV33531.1"
FT                   /translation="MQRIVAGITTLEQHVETTQKAAEVYRPKSCPHCGLGVVHQHGHYE
FT                   RKADRRAVPPRLNPIPILRYRCAGCRRTCSRLPECIAPRRWYDWSVQQQVLQQRLNGAA
FT                   EHPGGPPDRHTGARWWNWLQERGKDFVFHLRVRFAELGRAVDTHGFWHQVFNSLGLPRA
FT                   MFWLDQEMSVP"
FT   gene            212832..214154
FT                   /locus_tag="CAP2UW1_0173"
FT   CDS_pept        212832..214154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0173"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: gka:GK0880
FT                   IS1604-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33532"
FT                   /db_xref="GOA:C7RJG8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG8"
FT                   /protein_id="ACV33532.1"
FT                   /translation="MNRINPIALFRLSVLGSLTSRERLDHGELQQTIRALAEREYTIPG
FT                   TRRRHVAEKTIQGWYYTYLAQGIDGLTPKTRIDRGQSKLSQAIQTAILAAKRDNPRRSI
FT                   RQIRQLLEATGTVARGSLSRSTVHRLLQQHGLSRISGSASLPEEKRSFVAASAGAIWYG
FT                   DVMHGPRVPHEGKLVKGYLVSLFDDASRLVAHSAFCPGETALDIEGVLKQALLKRGIPI
FT                   KLVVDNGAAYRAETLQGICARLGIHLIYCRPYAPEGKGKLERWHRTCRDQFLSELDERH
FT                   INSFEDLNARLWAWLERVYHHTPHAGLDGMTPLARYQQDLSKIRSLGALAAQLDALFRY
FT                   RVSRRVRKDGTVSYQGARFEVPFELSGKTVCLVVDPHSGAVIEVEDEHGKGIGAATPLD
FT                   ALGNLDRQRNKSDPTDAAPASPSGPNLIELTYRQYYDRKGD"
FT   gene            214157..214951
FT                   /locus_tag="CAP2UW1_0174"
FT   CDS_pept        214157..214951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0174"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: gka:GK1917 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33533"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJG9"
FT                   /protein_id="ACV33533.1"
FT                   /translation="MYLQHFGLRHPPLGKDAAELWDDGALAQLAERFQWLLQSPGLGLL
FT                   TGEAGVGKTAALRLVTAKLNPHRYQVIYHAETDFGRADLYRCLAQSLGLQPSYRRAQLW
FT                   RDIKAHIHHLADAKQLLPVWILDEAQNLPPEFFRDFPAFLNFAFDSRDLITVWLVGHPI
FT                   LAQTLERASYAALAGRIQARVHLRPVLERERFAQLVGHALKSAGCAHTLLTDSGLELLR
FT                   QASKGLPRHAGRILRTAMRLAVPRALNHLPDDLLQAAIEELR"
FT   gene            214948..215145
FT                   /locus_tag="CAP2UW1_0175"
FT   CDS_pept        214948..215145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_p0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33534"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH0"
FT                   /protein_id="ACV33534.1"
FT                   /translation="MKRRPHSLFPDGLSDESAAAISEFLHQLAAACEARYLVQLRRHRS
FT                   RQMNLYDPEAPWRIPPGEPF"
FT   gene            complement(215344..216669)
FT                   /locus_tag="CAP2UW1_0176"
FT   CDS_pept        complement(215344..216669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0176"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33535"
FT                   /db_xref="GOA:C7RJH1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH1"
FT                   /protein_id="ACV33535.1"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTPSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARDGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDFVVGLQFMREAAPG"
FT   gene            217277..218146
FT                   /locus_tag="CAP2UW1_0177"
FT   CDS_pept        217277..218146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0177"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: cph:Cpha266_1254 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33536"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH2"
FT                   /protein_id="ACV33536.1"
FT                   /translation="MAGKKALFVGINKFANYSQFTLNGCVNDAKDMAALYKDLLGFKTT
FT                   EMSTLTDAQATKANIMARLNAMVADAKAGKLNYLVFSLSSHGTQMNDTSGDEPDGKDEA
FT                   FVPHDIAEKNGAWDPARIISDDEFHDLFVQLPANVLLEVYLDTCHSGTGLRGAEFGLHA
FT                   PRARYIAPPDHEFEQKTAKMRGFALDRPPAGSAKKGAAEASKAAVAGAHHVLWTGCKAN
FT                   QTSADAYFNGRYNGAFTYYFVKVMRDTQNKLSRKAVIAKMRALMKSGFAQTPQLEGNAT
FT                   NRGQAIVY"
FT   gene            complement(218302..218823)
FT                   /locus_tag="CAP2UW1_0178"
FT   CDS_pept        complement(218302..218823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_3056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33537"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH3"
FT                   /protein_id="ACV33537.1"
FT                   /translation="MAIPLYDVSVSSFLQVLGAVSGFLDKGASHCRETGTDPNDIVEMR
FT                   LYPDMLPFRFQIISVAHHSKGAIDGVQSGVFAPPTGMADQDYAALQAIVADARSALEKL
FT                   TRETVDAMQGKEVVFKFGERSIPFTAEGFLMSFSLPNLHFHATTAYDMLRMRGVPLSKR
FT                   DYLGRMQIKS"
FT   gene            complement(219078..220532)
FT                   /locus_tag="CAP2UW1_0179"
FT   CDS_pept        complement(219078..220532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0179"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mpt:Mpe_A1439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33538"
FT                   /db_xref="GOA:C7RJH4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH4"
FT                   /protein_id="ACV33538.1"
FT                   /translation="MNTDRISLSLISHTNAGKTTLARTLLGRDVGEVRDAPHVTLEATG
FT                   HSLISTPEGDELLLWDTPGFGDSARLARRLQQQGNPIGWFLAQVWDRFRDRAFWLSQQA
FT                   VRNVREQADVVLYLVNASEEPADVGYLAPELAVLEWIGKPVIVLLNQTGRPRPGDEEAA
FT                   DRERWHGALAGYRFVRAVLPLDAFARCWVQEITLLRAVGGVLPVERTAAYGRLVAAWQV
FT                   RREAQFDAAMALLAETLARAVADCETLPEKRLQGALRDLGRAIGVGRDDGGGDQARAVQ
FT                   ALAARLDANLRASMDRLLAIHELEGQAGSELLGRMARTVTLAAPVNAGKAALMGGALSG
FT                   ALTGLGADLMAGGLTFGAGLLTGAVLGALGGAGMARGVNRARGRLGTTLRWDDAFLSEL
FT                   VVALLLRYLAVAHYGRGRGEWHETEYPSFWQALVTGVVAENAAALVMVWDGRAADSSTA
FT                   AIARHARPLLAQVARTILARLYPDSF"
FT   gene            complement(220529..221980)
FT                   /locus_tag="CAP2UW1_0180"
FT   CDS_pept        complement(220529..221980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33539"
FT                   /db_xref="GOA:C7RJH5"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH5"
FT                   /protein_id="ACV33539.1"
FT                   /translation="MNEREALLTTALRVVETVDRDGHLWTDEDRAWASHAAAEVVGEGA
FT                   SPAAFVARRAGLAFERLRSRDQAFVAAVDGLGWRPWIGTAVIVLAFLAGVVIDHLGGGQ
FT                   RINLLAPPILGLLVWNLTVYLLIVVGWLRHQLGQAPAWSTVRRILVRWATGRDGWLRQR
FT                   GMHLPASVLARLISDWSTVAAPLYASRATRILHLAAALFAVGVVAGFYLRGLAFEYRAG
FT                   WESTFLGSEAVHRLLALMLAPGVWLTGQPLPDVEALAAIRFGVSPPTENAALWLHRLAA
FT                   TIVIVVVAPRLLLALLNALIERQRSADLIDRFDDPYFQRLLRGYRSTPLNLTVIPYSYH
FT                   PLPAALAGLQRVLARIFGSSAAMLCTPPVSYGEEDAPPSAARLDGNSPVFALFSLAATP
FT                   ENETQGAFVRALRSFASGAPVLLLVDEGPWRARFAADERRLAERRSAWRAQFADLALVP
FT                   IFLDLTTPDLAAAQSEIERRLEAAG"
FT   gene            complement(222014..223474)
FT                   /locus_tag="CAP2UW1_0181"
FT   CDS_pept        complement(222014..223474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0181"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: bra:BRADO3979 conserved hypothetical protein;
FT                   putative peptidase (caspase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33540"
FT                   /db_xref="GOA:C7RJH6"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH6"
FT                   /protein_id="ACV33540.1"
FT                   /translation="MPAVRRCLRLLATILLWLGCGALAAAPAATPGKGQVALVVGIGAY
FT                   QNAPPLPNPPKDARALADSLKKLGFQVELAIDPDKTRLEQAVKRFGDQLQGAKVGLFFY
FT                   AGHGLQVSGRNYLVPADAKIDNERSLPFAAVDADLVLTQMETSTPISLVFLDACRDNPF
FT                   SRSLARSMGTRSAAVGRGLAQIAAGEGSLIVFATQPGNVAEDGKADHSPFTEALLKNLA
FT                   APGLEVRQMLTRVRQQVKEQTNGKQIPWDHSSLTQDYYFLGPTTVVVQPQAAPAAQPKA
FT                   AGVDPMAVQLSLWESVRTSQDPADFEDYLKQYPDGKFAAIARRRVAALKTASLKEREPA
FT                   AKEPAAQPQPPPARPAAPVERQPAKASPAPPVAAPDAQAQAAFDVMMQGTATNLTVGTT
FT                   AQVQFQLRRSGSGVTAAIRVFPPLYATGVLQGQYQGGQCLMQGWMNEGFLLKMAGACSA
FT                   GSFSGQYQAESPGLVQQGVFRLQSRATN"
FT   sig_peptide     complement(223397..223474)
FT                   /locus_tag="CAP2UW1_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.640 at
FT                   residue 26"
FT   gene            complement(223604..224368)
FT                   /locus_tag="CAP2UW1_0182"
FT   CDS_pept        complement(223604..224368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0182"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   aeh:Mlg_1464 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33541"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH7"
FT                   /protein_id="ACV33541.1"
FT                   /translation="MRRVVFNQKGGVGKSTIACNLAAIAAARGRRTLLIDLDSQANASR
FT                   YVLGKALDEQKKTLAHYFDDILGYRLFPEALDAYVIHTPFANLDVLPSDSRLEELQVKL
FT                   ESRYKMYKLRESLDKLAGYDEIFIDTPPALNFFTRSALIAADTCLIPFDCDDFSRRALY
FT                   TLMDNVREIQADHNRALRVEGIVVNHYQARANLPLRLVDELRGEGLPILDAFLSASIKI
FT                   RESHHQALPMIHLDPRHKLTGEFAALYDLLSQ"
FT   gene            complement(224462..225172)
FT                   /locus_tag="CAP2UW1_0183"
FT   CDS_pept        complement(224462..225172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0183"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   azo:azo2859 probable carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33542"
FT                   /db_xref="GOA:C7RJH8"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH8"
FT                   /protein_id="ACV33542.1"
FT                   /translation="MNAKPTPSTADALLLPAVECRTGDSPQCAIIWLHGLGADGHDFEP
FT                   IVDEFDFDQLPAIRFVFPHAPMRAVTINGGYVMRAWYDIVSPDFAPGREEAEGVRQSAE
FT                   QIEALIARENARGIPDGRIVLAGFSQGGVIALHTGLRHPQRLAGVLALSCYLPLVDTLP
FT                   AEAHPANRDVPIFMAHGRNDPVIPYDFGKRSAKLLKVQGYALQWHGYAAEHTVCMEELR
FT                   DIEGWLQQILAAAC"
FT   gene            complement(225296..226390)
FT                   /locus_tag="CAP2UW1_0184"
FT   CDS_pept        complement(225296..226390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0184"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: bra:BRADO2458 putative 3-isopropylmalate
FT                   dehydrogenase (LeuB)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33543"
FT                   /db_xref="GOA:C7RJH9"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJH9"
FT                   /protein_id="ACV33543.1"
FT                   /translation="MKRDLRFHIAVLPGDGIGPEIVASSLHVLEVLNERMGGIGFDFWH
FT                   LEGGAAHYQKTGTAFSDENMAACKKADAVLLGAIGLPHVRYSDGTEVTTQLDLRVEMDL
FT                   YAGLRPIRSYPSLPRVLVDKRASQIDLVLVREQTEGILYSRCRGTIEDDRVAWETMMIS
FT                   RNGTSRVSEFAFRVAERRAKSRRRPGKVLCVDRSNALTSMAFFRRIFGEVAERHPSVSA
FT                   DYAYVDTTAMKLVKSPWEFDVLVTENAFGGILSDLAAGVVGSLGLAPSADIGEKHAVFQ
FT                   PAHGSAPHIAGQGLANPVAQILSVALMLDWLADQHGEPRLAHGARILEHAVEKALTVVC
FT                   PVEFGGKDGTAAITKAIIAQIRKS"
FT   gene            226683..227903
FT                   /locus_tag="CAP2UW1_0185"
FT   CDS_pept        226683..227903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0185"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG: fps:FP1733
FT                   Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33544"
FT                   /db_xref="GOA:C7RJI0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI0"
FT                   /protein_id="ACV33544.1"
FT                   /translation="MAFNPASRVQDYLVFGEFGDVNPSITDSSTYTFLSPERMAELFEH
FT                   EIEGCFLYSRHFNPTNKYLASALERMEDGESAQVMASGMGAISTTLMTLCGAGDEIVCG
FT                   RSIYGGTYALLKNLLPRFGVNTRFVDLCDHDAVRAAMTPRTRVVYCESLSNPLLEVSDL
FT                   PALAAIAHAGGARLVVDNTFTPMILSPLRHGADVVVHSLTKFVNGTSDCVAGCVVSSRE
FT                   FIARLNDINAGPSMLLGPVLDSTRAASILKNLHSLHVRLRQHGANALYLASRLETLGYP
FT                   VHYPGLASHPHHALLARLMNHGYGWGGMLTLDAGNHAAANRLMTLLQRDKVGYLAVSLG
FT                   YFKTLFTTPGHSTSSEIPLDERAAAGLSDGLIRFSIGLDEDIAQTMVRIEHCLAEANVM
FT                   PAAGAGV"
FT   gene            228711..230405
FT                   /locus_tag="CAP2UW1_0186"
FT   CDS_pept        228711..230405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0186"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: fra:Francci3_1922
FT                   transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33545"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI1"
FT                   /protein_id="ACV33545.1"
FT                   /translation="MGSGSDISYAGPSTSNGKPTPFAQVMVTLSKEAEIKLRSEANYWK
FT                   SQHQQALARLAQREADHRLAMAQAAAREAALRSELEKAEGKLRDLQKRLFGRKSERRSR
FT                   TEKDAASNDQKSARPRGQRPGVAGHGRRLESHLPAQVETIELDCPHCPECGLGYADFPG
FT                   TEDSEILEIDVKPYRRVIRRRRYRRTCRCPGTPGILSAPPPARLIARGKYGVSIWVHLL
FT                   LSKFSYGQPTHRLLRDWSDYDLTLSPGTLTGGLRALAPLFEPLEDALRCRLQSENRWHA
FT                   DETRWMVFAETEGKIGHRWYLWVFHSESVIHFVLDPTRSAQVPIAELSASQGGIVICDR
FT                   YSGYKKLARILGTILLAFCWAHQRRDFIELANAHPELSEWALSWVERIGELYLLNDARL
FT                   AVRADPVQWAARDDGLRQRVAQMANQREAERANPALKAPARKVLQSMQKHWSGLTVFVD
FT                   HPEVPMDNNVAERDQRTPVVARKNFYGSGSPWSGALAATMFSLLMTMRLWGINPRTWLT
FT                   AYLDACAANGSQPPADLSVFLPWAMDADLLAQRRRAAMDPADPIDSS"
FT   gene            230402..231259
FT                   /locus_tag="CAP2UW1_0187"
FT   CDS_pept        230402..231259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33546"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI2"
FT                   /protein_id="ACV33546.1"
FT                   /translation="MKPYCGRQFTLDELQTLRHLIEANPSASRAQLSRQVCALLDWFKP
FT                   NGELKDMTCRVAMLRMQADGLLTLPAAQRCAPRQPEYLATAATDPQSLLVRPVHELPPL
FT                   HLRQVSGSAHSRLWNEYIARYHYLGYTPMAGSQSRYFVFAGEHRVALLSFGASAWKLAA
FT                   RERFIGWQEDERQRNLPLVVNNARFLILPWIQSKGLASKILAIIHRQLPNDWLARYGYR
FT                   PVLLETFVETPRHRGTCYQAANWIKVGQTTGRGKKCPTSKPILPIKDIWLYPLHRNFRS
FT                   ILCR"
FT   gene            231902..233494
FT                   /locus_tag="CAP2UW1_0188"
FT   CDS_pept        231902..233494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33547"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI3"
FT                   /protein_id="ACV33547.1"
FT                   /translation="MATPAIGLGYPEWTTKAEKRGLDPLGMQTTSVALYQLLLPGISNV
FT                   TLRMRYYGFYAWLAQRYAKDLGDTSVERWCLYLRRAEALYSLIAVHAGAERGVAGVDWA
FT                   SRAFAASGPEVAFHPATDRGEGAPQYLKQKFGAFGAAYGSQLLDIGVLEVVPGHRVPVP
FT                   TRGIGDKLANAFESAIGASADAFIAAAKAGTVGKSSLTSLAPMLPSRIAATGPERDLYE
FT                   ELLLVGDPAQKPRATSRSHSLRLVLRIASDQRTSLRVDTLRWSLYASQCGGAPALTALG
FT                   AEEDQQRFAWAVYQANDLLHVSYETILKLALDILGGAPTGMPFEALLAQTVSRLMSALG
FT                   SHSVESWNELIASLVLAKDPVSEKDPMSEFMLQQTAFRSSRPEVVTSEDSARCSVLLLA
FT                   VLHKRFGDLLERIAREFPVLAQGDFLRSIVTEMRFLDEHATERFESLLARIVKQRVLDR
FT                   HLWVAIQKFRGPAGDYTFLIEADDGRMRLRQKDGPVLTNPRLSSAIAFLQDTHLLGPDG
FT                   PTPAGLRLIQEAA"
FT   gene            233491..235977
FT                   /locus_tag="CAP2UW1_0189"
FT   CDS_pept        233491..235977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33548"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI4"
FT                   /protein_id="ACV33548.1"
FT                   /translation="MKLFNCFSASGYHSSIITTFGIDFDAYEAIALPRLRDAGCNNNIV
FT                   VADARMLVQALGDGAHRPKFAGRRYSVVGTQCAGVFHPKLILQLGKASGRLLVTSANMT
FT                   TAGMAGNFEVAGEVAVAEDAMEAAPLLRAAVDYLLRFLAPASVARRQVEWTLKRARWLP
FT                   ASASPEAVVALQDGMRVAFLARNDGKGIAERFLEFVGDRVVTRLVVVSPYWDHDLRSLR
FT                   GLCDRFGAAKGAAFIQPQSALFPVHAHASAGPLALFDLNRVPGTASRFAHAKLFIAEGD
FT                   SGDCVLFGSANCTEAALGTSGQAGINEEACLARDLPAGDAVRLLGLEEALSAGAELAVS
FT                   SVPSFSPADDIPLSDLAARLPGRFELAGELLRWWPPSGLLSDEAAIRLLDQRGAPVAGS
FT                   LSRLGTQGSPANYRFDGTVAPHFAQVHQGQFVSSLAVVVVEQSIHESQRRAAGRGLANV
FT                   LDLLDDDEASEGLWLLEVIQKITEAEHEMRGPRGAAEQPPQQRPTTDAAPDSRVLSYDE
FT                   FVAGRRAEDGRTASAGSHLAATHQESVRSFLNALIGKRAVLEFSESQEDEGPVPDLGLG
FT                   DETADGAGAMESGDLPQSAPDGTGADQTAEAKRQLRQRQRYVQDTQRSIIDAVEAFLRG
FT                   LREQANGQSLGVVDLLRLRALLIVVLGAGSKKTDLLPRDLATQVRRRQVLPSVGEASWR
FT                   RLVGRLLYDFFRDRLGTRAPLIQSLRLESDGDMGLPEDVLECWATCFWATCAMREAVND
FT                   VGAPFHVTKSENMLAADLYRFTRLLPEQALGAVVHEVFSGMSRRYGDRLGVSAERVDQA
FT                   HLALVEPARIQSYAAR"
FT   gene            complement(236152..236607)
FT                   /locus_tag="CAP2UW1_0190"
FT   CDS_pept        complement(236152..236607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33549"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI5"
FT                   /protein_id="ACV33549.1"
FT                   /translation="MNGIRIRKTGAPDVIAASDGRLTLSVPIQIKRRSGRKLVTLPSGE
FT                   SAQPRPWDVAATPMQLALARGHRWLAMLESGEAQSITELAAREKIDNSYMCRMLNLTTL
FT                   APDIVEAILDETLPPHVTVHELAISPPVLWEEQHARIGVVGEEIQPE"
FT   gene            complement(236604..237962)
FT                   /locus_tag="CAP2UW1_0191"
FT   CDS_pept        complement(236604..237962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0191"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   mms:mma_2738 site-specific integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33550"
FT                   /db_xref="GOA:C7RJI6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI6"
FT                   /protein_id="ACV33550.1"
FT                   /translation="MSEALKRRVRCAVYTRKSTDEGMDQEYNSIDAQRDAGHAYIASQR
FT                   AEGWIPVADDYDDPAFSGGHMERPALRRMMADIEAGRIDVVVIYKIDRLTRSLADFSKM
FT                   VEVFERYGVSFVSVTQQFNTTTSMGRLMLNILLSFAQFEREVTGERIRDKIAASKVKGM
FT                   WMGGVPPLGYDVENRRLVLNEQEAKLIRHIFQRFFELGSSTALFNELKLDGVTSKAWTT
FT                   QDGKVREGRPIDKGMIYKLLNNRTYLGELRHKEQWVPAAHPPIIERELWDSVHAILSTN
FT                   CRVRGGVTQAVVPFLLKGIVFGNDGRALSPWHSTKKSNGRRYRYYIPMRDTKEQAGASG
FT                   LPRLPAAELESAVLEQLRGILRAPALLGDLLSQASKLDPTLDEAKVTVAMTRLDAIWDQ
FT                   LFPAEQTRIVRLLVEKVIVSPTDMELRLRANGIERVVLDLRREPAERRQEVLA"
FT   gene            complement(237959..238255)
FT                   /locus_tag="CAP2UW1_0192"
FT   CDS_pept        complement(237959..238255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0192"
FT                   /product="putative bacteriophage related protein"
FT                   /note="KEGG: neu:NE2540 putative bacteriophage related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33551"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI7"
FT                   /protein_id="ACV33551.1"
FT                   /translation="MVERNQRRIESLLETGQVRKCDRDTRPAVGTVLTREYRDVEYCVV
FT                   ATGDDQYEFNGRMYPSLSMIAREITGTRWSGPLFFGLKAPAQPATSARKGTRR"
FT   gene            complement(239058..239525)
FT                   /locus_tag="CAP2UW1_0193"
FT   CDS_pept        complement(239058..239525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33552"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI8"
FT                   /protein_id="ACV33552.1"
FT                   /translation="MKTTFSKLFLARLTVLVLASFAMAPVADAFGGGGGGARAGGGGNR
FT                   EVNTSNRDVRANNVRSTSVNNVNNTNVNVNRNVNVNVDNRGGWDNGYHPVATAAAVTTA
FT                   VVVTSAVVGSMVRTVPANCVPVNYGGLIYQQCGSTWYQPQGSQYVVINPPY"
FT   sig_peptide     complement(239436..239525)
FT                   /locus_tag="CAP2UW1_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.797 at
FT                   residue 30"
FT   gene            complement(239538..240263)
FT                   /locus_tag="CAP2UW1_0194"
FT   CDS_pept        complement(239538..240263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0194"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: reu:Reut_B4633 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33553"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJI9"
FT                   /protein_id="ACV33553.1"
FT                   /translation="MRLAREKCRTRAGTAQQVANAVDPASIQALKDMGAHLQSLKRFQV
FT                   STELTGERVLADGQKLQHSATADLEVDRPNKLRARMFSARSEREIFYNGQMATLYTPAQ
FT                   RYYSTVAFTDTLAVLVTKLQEKYAVQVPLSDLFVWGTAAAPLDKIDSAMNAGQDFVGQD
FT                   LCDHYAFRQGKIDWQVWITTGSKPLPRKIVITNRDDEARPQSVSLLDWNLKPTFTDAVF
FT                   KFTPPKGATEVELRSLDKK"
FT   gene            240384..242063
FT                   /locus_tag="CAP2UW1_0195"
FT   CDS_pept        240384..242063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0195"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p2A221 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33554"
FT                   /db_xref="GOA:C7RJJ0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ0"
FT                   /protein_id="ACV33554.1"
FT                   /translation="MFVKITTSGPRQYVKLVESYRDTAGVPRQRVIATLGRIESVRSGE
FT                   ADSLLNGLLRAAGKPSLEEGTGEVAFAPALSVGDTWLLTALWKELGFADAFRRLLRNRH
FT                   QFDAERLLRVMVFNRLCDPESKLGILRWLEGTRVPEVSADSVTHQHLLRTMDTLAEGAD
FT                   RVDDALAGLLRPLIDQELAIVFYDLTTIRAEGGTAESEDLRHFGHAKEGGTVRQVMLGV
FT                   VQTAEGLPIHHEVFAGNTGETTTLVPTIEKVLARYPIKRVVLVADRGLLSLDNLDAIRA
FT                   LRVDDQPLEFILAVPARRYGDFDSLLAPFHEKICHSATAEVFGELKWEGFRLIVAHRPD
FT                   MASEQSRVRDERIAALEADAAQWAEKLDAQDAGQTHPGKKLSDAGTIARFYKAVADAHL
FT                   THIIKVNLASEVFTYEIDERALKRARLMDGKLILVANVPDSLPAEIVARYKALADIERG
FT                   FRVLKSEIEIAPVFHRLPDRIRAHALICFLALLLYRVLRLRLKAKASPISPERALEIAR
FT                   RIQYHQITLHQRQSASGLSAITPQQKELFETVALPEPSARRL"
FT   gene            242254..242556
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0196"
FT   gene            242768..244363
FT                   /locus_tag="CAP2UW1_0197"
FT   CDS_pept        242768..244363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0197"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: rba:RB3877 aryl-sulfate
FT                   sulphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33555"
FT                   /db_xref="GOA:C7RJJ1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ1"
FT                   /protein_id="ACV33555.1"
FT                   /translation="MNKFTWRRAATWLVATAMALIAASPAFAQAQKKPNILVIWGDDIG
FT                   TWNISHTNRGMMGYMTPNIDRIAREGVGFTDYYAQQSCTAGRAAFISGSVPVRSGMTKV
FT                   GLPGAKEGWQKTDVTMATILKSQGYATGQFGKNHQGDRDEHLPTVHGFDEFMGSLYHLN
FT                   AEEEPENRDYPRDLKLPNGKTFLQQFGPRGVIKSKADGKGGQTIENLGPLTKKRMETID
FT                   EESLAAAKEFLTRQAKEGKPFFVWWNATRMHFRTHVKPEHTGISGKSGDEYHDGMVEHD
FT                   MHVGELLKLIDELGLANDTIVQYSTDNGPHYNTWPDAGTTPFRGEKNSNWEGAYRVPAF
FT                   VRWPGHFPAGTTLNGIVSHEDWLPTFAAAAGAPDIKEKLLKGATLNGRSYKNHIDGYNQ
FT                   LDYLSGKTNESPRKEFIYVGDDGAVMAIRVGDWKAVYLENRGYQLDVWREPVAHLRLPL
FT                   VFNLRRDPFEKSQHNSNTYHDWMIDRAYVLIPLQAVATKFLLTLKDFPPSQTPGDWSLD
FT                   SLEKQIKGMTTSGK"
FT   sig_peptide     242768..242854
FT                   /locus_tag="CAP2UW1_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 29"
FT   gene            244431..245432
FT                   /locus_tag="CAP2UW1_0198"
FT   CDS_pept        244431..245432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0198"
FT                   /product="nonspecific acid phosphatase precursor"
FT                   /note="KEGG: rba:RB6740 nonspecific acid phosphatase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33556"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ2"
FT                   /protein_id="ACV33556.1"
FT                   /translation="MKKILSKIAAVLLSAAAAMAFAAPVVDPLPSWNDTASRRAIVEFV
FT                   EKVTHEASPNYVPAPERIATFDNDGTLWAEQPMYFQAFFIVDRIKALAPKHPEWTTQEP
FT                   FASVLKGDMKAALAGGEKALLEMVMATHAGMSTAEFEQIVKDWIATAKHPKTGRPFTEM
FT                   VYQPMLELLAYLRANGFKTYIVSGGGIEFMRPWTEKVYGVPPEQVIGSSIKTKYEIRDG
FT                   KPVLVRLPEINFIDDKAGKPVGINQQIGRRPIAAFGNSDGDLQMLQWTTAGAGPRFALI
FT                   VHHTDAEREWAYDRKSHIGKLDKALDEAQARGWTVVDMRRDWKTVFAAPTKQ"
FT   sig_peptide     244431..244499
FT                   /locus_tag="CAP2UW1_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            245524..245865
FT                   /locus_tag="CAP2UW1_0199"
FT   CDS_pept        245524..245865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33557"
FT                   /db_xref="GOA:C7RJJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ3"
FT                   /protein_id="ACV33557.1"
FT                   /translation="MVTSAFLWLLPLLMLAPALLAAKRRARPAYAALVGEHERMVHRRW
FT                   ILREPVADPTLLEAAEIGPVADTAAIYHAVKAMRPAPIGMRAMVAIMLPIALPMLLAAA
FT                   LQIQSRISS"
FT   sig_peptide     245524..245589
FT                   /locus_tag="CAP2UW1_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.803 at
FT                   residue 22"
FT   gene            246002..246781
FT                   /locus_tag="CAP2UW1_0200"
FT   CDS_pept        246002..246781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0200"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: reu:Reut_B4633 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33558"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ4"
FT                   /protein_id="ACV33558.1"
FT                   /translation="MVRKKLVLSLLAISLAAPGIHAQTAPAAAPAAVPAVANAVDPASI
FT                   QALKNMGAYLQTLKRFQVSTELTGERVLADGQKLQHMATADMDVERPNRLHARIWSARA
FT                   ERELIYDGKTATLYTPAQKYYSTVEFSGNLGELINKLEERYGVEVPLADMFIWGTPAAS
FT                   FDKIESAMNAGQDFIGKDLCDHYAFRQGMFDWQIWITTGDKPLPRKLVITNRNDDARPQ
FT                   SLQLIAWNLKPTFKDAVFRFTPPKGATAVEIRPLVQK"
FT   sig_peptide     246002..246070
FT                   /locus_tag="CAP2UW1_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            246794..247264
FT                   /locus_tag="CAP2UW1_0201"
FT   CDS_pept        246794..247264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33559"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ5"
FT                   /protein_id="ACV33559.1"
FT                   /translation="MKKSFSKIFLAPLTVLVLASFAMAPVAEARGGGGHFSGGGGGGNR
FT                   QVNNARADVRTNNVRNTSVNNVNVNRNVNVNANNNRGGCCNGGWDNNYHPVATAAAVTA
FT                   AVVVTSAVVGSMVRTVPAGCVPVNYGGMIYQQCGSTWYQPQGSQYVVINPPY"
FT   sig_peptide     246794..246883
FT                   /locus_tag="CAP2UW1_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 30"
FT   gene            complement(247661..248635)
FT                   /locus_tag="CAP2UW1_0202"
FT   CDS_pept        complement(247661..248635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0202"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   pna:Pnap_0429 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33560"
FT                   /db_xref="GOA:C7RJJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ6"
FT                   /protein_id="ACV33560.1"
FT                   /translation="MVQQCVLAGVCRSTIYAQQKPAVVDASDLLYSRLIDEEYTRHPFY
FT                   GSRRMVIFLGKAGHTVNRKRVQRLMRLLGLAGMAPGPNTSRPHPEHQVYPYLLRGVPVV
FT                   RPNQVWSTDITYIRLARGFAYLVAVIDWYSRKVLSWRISNSMEAAFCVDCLEDALRTHG
FT                   RPEIFNSDQGSQFTSTAFTDVLKREGVVISMDGRGRVFDNIFVERLWRSVKHEDVYLKG
FT                   YATLGELTVGLAEYFAFYNGERPHQSLSDKTPDVVYRTAIGGGALILDKFGGAGGESPV
FT                   PLRSTGDSPPAEARSTSESTATTKPTAKPGQRRPAATAVESTA"
FT   gene            complement(248674..248973)
FT                   /locus_tag="CAP2UW1_0203"
FT   CDS_pept        complement(248674..248973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0203"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pna:Pnap_0430 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33561"
FT                   /db_xref="GOA:C7RJJ7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ7"
FT                   /protein_id="ACV33561.1"
FT                   /translation="MSETKTRKVHTPEFKAKVGLEAVRGVKTINEIGQEYGVHPVQVGQ
FT                   WKKAIQDQAKTLFEGKRGPKPLAAHREPERLYSEIGKLKMELDWLKKKSGISPS"
FT   gene            248992..249657
FT                   /locus_tag="CAP2UW1_0204"
FT   CDS_pept        248992..249657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0204"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: eba:ebA2691
FT                   phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33562"
FT                   /db_xref="GOA:C7RJJ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ8"
FT                   /protein_id="ACV33562.1"
FT                   /translation="MAHSLNYCLNSGDHYNRTLSADELRAYLAELGDNLADQALLLTLL
FT                   AGGQRVAQLLRPKVSDYDTGTATLRLWDAKGRTTSPREHLLPLAPRAAALVAHLIARAE
FT                   AKGSPLLFSTYGQTQLADTTPGKRAAEIGAAVTGEPFDLRDIRRTCETMLASMGISRDT
FT                   RAQLLSHGLSGVQVSHYDRDAYTDEKRAALMAWESRLHEIATGTARSNVLSMKQRNAT"
FT   gene            249688..249966
FT                   /locus_tag="CAP2UW1_0205"
FT   CDS_pept        249688..249966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0205"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   bch:Bcen2424_3084 plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33563"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJJ9"
FT                   /protein_id="ACV33563.1"
FT                   /translation="MIKSFQHKGLQAFFETGSKAGIQPHHSQKLLRLLARLDVAKVPED
FT                   MNLPGWRLHSLAGNLAGFHSVSVNGNWRMTFTFEDGDAVLVDYLDYH"
FT   gene            249977..250291
FT                   /locus_tag="CAP2UW1_0206"
FT   CDS_pept        249977..250291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0206"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="TIGRFAM: addiction module antidote protein, HigA
FT                   family; KEGG: bcm:Bcenmc03_3101 putative plasmid
FT                   maintenance system antidote protein, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33564"
FT                   /db_xref="GOA:C7RJK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK0"
FT                   /protein_id="ACV33564.1"
FT                   /translation="MNRMHAYPHPGEALREDVLPALGLSVTAAAAQLGVTRAALSRVLN
FT                   GRAAISPEMALRLEGWLGVENGGRADAWIAQQAAFDLWKARQAGAPTVRRAQVEIAPTV
FT                   "
FT   gene            complement(250296..251546)
FT                   /locus_tag="CAP2UW1_0207"
FT   CDS_pept        complement(250296..251546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33565"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK1"
FT                   /protein_id="ACV33565.1"
FT                   /translation="MKQPDDLSAYYEELLEGRYDCVDRIVLNGYFPLGQQAISLEKEGN
FT                   CFVGGSFQALDQLADTLCDEHAIGRLAKVCDRWVYSSCLCFALTIEEQERSRFRYRYSV
FT                   YQIEYSRNLLFVRGTTLDAVFQGLIDRTRRLLDVPILRTLFGRKQRPRWRADRSHGVAR
FT                   IVDQSAYDLTVFKVHFGALTLKLYDKGARVLRAEAIAHNIKELRCGRSLEKLSIMLAKL
FT                   QHMAIDFLNAMQAAHVSFLPDGVLDSLIEPTERGNRRLSGVDLQKPRMRSVAEAILHLA
FT                   PNPDGFTVQELADEVRPSLPEVSRDAYTGRQAAYDLMKLRGKCLIERIAKTRRYRPQPT
FT                   GISILAGWLILREKVIKPVLAGAGTPHLGPPPKNIQALDQHYENLQRELRRTFDTLLIT
FT                   VAPGSNTNTNMFASTPA"
FT   gene            complement(252477..252550)
FT                   /locus_tag="CAP2UW1_R0004"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(252477..252550)
FT                   /locus_tag="CAP2UW1_R0004"
FT                   /product="tRNA-Thr"
FT   gene            252708..254501
FT                   /locus_tag="CAP2UW1_0208"
FT   CDS_pept        252708..254501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0208"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dar:Daro_0787 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33566"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK2"
FT                   /protein_id="ACV33566.1"
FT                   /translation="MPSLSNPSEIAREALRLLAARRMSPSPENYRALYYEIAGIADHVA
FT                   EAFPEQDLKALPASLPRATASQQRLAKRFEQALGGRNWEEVQAGVAELAKEIGREQDLP
FT                   WSELLGEFLRQWEGKQAGLTVARKREALERVLAGGSTNRELLFGRLQGLVKSWSLNAPV
FT                   ADEIPLVEPETLAAPSSAAVMAAEGGATPSAGTTSEPAAELRELFAYTLEAVITTQLGD
FT                   EPELAAEARDLAHKVRTTMSRAAMDGLLTAIKRFAFRLDILAEDRGELRAGLLNLLQLL
FT                   IQNVGELVVEDHWLKGQIDIVRDIVAQPLSLRSIGDAESRLREVIFKQSQLKHSLNEAK
FT                   EALKQMLAGFVDHLAEFADSTSDYHDKIEVCADRISKAEDINQLEDVLAEVIRETQIIQ
FT                   LNAQRSRDDLRNAKLRVEEADKRISELQAELDRASTLVRHDQLTGALNRRGLEEAFGKE
FT                   TARSRRRQSCLCVALLDIDNFKKLNDSLGHDAGDAALIHLATVIRETMRPQDTIARYGG
FT                   EEFIILLPDTSIEDAQTAIVRLQRELTRRIFLHNNDRQLITFSAGVTDFRAEDTQLSVT
FT                   KRADEAMYAAKQAGKNRVLVG"
FT   gene            complement(254539..255339)
FT                   /locus_tag="CAP2UW1_0209"
FT   CDS_pept        complement(254539..255339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0209"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   dar:Daro_0656 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33567"
FT                   /db_xref="GOA:C7RJK3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK3"
FT                   /protein_id="ACV33567.1"
FT                   /translation="MSETAGDPGRRFGGIARLYGAGALSRLQSAHVAVVGIGGVGSWAV
FT                   EGLARSAVGRITLVDLDMVAESNVNRQVHALEGEFGKAKVSAMAQRIQSINPACLVTEI
FT                   EDFVTPENVDTILAGHFDYVIDAIDQVRSKAAMIDWSKRRGVPLITAGAAGGQIDPTQI
FT                   RVADLALTIQDPLLARVRALLRKDYGFTREAKKKFGIPAVFSGEALRYPDRAIGCAEPR
FT                   ALSGLNCAGFGSSVCVTAPFGLLAAGEALRALAGGKSPVAEALA"
FT   gene            complement(255336..256445)
FT                   /locus_tag="CAP2UW1_0210"
FT   CDS_pept        complement(255336..256445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0210"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; Hpt domain protein; KEGG: dar:Daro_0657
FT                   metal-dependent phosphohydrolase, HD subdomain:Hpt"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33568"
FT                   /db_xref="GOA:C7RJK4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK4"
FT                   /protein_id="ACV33568.1"
FT                   /translation="MDRQMIVAPVAADRETLQDFIDSLRDYAPGIEGDIAHLRSTPADR
FT                   GAIGSLFRALHSIKGDATICRLDLAVAIVHPVESILDRVRQGELPFSEQIAEVILLTID
FT                   RLELAMAGLSAGDRLDGLHLVSLVEGLERLASAPTGQFEDCVAEVIEAVTGFRPVSATA
FT                   VSTRREAPGLRSTANSPTDDDLRFFHTLADQFEARSPIFKGRTLRLLRLALETNRLAGE
FT                   TIDPLQLEAAVYMHDIGMMFLPESAWLKTSALTAEEKAMLRTHPAYAAGLLARMSGWAG
FT                   AAEMVAQHHETPDGKGYPAAHKAAQICPGAKLLAIVDAYEAVMLKHGSHGRTRSLLRAI
FT                   AEINACDTQFAPEWIEPFNRVIRRAADAR"
FT   gene            256659..257003
FT                   /locus_tag="CAP2UW1_0211"
FT   CDS_pept        256659..257003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0211"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   dar:Daro_3469 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33569"
FT                   /db_xref="GOA:C7RJK5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK5"
FT                   /protein_id="ACV33569.1"
FT                   /translation="MPIVTTPSGLQIEEIIVGSGPTASVGQHVIVHYTGWLADGKKFDS
FT                   SKDRNEPFRFPLDGRHVIAGWEEGVPGMSVGGIRKLTIPADLAYGARGAGKMIPPNAKL
FT                   VFEIELLDIA"
FT   gene            257007..257924
FT                   /locus_tag="CAP2UW1_0212"
FT   CDS_pept        257007..257924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0212"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: eba:ebA4056 propable 16S pseudouridylate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33570"
FT                   /db_xref="GOA:C7RJK6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK6"
FT                   /protein_id="ACV33570.1"
FT                   /translation="MAERPRKTLLSRPPPAADGVATTGTGHPPHPARGRLVRAPAVSPR
FT                   VVPGSPATKVAATVVSAPPGGVRISKLMAERGLCSRRDADDYIARGWVFVDGRRVSELG
FT                   TRADPGAAITLDTAAQTQQRKQMTILLHKPVGYVSGQPEPGCTPAVTLIQPERQFRTPD
FT                   TPVFHPSCLRGLAPAGRLDIDSTGLLVLTQDGRVARQLIGEESTVEKEYLVRVDGRLAD
FT                   KDLALLNHGLSLDGRQLKPARVEWLNDDQLRFVLREGRKRQIRRMCELVGLRVTGLKRV
FT                   RIGAVRLADLPLGQWRFLRPDEVF"
FT   gene            complement(257965..259005)
FT                   /locus_tag="CAP2UW1_0213"
FT   CDS_pept        complement(257965..259005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0213"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: dar:Daro_0044 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33571"
FT                   /db_xref="GOA:C7RJK7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK7"
FT                   /protein_id="ACV33571.1"
FT                   /translation="MNGEKLPHFVERDADLGGRTTLALPGRAAFYAEIKSVEQLAQLAG
FT                   KSALRRFVLGAGSNLVLTGDFDGLVLHMAIGGRELIGEDDDAWYVRGGAGEDWHAFVEW
FT                   TLAKGCWPGLENLALIPGTVGAAPIQNIGAYGLELADRFQSLEACDMLTGRTVRLDRDA
FT                   CRFAYRDSVFKQQGWHLDARLVITRVTFRLPKAWQPLASYADLAAELDQRQLGRPNARQ
FT                   IADAVIAVRRRKLPDPASVPNAGSFFHNPLVEANVGERLAAAHPDLPSYLQADGRVKLA
FT                   AGWLIERCGWKGRTLGQAGMYEKQALVLVNRGGATGAEVLALARAVQDAVRERFGVALT
FT                   PEPVFL"
FT   gene            complement(259025..262741)
FT                   /locus_tag="CAP2UW1_0214"
FT   CDS_pept        complement(259025..262741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0214"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: eba:ebA3184 B12-dependent
FT                   methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33572"
FT                   /db_xref="GOA:C7RJK8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK8"
FT                   /protein_id="ACV33572.1"
FT                   /translation="MQLDRTAELKARLEHDILVLDGAMGTMIQRRGLREADYRGTRFAA
FT                   HPHDLKGNNDLLLLTRPDIIRAIHAEYLAAGADIIETNTFNSTSASQADYRLEAIVYEL
FT                   NVAGAQLARAVCDEFTAGNPAKPRFVAGVLGPTSRTASISPDVNDPGYRNTSFDELVDT
FT                   YAEAIRGLCDGGADILLVETVFDTLNAKAALFAIERHFDEVGRRWPVMISGTITDASGR
FT                   TLSGQTAEAFWNSLNHIRPLCFGLNCALGAADLRQYVEELSHLCECFVSAHPNAGLPNA
FT                   FGGYDETPEQLAAEIGDWARKGFVNIVGGCCGTSPAHIAAIAASVAGVQPRVIPERERK
FT                   LRLSGLEPFNVGRDSLFVNVGERTNVTGSRAFARMILEGRFDDALAVARQQVENGAQVI
FT                   DINMDEAMLDSQAAMDRFLKLIASEPDISRVPIMLDSSKWEVIEAGLKCIQGKGIVNSI
FT                   SMKEGEAEFLRQARLARRYGAAVVVMAFDETGQADTYTRKTEICARAYRLLTEQAAFPP
FT                   EDIIFDPNIFAIATGIEEHNNYAVDFIEACAWIRAHLPGAQISGGVSNVSFSFRGNDAV
FT                   REAIHTVFLYHAVKAGLSMGIVNAGMLGVYDDLDPALRDKVEDVVLNRRPDAGEALVEF
FT                   AQTVKEGRSREGGMGGPDLAWRDFEVEARLTHALVKGINDFVVADTEECRATVESAGKP
FT                   PLSVIEGPLMNGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAHLIPYIEAEKLRTGVSS
FT                   KGKIVIATVKGDVHDIGKNIVGVVLGCNGYDVVDLGVMVGCDKILHAAREHGAQAIGLS
FT                   GLITPSLEEMSHVAAEMERLGFATGTDGSPPVPLLIGGATTSRAHTAIKIAPNYSGPVV
FT                   YVPDASRAVGVVTKLLSIDNADAFKAGLAADYEKLRAQHAGKKGTTLLALEAARDNRFV
FT                   WNGEATYRPSAPKRPGLHVLRAIDLATLAGFIDWAPFFQTWDLAGSYPKILDDPLVGAT
FT                   ARAVFSDAQAMLDKVIAENWLSANAVFGIFPANSVGDDIEIYADETRAKTLMTWHNLRQ
FT                   QHERPAGKPHYCLSDFVAERGTPDWIGAFAVSAGFGIEEKLAEFAAAHDDYHAIMLKAI
FT                   ADRLAEACAEWLHARVRREYWAYAGDEGLDPEALIREAYRGIRPAPGYPACPDHTAKGA
FT                   LFAMLDAPRNAGIELTESFAMTPAAAVSGFYLAHPQARYFAISKIAGDQLADWAQRAGF
FT                   SVPEAQRWLAPLL"
FT   gene            263061..264239
FT                   /locus_tag="CAP2UW1_0215"
FT   CDS_pept        263061..264239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0215"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: swd:Swoo_2828 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33573"
FT                   /db_xref="GOA:C7RJK9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJK9"
FT                   /protein_id="ACV33573.1"
FT                   /translation="MTLPSPATSLDDNVQLARIRIFFGHASGNMASILVGAILIAVVLH
FT                   SGGVSLPTLGVWGLFVCAASAGVLLVERRVKKTGVTAGNCQRLVNLRIGLGAGIALSYG
FT                   IVGFLLPGTAPAQDTFLFIIVSTVVTVAALGYAVMPRYYLTLNVVSLLPLTGHFAQQYL
FT                   AHADSYYLLLIAVAIMWQAIVLAKARQVSATAIGAIVLNERLQQEIEENRRTREAIRHM
FT                   ALHDDLTALGNRRYFEETIARTLSIASRDQGKVGLLAIDLDNFKPINDRYGHTAGDRVL
FT                   KAVAARLLSSIRAADFCARMGGDEFAIIVASVHAESDVADVASKLRLALAEPFQLDAIV
FT                   VRISASVGFAVYPDDGIGASALWSVADRRMYRAKASRVSEQPLAMPLHELGE"
FT   gene            264330..264932
FT                   /locus_tag="CAP2UW1_0216"
FT   CDS_pept        264330..264932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0216"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: rfr:Rfer_0614 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33574"
FT                   /db_xref="GOA:C7RJL0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL0"
FT                   /protein_id="ACV33574.1"
FT                   /translation="MNYTFASATILLLLITDPIGNIPIFANALRHVAPERRPWVILREV
FT                   LIAFVLLLTFMFVGEGFLRLMNLSELSLQIGGGVILFLIALRMIFPPPNPDTPDTTGEP
FT                   LIVPLAIPAIAGPSALATVLLLVSQAPDRRLEWIAALCITMAVSAVVLVLAERIQRVVG
FT                   DRFVVALERLMGLVLVAMSIEMMLRGIKTFATQITRM"
FT   gene            complement(265070..267037)
FT                   /locus_tag="CAP2UW1_0217"
FT   CDS_pept        complement(265070..267037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0217"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: mex:Mext_2071
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33575"
FT                   /db_xref="GOA:C7RJL1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL1"
FT                   /protein_id="ACV33575.1"
FT                   /translation="MRSKIVTADEAIALIRDGDTLASTGFVQTGFAEALLSALERRFLT
FT                   TGRPRNLALFAAAGQGDGKTLGLNHLGHEGLLRRVVAGHWGRMPTVAKLALDNRIQAYN
FT                   LPQGIICQLFRDLASGKPGSFSKVGLHTFVDPRYGGGRVNAATTKDIVSLVEVEGEEWL
FT                   FYKVGTVNVAFVRGTTADTFGNITMEREALTLNNLAMAMAAKNSNGIVIAQVERIAERS
FT                   GLPPRQVKIPGILVDCVVVAEPAQHMQTLATQYNAAYAGEFRVPAASLVSTPLTERKII
FT                   ARRAAFELPPNGIINLGVGMPEGVAAVANEERISHLLTLTVESGLIGGIPSSGGNFGTG
FT                   VNMDAVIDENQQFDFYDGGGLDMACLGMAECDAAGNVDVSRFGGRLTGAGGFINISQNA
FT                   RLVVFVGTFTGSGLKVDVDNGKLRILQEGVQKKFVRQVEQITFNGQYAYDRGKPVYYVT
FT                   ERCVFRRVRRGLALIEVAPGIDVGRDILAHMDFEPIIGEYGEMDARIFSANPMGLEAEL
FT                   LNLSLPERVIYDPERNILFLNFEGMHVRGSDDVQAIWDICELRCRAAGQRVGVIINYDR
FT                   FRINQDMYDAYAEMDRYFLANYFSQITRYATSAFLRAKLGEAFSARSIAPHVFERREEA
FT                   QAFLAGRSGDYGPQPSSGLP"
FT   gene            complement(267806..269260)
FT                   /locus_tag="CAP2UW1_0218"
FT   CDS_pept        complement(267806..269260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0218"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33576"
FT                   /db_xref="GOA:C7RJL2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL2"
FT                   /protein_id="ACV33576.1"
FT                   /translation="MTKTARLAVPNNAQAENEITMQASASLETLETEIPAIEPKMAGLL
FT                   EFTRANDSRLTPKEINAQLDLVLRDYDDLTARYAENNRLIDTALAELRQSGGAVSSQVH
FT                   RLDADLQQQRMSLAAHATATEQRIEAVAEDARGHLAETEQRWETRLASDNARIGADLTR
FT                   LGAGIGSLHGLFAAQERIIAEQRVRLDQFDLTYELLDSVTRGNKSRIEAVREQAAKQHA
FT                   IVEARLEGLSALQREHHAEFQTLQGLVGVLQSETQRLDAAIGELATAQADHRSATRDTF
FT                   KWTHRAIAALLLLTISGFVLVKWVPAFAPASSESAIAKNDARITEVSSQMASLSAAEAA
FT                   RKTSDALQQGRLEQVSDKVSGLEKSLGELRTALRKIGVPSGGAAVVHDSQWLLRQHPKA
FT                   YTVQLVMSPSRDDMARFIDRNMEHLTLNSLAFSATEHQQREHYNLFFGVFDTIAQARAA
FT                   IAALPAELRVNQPWVRQLQSVQDSLR"
FT   gene            complement(269494..269808)
FT                   /locus_tag="CAP2UW1_0219"
FT   CDS_pept        complement(269494..269808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33577"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL3"
FT                   /protein_id="ACV33577.1"
FT                   /translation="MRIGSLRTPQAAGTIELAGHLDESIAALPDTASGISTACDATGLS
FT                   TTGQDGGQENTGHECAFPVTATSYESFALGQRYRKWGGHQKLLRCTHPAVRLGRRTLAT
FT                   "
FT   gene            269910..270920
FT                   /locus_tag="CAP2UW1_0220"
FT   CDS_pept        269910..270920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0220"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: cvi:CV_1832 sulfate transport
FT                   system sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33578"
FT                   /db_xref="GOA:C7RJL4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL4"
FT                   /protein_id="ACV33578.1"
FT                   /translation="MNVQESLAGLLVGALLLGSASAAEITILNVSYDPTRELYQDFNAA
FT                   FGKYWQAKTGDTLRVKASHGGSGKQARSVIDGIDADVVTLALAFDIDAIADRGIVPLDW
FT                   QKRLPSNAAPYTSTIVFLVRKGNPKAIRDWNDLVKPGVSIITPNPKTSGGARWNYLAAW
FT                   AYALKQPGGSETRAREFVGQIYGNVKVLDSGARGSTTTFVERGIGDVLIAWENEAYLAI
FT                   KELGPDKFEIVTPSLSILAEPPVSVVDRVVDKRATRKVAQAYLDYLYSPEGQEIAARHY
FT                   YRPRDAKVSAKYAGQFGKVNLVTIDDTFGGWRYAQKTHFSDGGIFDQIYVPGGKR"
FT   sig_peptide     269910..269978
FT                   /locus_tag="CAP2UW1_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 23"
FT   gene            271105..271941
FT                   /locus_tag="CAP2UW1_0221"
FT   CDS_pept        271105..271941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0221"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azo:azo1335 sulfate
FT                   transport system permease protein probably"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33579"
FT                   /db_xref="GOA:C7RJL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL5"
FT                   /protein_id="ACV33579.1"
FT                   /translation="MTSVKRYSPLPGFRLAMGYTLVYLTLIVLIPLAAVGTKTLTMGWE
FT                   AFWAAVSSPRVVASYQLSFGASLLAAAINVVFGLIFAWVLVRYRFPGKGLIDSLVDLPF
FT                   ALPTAVAGIALATIYSENGPVGKLLEPWGIEIAYTPNGVLLALVFIGLPFVVRTVQPVL
FT                   GDLEKEVEEAAAGLGASRWQTFLRIILPHIAPALLTGFAMAFARAVGEYGSVIFIAGNV
FT                   PMVSEITPLLIITKLEQYDYAGATAVASVMLVFSFVLLLIINGLQGWMQNRHAKGA"
FT   gene            271943..272836
FT                   /locus_tag="CAP2UW1_0222"
FT   CDS_pept        271943..272836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0222"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mms:mma_0813 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33580"
FT                   /db_xref="GOA:C7RJL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL6"
FT                   /protein_id="ACV33580.1"
FT                   /translation="MSATIALHAGSLEHAETASTREPAWVRVVLISIALTFFAVFLLLP
FT                   LGTVFAEGLRKGWAAYVAALVNDDAWDAIKLTLITAAIAVPLNLVFGVAAAWSIAKFEF
FT                   PGKRLLITFIDLPFSVSPVISGLIYVLLFGAQGWFGPWLQEHDIRIIFAVPGIVLATIF
FT                   VTFPFVARELIPLMEAQGSEEEEAAVVLGASGWQVFWYTTLPNIKWGLLYGVILCNARA
FT                   MGEFGAVSVVSGHIRGQTNTMPLYVEILYNEYNYAAAFAVASLLALLAIVTLALKTLVE
FT                   RQTRRQLQEIIEPSGE"
FT   gene            272840..273907
FT                   /locus_tag="CAP2UW1_0223"
FT   CDS_pept        272840..273907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0223"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: azo:azo1333 putative sulfate transport
FT                   ATP-binding protein; TIGRFAM: sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33581"
FT                   /db_xref="GOA:C7RJL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL7"
FT                   /protein_id="ACV33581.1"
FT                   /translation="MSIAIRNISKQFGAFKALDDVSIDVPSGELVALLGPSGCGKTTLL
FT                   RIIAGLDFADSGQIVLDGDDASARHVRERHVGFVFQHYALFRHMSIADNVAFGLRVKPR
FT                   RERLAEADIKRRVKRLLELVQLDWLADRYPSQLSGGQRQRIALARALAVDPKVLLLDEP
FT                   FGALDAKVRKELRRWLRQLHDEIHVTSVFVTHDQEEALEVSDRVVVINKGKVEQIGTPE
FT                   SVYDHPATPFVANFLGSVNLFHGRVEDGHLHVGNDALALGASEGSDGKAVAFVRPHEFD
FT                   LVPGWDEQGALAARIVRVVSVGPSAQIELAHGDGKLIEVSLGRDAFRLLGLSEGDRVSL
FT                   RPRHIRVFPTDALAA"
FT   gene            273917..274852
FT                   /locus_tag="CAP2UW1_0224"
FT   CDS_pept        273917..274852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0224"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: dar:Daro_2129 transcriptional
FT                   regulator CysB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33582"
FT                   /db_xref="GOA:C7RJL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL8"
FT                   /protein_id="ACV33582.1"
FT                   /translation="MNFQQLRIIRETLRQDFNLTAVASALYTSQPGVSKHIKDLEDELG
FT                   IEIFVRRGKRLLGLTEPGKELAEVVDRILLGTQNLRRIADQFASRETGHFVVATTHTQA
FT                   RYALPQIIKWFKTDYPRVHLALHQGSPVDIAEKLVSGEADVGIATERLDQVPELETFPF
FT                   YRWHHALIVPHGHPLLQVDKLTLEVIGEYPIITYHEGFTGRTHIDKAFADAGVVPDIVL
FT                   SAIDADVIKTYVELELGVGIVASMAYDACKDRNLTLIAVPHLFPESTTRLAVRRGTYLR
FT                   SYALAFIEKVCPDIGEENLKAAIQKQNGNE"
FT   gene            275159..275461
FT                   /locus_tag="CAP2UW1_0225"
FT   CDS_pept        275159..275461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_0602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33583"
FT                   /db_xref="GOA:C7RJL9"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJL9"
FT                   /protein_id="ACV33583.1"
FT                   /translation="MEKRRAHYDLGQVKAVVMYRGIDSFTSTALLGLFSMGLSEADGVS
FT                   IVLGLRRDMLFKSMTTHADSRVWQDVYHAPCPNGKTAYVKVTLQDGAVVIQFKEL"
FT   gene            275463..275873
FT                   /locus_tag="CAP2UW1_0226"
FT   CDS_pept        275463..275873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0226"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   ypi:YpsIP31758_0889 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33584"
FT                   /db_xref="GOA:C7RJM0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM0"
FT                   /protein_id="ACV33584.1"
FT                   /translation="MRNPAYCLQCDDGSVLQHGAQDMMITIDGMSQTVPAVVGWHCPTC
FT                   GTCEFDDGEGKRFSATLAALRQLANAQRAASLRAIRKKLGLRQADAGRLFGGGASAFSE
FT                   YERGKTQPHKSTVLLLKLLDRHPELLEELRGT"
FT   gene            complement(276025..276252)
FT                   /locus_tag="CAP2UW1_0227"
FT   CDS_pept        complement(276025..276252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33585"
FT                   /db_xref="GOA:C7RJM1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM1"
FT                   /protein_id="ACV33585.1"
FT                   /translation="MTTDRAVRIMAGSFILISLALGVPESPLFVSKYFLWFTAFVGANL
FT                   LQSGFTCFCPAESVMVKLGMKRGDEASCGR"
FT   gene            complement(276249..279455)
FT                   /locus_tag="CAP2UW1_0228"
FT   CDS_pept        complement(276249..279455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0228"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dar:Daro_3343 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33586"
FT                   /db_xref="GOA:C7RJM2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM2"
FT                   /protein_id="ACV33586.1"
FT                   /translation="MGVSGRIARLFASSQMTPLLALVALLMGVFATLVTPREEEPQIDV
FT                   TMADVLIPFTGASVRDVENLVATPAEQVLSRMSGIEHVYSVSRPGMAIVTVQFAVGVKY
FT                   NDAVVRLYDTVHSHRDWLAPNLGVLEPTIKPKGIDDVPIVSLTFWTSDPTRSAFDLQQV
FT                   ARAAEIDLKRVKGTRDVSTLGGPDHVLRVLMDSERMNAFAVTPQDLAAALRVGNALQSS
FT                   GSLVAGNHEVLVQTGTYLESAADVRQLVVAVRGSADERKPVFMSDVARVEDGPDQPRRY
FT                   VWLGNREGEFPAVTVQVSKKPGVNAADVADALIARVATLKGTLIPEGVEVTVTRNYGQT
FT                   ATDKAQKLIGKLVFATAFVVLLVFFALGRREALIVGVAVSLTLAATLFASWAWGFTLNR
FT                   VSLFALIFSIGILVDDAIVVVENIHRWQALQPGTPLIEIIPLAVDEVGGPTILATFTVI
FT                   AALLPMAFVTGLMGPYMSPIPINSSLGMFISLAVAFVVTPWLAARLLAAAPPHPGVADT
FT                   PVASRLERLFRRLLTPFLDAHTGRRARRWLLLVIGLLILSSLALAGLKLVVLKMLPFDN
FT                   KSEFQIVLDMPAGTPLEETARVLREIGAEVVRVPEVSDYQAYAGTASPINFNGLVRQYY
FT                   LRAAPELGDLQVNLVDHRQRSRQSHEIAASVRAAVEAIGQRAGGNAKIVEVPPGPPVLS
FT                   PIVAEVYGPDYRGQIAVAREVRKVLEGTPDLVGVDDSVTAAGSKTVLHVLQNKAALLDV
FT                   AQSDIVEVVRMGLAGEDVTPVHNSESKFEIPVRLTLPAEQQSSIEALLKLRVRSRAGRL
FT                   VPVSELVEVREQPRETVVYHKDLLPVVYVVADMGGKLDSPLYGMFAARSDLVGRSLDGL
FT                   DKGAGTLGEWFIRQPAAPDAAYSIKWDGEWQITYETFRDMGIAYGVGLILIYLLVVAHF
FT                   RSYLLPLIIMAPIPLTIIGVMPGHALLGSQYTATSMIGMIALAGIIVRNSILLVDFIRQ
FT                   QIGEGMPLREAIIQSAAVRAKPIALTGLAAMLGALFILDDPIFNGLAISLIFGIFVSTL
FT                   LTLVVIPVLYYAAFRKEPQT"
FT   sig_peptide     complement(279360..279455)
FT                   /locus_tag="CAP2UW1_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.532 at
FT                   residue 32"
FT   gene            complement(279460..280482)
FT                   /locus_tag="CAP2UW1_0229"
FT   CDS_pept        complement(279460..280482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0229"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dar:Daro_3344 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33587"
FT                   /db_xref="GOA:C7RJM3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM3"
FT                   /protein_id="ACV33587.1"
FT                   /translation="MPDHTHRRWSLWQPLLASLAAAVSLTVQAQALPVMIMQPHPVELT
FT                   LPADALVEAVNQATVAAQVAGRVVEVHVDAGQAVRKGDLLMKIDAREASEVAAGASAQY
FT                   VNARAHYQRTVSLRQQGFVSQAAVDKAKADLDAAQAAHGQAAVGVGHATVRAPLTGIVA
FT                   QRLTEMGEMATPGKPLLVIHDPQGLRVTASIPQYRVPQMHAVRQARIEFPELGKVVDAT
FT                   SVTLLPTADAATHVSPVRVGLPPGFADIVPGMHARVHFVVGRANKMTVPQTAIVRRGEV
FT                   AAVYVQNEQEALSLRQLRLGEPVGTGEVEVLAGLRAGERVVLDPVKAAVALKSASPPGK
FT                   "
FT   sig_peptide     complement(280393..280482)
FT                   /locus_tag="CAP2UW1_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 30"
FT   gene            280665..282461
FT                   /locus_tag="CAP2UW1_0230"
FT   CDS_pept        280665..282461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0230"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   pol:Bpro_3094 Gamma-glutamyltransferase 1. Threonine
FT                   peptidase. MEROPS family T03"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33588"
FT                   /db_xref="GOA:C7RJM4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM4"
FT                   /protein_id="ACV33588.1"
FT                   /translation="MKLVCLALTTALLAIGCSNLAPALAPAPAAGTALHQPEGPSGVST
FT                   QPGWHGRRFAVATAHPLASEAGQQVLVAGGSAIDAAIAAQMVLTIVEPQSSGIGGGAFL
FT                   LYHDGRETVAFDGRETAPAAAGETLLMRPDGKPMDFHDAVVGGRAVGVPGAVRMLEVAH
FT                   ARYGRLPWASLFEPAIRLADSGFPLGARLYALLESDPHLRKDPGAAAYFYDPDGRALAT
FT                   GTLLRNPALAAVLRLIAAEGSPALYQGEIAQAIVDKVAKHPYNPGTLSMADLTTYSPKE
FT                   RTPLCTRYASRTAEPARTYRICGFPPPSSGAVAIAQILGILNHTEAPFLPFEDPRWMHF
FT                   YSEASRLAFADRAQYVADPDFVSAPAGDWLSLVRPDYLAARARLIGPMSMQVARPGLPS
FT                   PERSSHAPMPEQAEYGTSHISIVDAYGNALAMTSTIEDAFGARQMVRGFLLNNELTDFS
FT                   FTPTDASGAPVANRVQPGKRPRSSMSPTLVFDDDTGELVMSGGSPGGALIIHYTAKLLY
FT                   ATLNWGFAPQQAIDLPNFGSLNGPTLLEEKRFPPAFVEALRAAGHEVKEVGMTSGVQAI
FT                   RKDHGSYVGGADPRREGRVMGE"
FT   sig_peptide     280665..280727
FT                   /locus_tag="CAP2UW1_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.409 at
FT                   residue 21"
FT   gene            282461..283831
FT                   /locus_tag="CAP2UW1_0231"
FT   CDS_pept        282461..283831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0231"
FT                   /product="protein of unknown function DUF1615"
FT                   /note="PFAM: protein of unknown function DUF1615; KEGG:
FT                   cvi:CV_1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33589"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM5"
FT                   /protein_id="ACV33589.1"
FT                   /translation="MPAIMNRTHRQRPSTAFAPLATDSSSSHAQTGWRPAPVSPAWRLS
FT                   VLLCVAAVAGCATDGSYESRASPRARAALPADSSASSPAPLREASPITPTPPTLGSPAP
FT                   LPQPAPVPYPSANEARLALDRLLPTGISERSAWAVDILTAFASLRIPALAENLCATIAI
FT                   IAQESSFQADPPVPGLAHIVWQEIERRRERYAIPKVVLDLALLKSSPDGRTYRARIDAL
FT                   RTEKQMNALYEEMISELPAGRMLLGGYNPVRTGGPMQVSVTFAEEQVRNRPYPYTRRDS
FT                   IRDQVFTRRGGVYFGVAMLLDYPAAYSQMLYRFADFNAGRYSSRNAAFQSSVARLSGSP
FT                   LALDGDLLRYSDGSPAAEASDTQRAIQSLRVRLNLSEAEILRDLKLEKSFAFEQTPLYQ
FT                   RLYALADAAGAGKRPRELLPRIDLKSPKISRRLTTEWFARRVDERYRNCLERNVPAT"
FT   sig_peptide     282461..282550
FT                   /locus_tag="CAP2UW1_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            283938..284013
FT                   /locus_tag="CAP2UW1_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            283938..284013
FT                   /locus_tag="CAP2UW1_R0005"
FT                   /product="tRNA-Phe"
FT   gene            284226..285326
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0232"
FT   gene            285369..286694
FT                   /locus_tag="CAP2UW1_0233"
FT   CDS_pept        285369..286694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0233"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33590"
FT                   /db_xref="GOA:C7RIX8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX8"
FT                   /protein_id="ACV33590.1"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARHGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDCVVGLQFMREAAPG"
FT   gene            286763..287350
FT                   /locus_tag="CAP2UW1_0234"
FT   CDS_pept        286763..287350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33591"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM7"
FT                   /protein_id="ACV33591.1"
FT                   /translation="MRRHRPPLPDSGFKSLEIWDVPLRWDGKPWQPQNTGDNPAAFQRF
FT                   GVGDTMGERLGGAGRSNLTQVLLRRAIGKCTGEGTGVRRMHLYWRDGDQQWFYVVEAGR
FT                   ELETSIEQQGIKPLSVEAKGFLFTFDEEAEIDEIRASTGAFLKRDRLRLASVYFTQQPS
FT                   ADNSRLDYHCQVGLIGDSSVRGGEGGVNYLVR"
FT   gene            287433..288041
FT                   /locus_tag="CAP2UW1_0235"
FT   CDS_pept        287433..288041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_2998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33592"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM8"
FT                   /protein_id="ACV33592.1"
FT                   /translation="MPDMDTTAERLIELARSRGLIRPCDLAPFGIPRVSLTRAVRSGLL
FT                   ERIGRGLYGLPGREVSAHGLLAEVARRVPKGVVCLLSALRFHGLTTQAPFEVWLAIENK
FT                   ALAPKLDYPPLRIVRFSGKAFTEGVEEHVVDSVTIRITGVAKTVADCFKYRNKIGLDVA
FT                   LEALREAWHERRMSSDDIWRYAKVCRVANVMRPYLDSLT"
FT   gene            288038..288961
FT                   /locus_tag="CAP2UW1_0236"
FT   CDS_pept        288038..288961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0236"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   xom:XOO_2997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33593"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJM9"
FT                   /protein_id="ACV33593.1"
FT                   /translation="MSVRNIGAAIRNRLLNKARAENLDYNLLLTRYALERMLYRLSISE
FT                   QRDQLVLKGALLFDLWFDVPHRPTHDADLLGFGPAEIPHIEQVFRSMCSIEVEDGIVFQ
FT                   PDSVKATEIRKEASYSGLRVTLVGMLDSARCPVQIDIGFGDAVVPGPDEVHYPVILSEM
FT                   AGPQLRAYPRYTVVAEKLEALTSLGMLNSRMKDFFDLWVLARHSDFDGPILSRAVAATF
FT                   ERRRTPIPHGAPIGLSDEFINDAQKNKQWQAFLRKNALDPMPLAKVIADLREFLLPVLA
FT                   SVEASGSHDMAWWCREGWRQLTEHGT"
FT   gene            complement(289225..291462)
FT                   /locus_tag="CAP2UW1_0237"
FT   CDS_pept        complement(289225..291462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0237"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: rca:Rcas_1875 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33594"
FT                   /db_xref="GOA:C7RJN0"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN0"
FT                   /protein_id="ACV33594.1"
FT                   /translation="MNMNNKSPPKSIGVLTSGGDAQGMNAAVRAVVRTALHQGAAVYAI
FT                   YEGYQGMVDGGERIRLQSWDDVGSILHRGGTIIGTARCAAFRERAGRLRAAHNLLRHGI
FT                   DRLVIIGGDGSLTGADTFRREWPGLLAELLESGQIDEQTARAHPALMIAGLVGSIDNDM
FT                   VGTDMTIGADSALHRIVEAIDAIASTAASHQRSFVVEVMGRHCGYLALMSAIAGGTDYV
FT                   LIPESPPPEGWEEQMCGLLRQGRIAGRRDSIVVVAEGAQDRAGNPISCDYVRQVLQERL
FT                   DEDTRVTILGHVQRGGTPSSFDRWMSTLLGFAAVQEVLSATPDSEPQLIGIRQNRIQRV
FT                   PLMQCVEQTRAVAQMIGEQNYARAMELRGGSFTEMFDVFKAIAEASPSVTATTRPRRLA
FT                   IIHAGGLAPGMNSAVRAAVRFGRDRGLTLLGVRGSFEGLLAGRIEELTWGDVEGWTGLG
FT                   GCELGTNRHIPSVEELYAVARAIETHQIEGLLVIGGWMAYKAAYQLHCERDRYPAFKIP
FT                   IICLPATIDNNLPGSELSVGADSALNAIVGALDRVKQSAMAAKRCFVVETMGRYCGYLA
FT                   LMSGLAGGAERVYLHEEGVTLKDLQAEVEHMVDAFHTGRRLYLTIRNERANAQYTTDFM
FT                   CALFEEEGRGLFDVRRSVLGHFQQGGNPSPYDRILATRLAAHCISFLSEQLASGSADGA
FT                   FIGLVEGKVTLVPLGRMSEMVDWTHFRPKEQWWLELRPVVQTMAQSIATEA"
FT   gene            complement(291643..293850)
FT                   /locus_tag="CAP2UW1_0238"
FT   CDS_pept        complement(291643..293850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0238"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dar:Daro_1633 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33595"
FT                   /db_xref="GOA:C7RJN1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN1"
FT                   /protein_id="ACV33595.1"
FT                   /translation="MNARNPSLVDQLSAMDARIRFIISVIVLGLLMTGPFVITAILIWA
FT                   SAQPAEQELLVQLIAPHLSLGALMTTFGFILGLLVIRYLFRQYVQGLLKMVENLRLMLS
FT                   ANRDFRVTPEGPPEVRLLAEATNDLAQQRDGLMDDVEAQIATAKASVEAEKNRLAALMS
FT                   ELAQAVVVCNLDGRILLYNSRARLQFKALAQGGTAIAGGALIGLGRSIFSILERNQIDH
FT                   ALEVVRQRLDKGAAAAIANFITTARGGQLLRVQLVPVLAAGEDLRQRDMTGYVLTVENI
FT                   TRSLEQESRRDQVLQSLTDGSRGCLANIRVAVGNLMDYPDMELEIRERFVGIISDEVVR
FT                   MSQRLDQTMSEFADSLKTRWPLEDVLGLDIVAAAQRRIEQQLGLPTKSEEIDEALWLRV
FT                   ESFSLVFSICFLASRLIDNYQIKELRFRLLPFGKLAYLDLIWAGHAMSTETSYTWETET
FT                   MQVGKEISPLSLRDVIDRHGGEIWYEREKAAQRAFFRFVLPVAAPDELGASEMIDDSGV
FT                   RPEYYDFDLFHFQDQSIDLDRPLSDLTYTVFDTETTGMEPAAGDEIIQIGAVRIVNGRL
FT                   LRNENFDQLVDPERFIRPEGIRIHGISDDMVRGQPNIEVVLPALHDFCNDTVLVAHNAA
FT                   FDMRFLQLKEERTGVAFSQPVLDTLLLSGVLHPNQESHQLDSIAERLGIGIEDRHNALG
FT                   DACATAEVFLKMLPLLAQMGITTLRQALEASEKTYFARVKY"
FT   gene            complement(294228..294374)
FT                   /locus_tag="CAP2UW1_0239"
FT   CDS_pept        complement(294228..294374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33596"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN2"
FT                   /protein_id="ACV33596.1"
FT                   /translation="MIKANWLAGLLALALFSHAQYQGWSLFDREAGAQTARVAGTAGRG
FT                   YHK"
FT   sig_peptide     complement(294315..294374)
FT                   /locus_tag="CAP2UW1_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.812 at
FT                   residue 20"
FT   gene            complement(294376..296277)
FT                   /locus_tag="CAP2UW1_0240"
FT   CDS_pept        complement(294376..296277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33597"
FT                   /db_xref="GOA:C7RJN3"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN3"
FT                   /protein_id="ACV33597.1"
FT                   /translation="MKRAICPSCGAPVLFHSAASIYAVCEFCRSTLLRTGEDLQNLGRM
FT                   ADLLDDTSRIQIGSEGTFRSRHFLVVGRIQLKYEAGLWNEWHILFDDGRSAWLAEAAGE
FT                   YIVSAQVSVREPIPAFTVLVPEMAVTLDGRQFTVTDLETARCISGQGELPFRVAAGYDV
FT                   NTADLRSNDRFLTIDYSETPPLVFVGQSTTFVDLKLVNLREASEPSAGGAPQVGARAFN
FT                   CPHCAAPLQIHSPAIESVACDACGSIIGIDNENVRLLARAAQALREVPWLPLGSRGSLH
FT                   GVDWEVIGFMRRSTTSEGTEYPWSEYLLFNATDGFAWLIEYQGHWNFARTLAKPPSVSR
FT                   KQPKFKLDGKEFKLFNRGKAQVTYVVGEFYWRVTVGETCAVDDYVCPPLMLSREVTAKE
FT                   ASWSQAEYLEAADLCAAFRMKTPLPRSGVYANQPNPLAETHRTTCSLFWKLALAATAVQ
FT                   LAFTFLFASQLVLKQQLVLSPQNEEATLTSQEFVLKSRARALLVRHATDVTNNWLSLST
FT                   TLVEKNTGESYQGEQEVSHYKGVDDGESWSEGSPSEEMVFKAVPAGTYYLVLEYELGTD
FT                   DAAAVVDTLEVVRNPTVWSNFVLLLIFLAIFPLISRWRRNAFEARRWSESDLGGKDD"
FT   gene            complement(296346..297389)
FT                   /locus_tag="CAP2UW1_0241"
FT   CDS_pept        complement(296346..297389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0241"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: dar:Daro_3752 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33598"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN4"
FT                   /protein_id="ACV33598.1"
FT                   /translation="MAFMDFIKKQFIDVIQWTEQGDGVLAMRYPMQDFEIQYGAQLTVR
FT                   ESQMAIFVNEGKIADVFGPGLYKLTTRTLPVLTYLKNWDKLFESPFKSDVYFFSTRLQL
FT                   DRKWGTPNPITIRDKDFGMVRMRAFGIYSYKLTDPRKLHTEVSGTREQYMVDDLDGQLR
FT                   NLVIGSMTDLFGESGVPFIDMAANQDELGRTLKGKLEPVFERYGLALDSFVVQNVSLPE
FT                   ELQKVLDSRIGMNMIGDLGRYTQYQVANSIPLAAQNEGGIAGIGAGLGAGLGIGQAMSA
FT                   AMGQAVQAGSAPQQPMSPATPTAAAAASSADEVVATLEKLHGLVAKGILSQAEFDVKKA
FT                   ELLGKLV"
FT   gene            complement(297460..297864)
FT                   /locus_tag="CAP2UW1_0242"
FT   CDS_pept        complement(297460..297864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0242"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   dar:Daro_3753 protein of unknown function DUF350"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33599"
FT                   /db_xref="GOA:C7RJN5"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN5"
FT                   /protein_id="ACV33599.1"
FT                   /translation="MPTHLLTMLPAFLAYFAVAIALLALFLLVYLNVTPYHEVALIRGG
FT                   NNAAAVSLSGALLGFAMPVANVIAHSDTLLDLASWGAIAGVIQILAYLVARLALPQLDQ
FT                   DIPAGKTAPAIFLAVLSLSVGLINAACMTY"
FT   sig_peptide     complement(297799..297864)
FT                   /locus_tag="CAP2UW1_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.387 at
FT                   residue 22"
FT   gene            complement(297899..298618)
FT                   /locus_tag="CAP2UW1_0243"
FT   CDS_pept        complement(297899..298618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0243"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: eba:ebA4111 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33600"
FT                   /db_xref="GOA:C7RJN6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN6"
FT                   /protein_id="ACV33600.1"
FT                   /translation="MIVAIDAGNSRIKWGVNDGNAWLDSGVLATADVAWLSEAADEWPA
FT                   NARVAICNVAGPEVAESISSLLAPRHATISFLRARVAACGVRNTYERPEQLGADRWAAL
FT                   IGARGMLAGACLVVCAGTATTIDLLDATGVFRGGLILPGFDLMRTALAHNTAQLPLAEG
FT                   VFRAEPRNTLDAIFSGCLQAQLGAVERMFAGIAAEPDARCLLTGGGAGSLAAHLKVPCQ
FT                   LVDNLILNGLARFAASP"
FT   gene            complement(298615..299421)
FT                   /locus_tag="CAP2UW1_0244"
FT   CDS_pept        complement(298615..299421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0244"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: dar:Daro_3757 biotin--acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33601"
FT                   /db_xref="GOA:C7RJN7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN7"
FT                   /protein_id="ACV33601.1"
FT                   /translation="MDDSSVTCRIDPARLKLRLAAASDRFAVEALPECVSTSTLLLERA
FT                   RQGAPSGALLVADRQTAGRGRRGRSWLSSPAGSLTFSLLWRFACPVARLAGLSLAVGVA
FT                   VARALEASGVAGIELKWPNDILLDGGKVGGILIELEAAPGSMLAVIGIGLNLQLPATGD
FT                   EEMLHPPAALAQALSPVPDRHQLLAQLLIDLATVLDGFAESGFAAVRDDWQARHAWQGR
FT                   YVRLLNGGLVDREGKCLGADTDGALLLKTAAGVERCLSGDLSLRAA"
FT   gene            complement(299460..300890)
FT                   /locus_tag="CAP2UW1_0245"
FT   CDS_pept        complement(299460..300890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0245"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: dar:Daro_3758 helix-turn-helix,
FT                   fis-type:nitrogen regulation protein NR(I); TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33602"
FT                   /db_xref="GOA:C7RJN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN8"
FT                   /protein_id="ACV33602.1"
FT                   /translation="MKPVWIVDDDKSIRWVLEKTLSREKIPFQSFASATEALARLDAGG
FT                   DPPQVLVSDIRMPGQSGLELLQLFKERFPAIPVIIMTAYSDLESAVSAFQGGAFEYLPK
FT                   PFDVDQALELIRRAIGESLHQSGAPNEVGLMPEILGQAPAMQEVFRAIGRLSQSSATVL
FT                   ITGESGSGKELVARAVHRHSPRADKPFIAINTAAIPRDLLESELFGHERGAFTGAAAQR
FT                   QGRFEQAEGGTLFLDEIGDMPAELQTRLLRVLSDGHYYRVGGHSPLKTKVRIIAATHQN
FT                   LEERVRQGLFREDLFHRLNVIRVRLPSLGERREDIPILARHFLQKSAHELGVEGKRFSD
FT                   AALKHLCSVDFPGNVRQLENLCHWLTVMAPGQLVELADLPPELRDAQVSAQSGDWEDAL
FT                   AQEVDRLLISEPGHVHETLTHAFERVLINRALSHTGGRRIEAAHSLGIGRNTITRKIQE
FT                   LGLDSAGASEDREASLQR"
FT   gene            complement(300951..302057)
FT                   /locus_tag="CAP2UW1_0246"
FT   CDS_pept        complement(300951..302057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0246"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: dar:Daro_3759
FT                   ATP-binding region, ATPase-like:histidine kinase A,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33603"
FT                   /db_xref="GOA:C7RJN9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJN9"
FT                   /protein_id="ACV33603.1"
FT                   /translation="MPGTRCDLDTPVTEPSANPFGGLDLLSSAVLLLDETLAIRYMNAA
FT                   AENLLEISGKVFAGCRLDSVAECPPKLLAALDSALHHGWAYTGQSIELRVAGGEILKLN
FT                   CTVNPAEAPQARLLVELWPIDQQLKATREERLVEQQHANRELIRNLVHEIKNPLGGIRG
FT                   AAQLLEHELNNPGLREYTQVIIKEADRLQDLMRRLLSPHRPMQPGPVNIHEILERVRSL
FT                   LTAEFPTILAVCRDYDTSLPELIGDREQLIQVFLNVARNAAQAIRWQPDGSVVGQGQIT
FT                   LRTRVARQMTLCKRRYPLALEVQVIDDGPGIPEDIRERMFYPLVSGREGGSGLGLTLAQ
FT                   SFVQQHQGTIDCESRPGHTCFTIRLPLA"
FT   gene            complement(302057..302548)
FT                   /locus_tag="CAP2UW1_0247"
FT   CDS_pept        complement(302057..302548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33604"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP0"
FT                   /protein_id="ACV33604.1"
FT                   /translation="MKRQDLCIAFALLSLLAVPAQAQDIYKCDLDGRITYSNVPSKNCR
FT                   KIMLDPVNLAPANKAAPKASTSTPTPGSFPKVDDQTQKSRDTDRRRILESELTAEQANA
FT                   DQAKKELAEQEATVLPNERMQGGAISGGKVQERLQPYKDKVALHQRNVEAIRKEISNLR
FT                   "
FT   sig_peptide     complement(302480..302548)
FT                   /locus_tag="CAP2UW1_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(302733..304148)
FT                   /locus_tag="CAP2UW1_0248"
FT   CDS_pept        complement(302733..304148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0248"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: dar:Daro_3763 L-glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33605"
FT                   /db_xref="GOA:C7RJP1"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP1"
FT                   /protein_id="ACV33605.1"
FT                   /translation="MASPQDVIKMVKENEAKFVDFRFTDTRGKEQHVTVPVSAFGEDKF
FT                   ENGHAFDGSSIAGWKGIQASDMQLMPDPSTAYVDPFFDETTVVITCDVVDPADGRGYDR
FT                   DPRSIANRAEAYLKSCGIGDTAYFGPEPEFFIFDSVAWSVDMSGCNLKIYSQEAAWTSG
FT                   EKSDSEGGTGHRPGVKGGYFPVPPVDSLHDIRSAMVLTLESVGVPVEVHHHEVATAGQC
FT                   EIGTVFSTLVKRADWTQILKYVVHNVAHQYGKTATFMPKPIVGDNGSGMHVHQSIWKDG
FT                   KNLFAGNGYAGLSELALFYIGGIIKHAKALNAITNPGTNSYKRLVPHYEAPVKLAYSAK
FT                   NRSASIRVPHVASDKARRIETRFPDPIANPYLCFSALLMAGLDGIQNKIHPGDPADKNL
FT                   YDLPPEEDAKIPTVCASLEEALAALDKDREFLTRGGVFSEDWIDAFIELKMEEVNKVRM
FT                   TTHPVEFDLYYSC"
FT   gene            304453..304902
FT                   /locus_tag="CAP2UW1_0249"
FT   CDS_pept        304453..304902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0249"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: eba:ebA4122
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33606"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP2"
FT                   /protein_id="ACV33606.1"
FT                   /translation="MGKLTDLLKLAQARASELALPYAGALTPQEAHEVWQLAPGAKLID
FT                   VRTRAEWDWVGRIPGAIEIEWLSYPDNRPNTHFLAQLKQQVDREALLMFICRSGMRSHN
FT                   AAALASEAAHLECYNVLEGFEGDKDANGQRGKVGGWRRAGLPWRS"
FT   gene            304957..306054
FT                   /locus_tag="CAP2UW1_0250"
FT   CDS_pept        304957..306054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0250"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: azo:azo0741 quinolinate synthetase; TIGRFAM:
FT                   quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33607"
FT                   /db_xref="GOA:C7RJP3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP3"
FT                   /protein_id="ACV33607.1"
FT                   /translation="MQTATISFDTFNQLRDEESHQRIRAARERLGDRAVLLCHHYQRAD
FT                   VYQYADLTGDSLKLSRLASQTESEFIVFCGVHFMAEVADIMSKPDQIAILPDLAAGCSM
FT                   ADMANLAKVERCWRELGEVLDVEQQVTPVTYINSAADLKAFCGARGGIVCTSSNAGTIA
FT                   AWAFERREKILFFPDQHLGRWTGYQMGIPLDEMMVWDPDLEMGGLTAEQIRRARLLLWK
FT                   GHCSVHQMFQPAHILRFRNQHPDGLVIAHPECSFEVCRQSDFVGSTEHIVRTIKEAPAN
FT                   TRWLVGTELNLVNRLAEEVKGEGKIVQFMAPTVCMCSTMQRIDPQHLAWTLENLAEGTV
FT                   VNQIQVPEHERELAKLALDRMLGVS"
FT   gene            306112..307050
FT                   /locus_tag="CAP2UW1_0251"
FT   CDS_pept        306112..307050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0251"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   nmu:Nmul_A0297 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33608"
FT                   /db_xref="GOA:C7RJP4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP4"
FT                   /protein_id="ACV33608.1"
FT                   /translation="MPVVSVVIPAYNCALYIGETLASILAQEAAELEIIVINDGSTDET
FT                   GAIARSFGEPVRVIDQPNSGVCAARNHGIREARGEFIALVDHDDYWLPNKLANQLAAFA
FT                   DNPQVDVVFTAFVWWRQESEGGRFPQPASFAAQAAPQGIDSDFSGWIYHQMLLDSWVLT
FT                   STALARSAVVRASGGFDETLPFSEDWDFWLRVARTSQFLKLREATTLYRQHPHQGSRVT
FT                   RALDYRTRLLEQASRQWGLSSQDGRCVAPGVFRRQLAQYSASFGLGHLQGGPGASRLIA
FT                   AKAFLKAWRIDPTYWKSLLYLAATPFYGKSR"
FT   gene            307067..307936
FT                   /locus_tag="CAP2UW1_0252"
FT   CDS_pept        307067..307936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0252"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: tbd:Tbd_0750 disulfide
FT                   bond chaperone, HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33609"
FT                   /db_xref="GOA:C7RJP5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP5"
FT                   /protein_id="ACV33609.1"
FT                   /translation="MVSDCLWRFLFDDLDISGAFVRLGPVWRNMLDGRGYPAPVARLLG
FT                   ELTATTLLLGGKLKQPGRLTVQLRGNGPISLLVIDCDEQLHIRGMARFSAPLAGESAPE
FT                   LLGDGQLLLSLDMPSMREPYQSIVPLAGTSVAEIFEHYLGQSDQLPSRFLLVTTPDAAA
FT                   GLLVQRMPGADACDADGWARIEALAATVRPAEILSLPADQLLLRLFPDEAVRLFPARTV
FT                   AYHCPEDWQKVRSMLRVLGPAEVYAALHEQGEVVIRDEICNREYRFDEAAVDELFGGSS
FT                   PGEPPTIH"
FT   gene            complement(308014..309423)
FT                   /locus_tag="CAP2UW1_0253"
FT   CDS_pept        complement(308014..309423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0253"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dar:Daro_2750 FAD linked oxidase, C-terminal:FAD linked
FT                   oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33610"
FT                   /db_xref="GOA:C7RJP6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP6"
FT                   /protein_id="ACV33610.1"
FT                   /translation="MKDAPLIRTLADLLGADQVLTSAADMSAYLADWRGRYRGAATCVV
FT                   RPASTAAVAAVVRACAEAAMPIVPQGGNTGLCGAATPAGDGHAVVVSLTRLNRVRQIDT
FT                   ANNTMTVEAGCVLATLQAAAAQAGRLFPLSLAAEGSCQIGGNLSTNAGGVQVLRYGNAR
FT                   DLTLGLEVVLASGEIWDGLRGLRKDNTGYDLKHLFIGAEGTLGIITAAVLKLFPLPRAN
FT                   ATAWLAIASPAAAVRLLADLQARFASTLTACELVSDVALGLVRQHIPGPHPALSASPWH
FT                   LLIELSAGGDEGELREALGALLAEALASGTISDAVLAQSGEQARRLWAMRENIGEAQRI
FT                   DGLSIKHDVSVPISRIPEFVERADQALTEAFPGLRIVAFGHIGDGNLHYNQSQAAAGLN
FT                   AAFLAAQPTVNRIVHDLVDELGGSISAEHGIGQLKRDELLRYKSPVEIEMMRAIKRVLD
FT                   PQGLMNPGKVL"
FT   gene            309927..310892
FT                   /locus_tag="CAP2UW1_0254"
FT   CDS_pept        309927..310892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0254"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: eba:ebA584 glucokinase; TIGRFAM: glucokinase;
FT                   PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33611"
FT                   /db_xref="GOA:C7RJP7"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP7"
FT                   /protein_id="ACV33611.1"
FT                   /translation="MIPGARLVADIGGTHARFALLDERGLPERVRVLAVADYAGPVEAV
FT                   QAYLHEFGSPPLRAAALALAAPVHADVIRMTNADWVFVRADIMARLGLAQLLLLNDFAA
FT                   LALSLPHLAAADLRQVGGGTAVALAPKAVLGPGTGLGVSGVFYARGRWLALTGEGGHCS
FT                   LAPGDRREAEILALAWREFAHVSAERLLSGSGLPLLYRLVGEVDGWSGEPLATPEIVAR
FT                   AVSGDDPRCRAVIDTLCAMLGAMAGNLALTLGAQGGVYVGGGIIPRLGDLFDRSAFRTR
FT                   FEAKGRFASYLVAIPTYVMLCPTPALLGSAHALADSEGCP"
FT   gene            310915..313368
FT                   /locus_tag="CAP2UW1_0255"
FT   CDS_pept        310915..313368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0255"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: pna:Pnap_1105 glycogen/starch/alpha-glucan
FT                   phosphorylases; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33612"
FT                   /db_xref="GOA:C7RJP8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP8"
FT                   /protein_id="ACV33612.1"
FT                   /translation="MSDSAQPQPESPTLRSQIDRKLLCAVAAEPTRASKADLYQALSFV
FT                   AREKLAQRWVDTQNSDRDDKARRVYYLSMEFLIGRAMNNALSALDLRDQAAAAFSGPGP
FT                   SLDEVMECEPDAALGNGGLGRLAACFLDSMATLGLPSWGYGVRYEYGMFAQSILNGQQV
FT                   EKPEAWLQDRSPWEFPRANKHYTVRFGGTAEHHEEWAEWHAADSVEAKAFDYVIPGHGT
FT                   DRVSTLRLWKAAAPSEIDLGAFNTGDYQRAAEFKNHFENISWVLYPNDSTPAGRELRLR
FT                   QEYFFVSASLQDILVRHLDENGSLANLADKVAIHLNDTHPAIGVAELMRLLIDDHGMSW
FT                   AAAWDQCRRIFSYTNHTLMPEALETWKVTLIQRVLPRHLLIIYRINQEFLDEVVRLYPG
FT                   DIDLMRRVSLIDDGGGHDRDKRVRMANLCIVGSHRVNGVSQLHSDLMVQTIFADFARLY
FT                   PERFHNKTNGVTPRRWLAQANPGLSALLDQRLAGQGWRLDLDRLQDLRATADDAAFRSA
FT                   FAAAKRHNKVRLANYVAREVGISLNPDSLFDVQVKRIHEYKRQLLNVLHVITRYNALLD
FT                   GSASDLAPRSVIFAGKAASSYHMAKQVIRLIHDVAAVVNNDPRTRDLLQVVFIPNYGVS
FT                   VAELIMPAANLSEQISTAGTEASGTGNMKLSLNGALTIGTEDGANIEIRDNVGADNIFI
FT                   FGNNTAQVTAIRQAGHRPMDIYRDDPALKEALDRIDSGFFSPGERPRYHDIFNSLLHYG
FT                   DHYLLLADYADYVATQKRVDALYLNSDEWQRKAILNVAGMGPFSADRTISDYANDTWNI
FT                   RTHTT"
FT   gene            313380..315563
FT                   /locus_tag="CAP2UW1_0256"
FT   CDS_pept        313380..315563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0256"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: pna:Pnap_1104 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33613"
FT                   /db_xref="GOA:C7RJP9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJP9"
FT                   /protein_id="ACV33613.1"
FT                   /translation="MLDTAEIVALCRAEHGDPYAVLGMHVDADGFLWVRSLQPGARSVA
FT                   VLDAKTGRQLAELEHREVEGVEGYFEGLIPRRRISFPYRLRIEWENGVQETDDPYRFAT
FT                   VLGEMDVWLLAEGSHLRPFERLGAHLCEIDGVPGTAFAVWAPDAQRVSVVGDFNTWDGR
FT                   RHPMRLRRECGVWEIFLPGVSAGAHYKYEIRSHGGFLLPLKSDPYGFQAEMRPSTASIV
FT                   CELPPPVDPTSIPAGDLLGAPMSIYEVHLASWRRADDGGFPDWQRISETLIPYVVGLGF
FT                   THIELLPISEHPFDGSWGYQPLGLYSPTARHGSPTGFRNFVGACHAAGLRVMVDWVPAH
FT                   FPTDEHGLGRFDGTALYEHADPREGMHQDWGTLIYNFGRREVSNYLIGNALFWIERYGI
FT                   DGLRVDAVASMLYRDYSREEGQWLPNQYGGRENLEAVAFLRRMNEVLGQEHPAADTHAE
FT                   ESTAWPMVSRPPSMGGLGFHYKWNMGWMHDVLDYMTKDPVHRRYHHNQLSFGMMYAFTE
FT                   NFVLPLSHDEVVHGKGSLLSKMAGDYWQKFANLRSLYAFMWAHPGKKLLFMGGEIGQWN
FT                   EWNHDTSLDWGLLDFPLHAGMHDLIRDLNGIYRSNPALHEVDFEPAGFEWMAPDDADCS
FT                   VVAFVRWSRDHSRAVLYVGNFTPVVRQGYRIGVPVPGGYCERLNTDSQYYGGSNVGNGY
FT                   EPVYAEYVPAHGREWSVSLTLPPLAGLYLEWVP"
FT   gene            315551..317566
FT                   /locus_tag="CAP2UW1_0257"
FT   CDS_pept        315551..317566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0257"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: pna:Pnap_1103 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33614"
FT                   /db_xref="GOA:C7RJQ0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ0"
FT                   /protein_id="ACV33614.1"
FT                   /translation="MGPVIDGMRLQAGRPWPLGAHWDGRGVNFALFSAHAEAVELCLFE
FT                   GGQMRALHLEQCTDQVWHGYLAGAAPGLCYAYRVHGPSAPDRGHRFDARHLLLDPYARE
FT                   VVGRFSWPAQDDPAHRLKACVVDEHFDWGGDAPLAVPWADTVLYEVHVKGISCQHPGVP
FT                   EALRGTYAGLAAPAMIEHYRRLGVTALSLLPVHHFLDEQRLVNEGRVNYWGYNSLAFFA
FT                   PEPRYAARIGGQSVIAEFKTMVCALHAAGIEVILDVVFNHTAETDEAGPTLSFRGIDNL
FT                   SYYRLPAGNLASYENFTGCGNTLNLANARVLQMVMDSLRYWVEVMHVDGFRFDLAATLT
FT                   RDSAFLAAKRQDPVLQRVKLIAEPWDVGPDGYHLGRFLPGWSEWNDRFRDDVRAFWLTG
FT                   GVGVAALAQRLAGSSEVFRFAGRAPQAGVNFITAHDGFTLRDLVSYQEKHNELNGEGNR
FT                   DGHSHNLSWNCGEEGESRDPAVLERRRRLQRALLTTLLISQGVPMLQSGDEIGRTQAGN
FT                   NNAYCQDNAMTWLDWRSADADLVAFVAGLIGLRQRFRQLRRRRWLTGEGNAEGQPDVVW
FT                   WHPAGRPMRVADWQSGKLGALGLQLAPETSTDGQADDHRILLCLINRDEIPVSFLLPAG
FT                   VWWQVCDSSAQSPFAACQRERTSTLPARSVQILCLG"
FT   gene            complement(317608..318576)
FT                   /locus_tag="CAP2UW1_0258"
FT   CDS_pept        complement(317608..318576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0258"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="PFAM: NUDIX hydrolase; thiamine monophosphate
FT                   synthase; KEGG: dar:Daro_3706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33615"
FT                   /db_xref="GOA:C7RJQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ1"
FT                   /protein_id="ACV33615.1"
FT                   /translation="MNVVGEGATPITEVAAAVLLRGDPATPEFLLAQRPVGKVYAGYWE
FT                   FPGGKVEAGETTRAALVRELQEELGVTVDQAWPWVCCEFTYPHARVRLRFFRVTSWHGE
FT                   IAPIEHSGFVWSKVGAAASVAPILPANGPILRALALPPVYALSHAEERGVEAELTRLAH
FT                   ALSSGLRLIQVRDKTLPRAQRRHFAHMVVTLARGFAGACVLVNDDPELARTVSADGLHL
FT                   SSRRLWEIDRRPDFDRVAASCHTPADLARAVELGLDFVVLGPVLPTASHPEARAMGWEQ
FT                   FSRLLEHSPLPVYALGGLQPNMLDTARRHGGHGIALMRGWR"
FT   gene            complement(318614..319579)
FT                   /locus_tag="CAP2UW1_0259"
FT   CDS_pept        complement(318614..319579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0259"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; SMART: AAA
FT                   ATPase; KEGG: eba:ebA4101 predicted AAA ATPase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33616"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ2"
FT                   /protein_id="ACV33616.1"
FT                   /translation="MSDPFRQLASFLARAEQLLERIEPLLPPASPLPEWHLASAFRWRT
FT                   RRGVGYLQPIARLPAIRLADLQDIDEQKARIDTNTRHFVAGQPANNVLLTGARGSGKSS
FT                   LIKALLNEYAANGLRVIEVEKGDLTDLPDIVELTEGRPERFIIFCDDLSFDAGDARYKA
FT                   LKVVLDGSLAAPPENVLIYATSNRRHLMPEYFAENLESRRVGEEIHPGEAIEEKISLSE
FT                   RFGLWISFYPFDQDAYLNIVAHWLKAFGCRHDDIAAAERDALNWALERGSRSGRVAWQF
FT                   ARDWAGRHSGVLPVRPRRQRTKAAPTDAASATRKRPGNAP"
FT   gene            319629..320879
FT                   /locus_tag="CAP2UW1_0260"
FT   CDS_pept        319629..320879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0260"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   eba:ebA4100 membrane-bound lytic murein transglycosylase A"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33617"
FT                   /db_xref="GOA:C7RJQ3"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ3"
FT                   /protein_id="ACV33617.1"
FT                   /translation="MPKSQSRRLLATALLTALLTACGGTNGTREVPAACPACPACPPCG
FT                   TQAQPAATTTSPPSARLLQAARWSELPGWGDDDLAAAWPAFLLSCRALASRPQWPQWKT
FT                   ACDEAKGLTSPSTTTIRRFLEARLQPWLLTNSDGSTGGLVTGYYEPLLRGARTRGKPYL
FT                   QPVLGVPTDLLTIDLGAVLPELKNMRLRGRLDGNKVVPYYSRAEITSREKDSPDRALLW
FT                   VDDPVELFFLQVQGSGRVKLPDGSMTRLAYADQNGHPYQSIGRVLVDRGELTLDQVSMQ
FT                   GIKQWARANPARVGELLNANPSYVFFREQAIKSGQNGAAEGPSGALGVPLTPERSIAVD
FT                   PRHVPLGAPVFLSTSLPASTTPLRRLVLAQDTGGAIRGVVRADLFWGFGAQAGMQAGRM
FT                   KQQGQMWVLLPPGAAPE"
FT   sig_peptide     319629..319700
FT                   /locus_tag="CAP2UW1_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.588 at
FT                   residue 24"
FT   gene            321055..322257
FT                   /locus_tag="CAP2UW1_0261"
FT   CDS_pept        321055..322257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0261"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   dar:Daro_3703 Rh-like protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33618"
FT                   /db_xref="GOA:C7RJQ4"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ4"
FT                   /protein_id="ACV33618.1"
FT                   /translation="MEALKSGSDVLFILLGGIMVLAMHSGFAFLELGTVRKKSQVNALV
FT                   KILTDFSVSTIAYFFVGYSIAYGVNFFAGAETLVQKNGFELTKFFFLLTFAAAIPAIVS
FT                   GGIAERARFYPQLAATFLIVGFIYPLFEGIAWNQAFGVQAWLKANYGEEFHDFAGSVVV
FT                   HAMGGWIALPAVVLLGARYGRYTKEGRVSAHPPSSIPFLALGAWILTVGWFGFNVMSAQ
FT                   TIDKISGLVAMNSLMAMVGGTLVAMVAGRNDPGFVHNGPLAGLVAVCAGSDVMHPIGAL
FT                   IVGGVAGGMFVMMFTLTQNRWKIDDVLGVWPLHGLCGAWGGIAAGIFGSKALGGIGGVA
FT                   LMPQLLMTGMAIAIALIGSCLVYGLLKGAVGLRLDQEQEYNGADLSIHKITATPERETN
FT                   W"
FT   sig_peptide     321055..321141
FT                   /locus_tag="CAP2UW1_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.329 at
FT                   residue 29"
FT   gene            322363..323874
FT                   /locus_tag="CAP2UW1_0262"
FT   CDS_pept        322363..323874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0262"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dar:Daro_4123 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33619"
FT                   /db_xref="GOA:C7RJQ5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ5"
FT                   /protein_id="ACV33619.1"
FT                   /translation="MHTDYLERILNARVYDVAIETPLDFAPGLSARIGNRVLLKREDLQ
FT                   PVFSFKLRGAYNKIVHLSKEKLKRGVICASAGNHAQGVALAANKVGCRAVIVMPTTTPQ
FT                   IKVQAVQARGAEVILAGESYDDAYTHALELEKTEKLTFVHPFDDPEVIAGQGTIGMEIL
FT                   RQHAQPIHAVFCCVGGGGLISGVAAYIKRLRPETRIIGVEAADADAMARSLNAGKRVRL
FT                   EHVGLFADGAAVKYVGEETFRLCQMYVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGAL
FT                   AVAGAKAYAASHRLKDRTLVATASGANLNFDRLRFVAERAEIGEQREAVFAVTLPEKPG
FT                   AYRQFLSLIGARNVTEFNYRYNDQRAAHIFVGVQVASRAESVRLLDHLRRHDYPTLDLT
FT                   DDEMAKGHVRHLVGGRSPQITNEIVYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHG
FT                   ADYGRVLVGMQVPPDELDDFEVFLKTLGYAHWNETDNPAYRLFLA"
FT   gene            complement(323963..324595)
FT                   /locus_tag="CAP2UW1_0263"
FT   CDS_pept        complement(323963..324595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0263"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   dar:Daro_4131 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33620"
FT                   /db_xref="GOA:C7RJQ6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ6"
FT                   /protein_id="ACV33620.1"
FT                   /translation="MAPDLAPGIRPGSSSGSDPGERRALRRALLERRLALPTADWASYS
FT                   SRVCAHLEAGFPQLATMAVGFCWPQKQEPDLRPLIERWAVAARKGFRALLPVVLAENRP
FT                   LAFRAWSPDTVMLADRYGIPTPATGEFLIPEALLLPVNGFDAAGYRIGYGGGYFDRTLA
FT                   ALHPRPLAIGVGFELARLDSIGPEPHDQVLDAMVTEAGLFRPARPTT"
FT   gene            324639..326582
FT                   /locus_tag="CAP2UW1_0264"
FT   CDS_pept        324639..326582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0264"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   dar:Daro_4132 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33621"
FT                   /db_xref="GOA:C7RJQ7"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ7"
FT                   /protein_id="ACV33621.1"
FT                   /translation="MKHRYTVFGLFISLLGVHLAALALTADEQFLAARDAFRAGDKARL
FT                   ERLASTPPGYELEAYVDYWRLLLDLKDTDATSVAAFLARHENTYVGERLRVDWLRLQGK
FT                   RQQWAAFDVEYPRLAQPDQDLACYALQSRRAQGDASALDDALPLWLTLIEPPEPCYPLL
FT                   EALIVEKRVLADAVWARIRRQFEANKIAAAIYSMNYLPPSQTPDKKVAQMVADAPLPWL
FT                   TRLPSDLAGSRMQRELAVLAIQRVARNDPRMAADQLSRISASLNAGEKAWAWGQIGWQA
FT                   AQRHLPEAMEWYRQAGEAPLSDEVAQWKVRAALRVHDWGSVRATIEKMPPALAAQPAWV
FT                   YWLGRAYRAGGRLDEANALFAKIAGQPDFYGNLANDELGRTTTTPPKASPPSREELLQV
FT                   TANPGVQRALAFFRLNLRTEGVKEWNWSLRGMSDRELLAASDIAQRAGMYDRAIAAADR
FT                   TRTEHDYSLRYLAPYADQVRPAARNQVLDDAWVYGLMRQESRFVTSARSSVGASGLMQL
FT                   MPATAKWVANKIGLKDFQQSRVNDTETNVLLGTTYMRLVLESLDNHPVLASAAYNAGPG
FT                   RARRWRADRPMEGAIYAETIPFNETRDYVKKVMSNSVYYAALFDGKPQTIKSRLGVIAP
FT                   RTGGEAKGEDLP"
FT   sig_peptide     324639..324710
FT                   /locus_tag="CAP2UW1_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.699 at
FT                   residue 24"
FT   gene            326623..327588
FT                   /locus_tag="CAP2UW1_0265"
FT   CDS_pept        326623..327588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0265"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="7.1.1.2"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: dar:Daro_4134 NAD-dependent
FT                   epimerase/dehydratase:3-beta hydroxysteroid
FT                   dehydrogenase/isomerase:dTDP-4-dehydrorhamnose
FT                   reductase:NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33622"
FT                   /db_xref="GOA:C7RJQ8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ8"
FT                   /protein_id="ACV33622.1"
FT                   /translation="MELENVLLIGGSGFVGGWIASCLSERGVRVTIPTRRRENTKKLIM
FT                   LPTVSMVEANIHDPQVLAQLVQGHDAVINLVGVLHDTDSRLPYGRGFQAAHVDLPKKII
FT                   AAMRENGVRRLVHMSALRAGINAPSEYLRSKGDGEAAVRSAMNELDVTMFRPSVIFGPD
FT                   DAFLNMFAKLLRLFPVLPLGGGSARFQPVYVGDVARAFADSLTNGATFGQTYELCGPKV
FT                   YTLREMVDYTAHLVGKQRRVIDLGTGGWAYLQAGLMWLLPNPPLSPDNLRSMELDSVTD
FT                   GSHDYPGWQPTPLEAVAPGYLSPDEMIQLRLDRYRYRAGR"
FT   gene            327627..328874
FT                   /locus_tag="CAP2UW1_0266"
FT   CDS_pept        327627..328874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0266"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   dar:Daro_4135 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33623"
FT                   /db_xref="GOA:C7RJQ9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJQ9"
FT                   /protein_id="ACV33623.1"
FT                   /translation="MQIFTVGGAVRDELLGLPVKDRDYVVVGASPEEMLARGFRPVGKD
FT                   FPVFLHPSTHEEYALARTERKTGPGYRGFAFRAAPEVSLAEDLARRDLTINAIARAADG
FT                   SLLDPYHGIDDLSRRVLRHVGPAFVEDPVRVLRIARFAARFSDFVVAPETVALMRLMVA
FT                   GGELDHLVAERVWQEVARGLMETRPSRMFEILRECGALARLLPELDRLWGVPQRADYHP
FT                   EVDTGIHVMMVIDQSAQRSCALPVRFAVLVHDLGKGTTPDGDLPRHPGHEERSVELVGQ
FT                   VCVRLKVPVECRDLAVLVARHHGKVHRAAELGAAAIVRLLEATDAVRRPGRFEQLLEAC
FT                   ACDYHGRLGWQEIAYTAPALLRQALAQAGAVDAAAIVRGCTDPASIPARLHEARVAAVR
FT                   QGLSAGLATAGALGLR"
FT   gene            complement(328871..330055)
FT                   /locus_tag="CAP2UW1_0267"
FT   CDS_pept        complement(328871..330055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0267"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   dar:Daro_4140 protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33624"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR0"
FT                   /protein_id="ACV33624.1"
FT                   /translation="MLSHASQAALSLPLPTADGLAFSRALSQHISTEIAAGDGWIGFDR
FT                   FMSLALYAPGMGYYSGGAHKFGPAGDFVTAPEICPAFAQTLGAQAAQILVLSAPRIIEV
FT                   GAGTGEFAADLLLELERRGALPDSYAILDLSGELRARQQATLARRTPHLLPRVRWLERL
FT                   PERFDGLVLANEVLDAMPAHLVLWGPTHIAERGVGVDEGRFVWRDRPASGPLLGRAKVL
FT                   AGECEIAPGYLSEISLTAPAWITEWAGILGQGALLLIDYGFPRHEYYHPQRSAGTLMCH
FT                   YRHRSHTDPFYLPGLQDITTHVDFTGIVEAGCQAGLELLGYTTQSSFLFNCGLTEILSR
FT                   TPVGDALRYLPLANAVQKLVSPAEMGEIFKVIALGKGISQPLLGFATGDRSATL"
FT   gene            complement(330116..330964)
FT                   /locus_tag="CAP2UW1_0268"
FT   CDS_pept        complement(330116..330964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33625"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR1"
FT                   /protein_id="ACV33625.1"
FT                   /translation="MSKPDQPLDADELMDLAERAAQLPATEAEWVGRLFQEVLRARTHE
FT                   TELQAQQVSAPREAQPSGDELDDRLVQVAIDTAEWLRTLWDVGYMGAGSFRSQPRSAFP
FT                   SIDLEDIRKSSLFARIRQGKHALPFPPPTRQGLPWHALLDDNGQTHAVTAEVIRDGVGP
FT                   PLGAIIEGCAEWDVIEEVVDGQEYVVQHQGKGPTYRLCVSGAATAELCREPPTSTRTIH
FT                   LEGRSGFHSYTLEWPEADGSQIFVTLRAATWERAESEAERWLANTHPELYGQIRFERCE
FT                   D"
FT   gene            331099..331836
FT                   /locus_tag="CAP2UW1_0269"
FT   CDS_pept        331099..331836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0269"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   azo:azo0486 pteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33626"
FT                   /db_xref="GOA:C7RJR2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR2"
FT                   /protein_id="ACV33626.1"
FT                   /translation="MEGKTILVTGAARRLGSAVAREMHTAGARVMLHYRKASGEAEALV
FT                   AELNALRPDSAACVQADLLAIDTLPQLVADTVARFGSLDALVNNASSFFSTRFGSIDPA
FT                   AWDDLVGTNFKAPLFLTQAAAPHLLAAHGAVVNITDIHAERPLAGYSLYCAAKAALLGL
FT                   TRALAIELAPRVRVNAVAPGPILWPETGAFDSAARAEIVAHTLLQRPGSPQDIARAVRY
FT                   LLVDAVYVTGQVINVDGGRTAHL"
FT   gene            331863..332747
FT                   /locus_tag="CAP2UW1_0270"
FT   CDS_pept        331863..332747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0270"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: dar:Daro_4143
FT                   PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33627"
FT                   /db_xref="GOA:C7RJR3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR3"
FT                   /protein_id="ACV33627.1"
FT                   /translation="MQLSNTLLRLKKRLESNVGKAIADYGMIEDGDTVLVCVSGGKDSH
FT                   TLLSLLIALRERAPVNFRVIAMNLDQKQPGFPAEVLPDYLAKIGVDYRIVEQDTYAVVK
FT                   DKIPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVHTLFLNLFFGGQLKAM
FT                   PPKLRTDDGCHVVIRPLAYCRESDIARFARGMEYPIIPCNLCGSQDNLQRQKIREMMAD
FT                   WDQRYPGRTDVVFSALQKVVPSHLADQTLFDFKGLRVGGETVPAAADALFDAPWFGTPP
FT                   HTSHVFPLQVAKA"
FT   gene            332818..333708
FT                   /locus_tag="CAP2UW1_0271"
FT   CDS_pept        332818..333708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0271"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   dar:Daro_4144 forkhead-associated"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33628"
FT                   /db_xref="GOA:C7RJR4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR4"
FT                   /protein_id="ACV33628.1"
FT                   /translation="MSSEEGMLSALFVSVSGSARLFDKLGGAEALHAVDRCMKRVLRGV
FT                   DGFRGRIVRTTRDDITALFEHADDACQAAIAMQRRIADLPPVSGVKLAIRAGFHHGEVI
FT                   GEGVGGCVNTAECLAGLAKPGQVLATAETQALLSVPLQSSTRCLDSLSVKGQFTDQRVF
FT                   EVLWLEPRNPGYRAIVESAAEAPSERDPRLCLRYAGQVKLLDRIRPKLLMGRDSGCDVT
FT                   VRDRRASRHHARIERRGDFFVLSDLSTNGTFVTISGGPELLVRREEFVLRGSGIISFAA
FT                   SASSPGADIAEFEYL"
FT   gene            complement(333806..334513)
FT                   /locus_tag="CAP2UW1_0272"
FT   CDS_pept        complement(333806..334513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0272"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: dar:Daro_0617 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33629"
FT                   /db_xref="GOA:C7RJR5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR5"
FT                   /protein_id="ACV33629.1"
FT                   /translation="MTILTQSAELVRRSCKRLLPQDCLLCGAASGTTLLCPACATDLPR
FT                   LPATRCPLCALPTPGGSVCGRCLTAPPHYDATLAVYRYAFPIDKLVQAFKYGHRLALGA
FT                   WFGSRLAELAKDFHADLIVPMPLHRLRLRERGFNQALELARAVSRCSRIPIDARTCTRI
FT                   RQTATQADLPWRERAGNVRGAFHCATDLTGKRLVLVDDVMTTGASLNELARTVKLHGAV
FT                   EVTLLTLARALPS"
FT   sig_peptide     complement(334391..334513)
FT                   /locus_tag="CAP2UW1_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.752 at
FT                   residue 41"
FT   gene            334580..335569
FT                   /locus_tag="CAP2UW1_0273"
FT   CDS_pept        334580..335569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0273"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: dar:Daro_0618 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33630"
FT                   /db_xref="GOA:C7RJR6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR6"
FT                   /protein_id="ACV33630.1"
FT                   /translation="MNAIPQAATLAQDCSPTTHSARWTVAEVEALYQLPLMDLIYRAQQ
FT                   VHRENFDANAIQRSTLLSVKTGGCSEDCGYCSQAARYTTGTEREALLPLDEVIAAAQAA
FT                   KDKGASRFCMGAAWRGPKDKDLAKVTEMIRAVKGLGLQTCVTLGMLKEGQADELKEAGL
FT                   DYYNHNLDTDASFYGQVITTHKHADRIDTLGQVREAGLKVCSGGIIGMGESRRNRAALI
FT                   VQLANLNPPPESVPINNLVPIPGTPMAALAPIDNFEFVRTIAAARITMPASFVRLSAGR
FT                   QAMAEELQALCFLAGANSIFYGDKLLTTGNPEADRDEALFEKLGLRPI"
FT   gene            335576..336463
FT                   /locus_tag="CAP2UW1_0274"
FT   CDS_pept        335576..336463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0274"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   dar:Daro_0619 biotin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33631"
FT                   /db_xref="GOA:C7RJR7"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR7"
FT                   /protein_id="ACV33631.1"
FT                   /translation="MNAPAQFVDRRQVRRNFARAAASYDEAAVLQREIGKRMLERLDYV
FT                   RIEPQRVLDLGCGTGASLTALHERYPGALVIGADPCLPMLRVGQRQHSRLRWLLPFLRS
FT                   HRSPLLAAEASALPLPAQSIGLLWSNLMLHWLDDPLPAFREANRLLEVGGLLMFSTFGP
FT                   DTLKELRASFGDGYVHTQRFTDMHDYGDMLVECGFTDPVMDAEVLTMTYARLDDLLADL
FT                   RRSGSACAMQARRRGLTGRSTWAATRAAYAQCAREGRLPATYEVIYGHAWKSQPRKMAD
FT                   GRTIVRFDPHQRLR"
FT   gene            complement(336483..336791)
FT                   /locus_tag="CAP2UW1_0275"
FT   CDS_pept        complement(336483..336791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0275"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   dar:Daro_1619 acetolactate synthase 1 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33632"
FT                   /db_xref="GOA:C7RJR8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR8"
FT                   /protein_id="ACV33632.1"
FT                   /translation="MNSLTRTENQALARTVLELDVNNHAGVMSHVVGLFSRRAYNVEGI
FT                   LVMPVGSGATSRIWLLVNEDERLDQMVKQVEKLEDVLAVRRHGAEHEVFVRLEEFFV"
FT   gene            complement(336795..338474)
FT                   /locus_tag="CAP2UW1_0276"
FT   CDS_pept        complement(336795..338474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0276"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: dar:Daro_1620 acetolactate synthase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33633"
FT                   /db_xref="GOA:C7RJR9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C7RJR9"
FT                   /protein_id="ACV33633.1"
FT                   /translation="MPKQTPETLTGAQIVVRLLERQGVRTVAGIPGGAILPIYDALSKS
FT                   EIHHVLARHEQGGGFMAQGMARATGVPAVCMASSGPGATNLLTAIADAKLDSIPLVAIT
FT                   GQVPKPMIGTDAFQEVDTYGLSIPITKHNFLVGSADDLLTVIPRAFRIAASGRPGPVLV
FT                   DIPKDVQNQLVDVDEWPAPGCADVVPPPDGELIERAAAMINAAAKPVLYLGGGVVHSGA
FT                   AEAAVALAQKARLPTVMTLMALGAMPVDHVLSLGMLGMHGARCTNLALDECDLLIAVGA
FT                   RFDDRATGKVAGFCPQAKIIHIDIDPSELDKIKTAHVGIAGDVRTVLELLQPVIESPQR
FT                   HAWLARVASLKADHPLRMPGIDDPRTPYGLIRAVANCLDDEATITTDVGQHQMWVAQAY
FT                   PLRRPRQWLTSGGLGTMGFGMPAAIGASLAEPERTVVCFTGDGSILMNIQELVTAAEED
FT                   VNVKIVLMNNSSLGLVFQQQTMFYGERIYASKFKGMPDFIRVAEGFGVPAVDLDKASDP
FT                   LAALAAALATRGPMLIHASIAMHEQVLPMVPPGAANKEMIGG"
FT   gene            complement(338889..339608)
FT                   /locus_tag="CAP2UW1_0277"
FT   CDS_pept        complement(338889..339608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0277"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   dar:Daro_1460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33634"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK43"
FT                   /protein_id="ACV33634.1"
FT                   /translation="MKALRGVLAGMLLAIGGAAHAVPYHFVDWTAANPGAGTASGTITL
FT                   PDLSTVTVSFSVTQVTGAAGSFKFAQTFGGTNYWSPSAPYISSQVDNAPPDSDIISLIG
FT                   GSSTTTYKLTLSEAIKDPIMDIVSLGQPGFNVTYDFDRPFDIVSQGVGFWGGGPTALQE
FT                   LPGDVLQGAEGHGTIQFIGTFDSFSWTAPTSEDWHGFQFGIRTTEKLDPSVPEPASLAL
FT                   LAIGFAGLAAARRRRTR"
FT   sig_peptide     complement(339543..339608)
FT                   /locus_tag="CAP2UW1_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            340095..340598
FT                   /locus_tag="CAP2UW1_0278"
FT   CDS_pept        340095..340598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0278"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   dar:Daro_0532 thiol peroxidase (atypical 2-Cys
FT                   peroxiredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33635"
FT                   /db_xref="GOA:C7RK44"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK44"
FT                   /protein_id="ACV33635.1"
FT                   /translation="MASTVTLGGKPFQVGGILPEKGQTAPAFTLVGKDLANVSLSSFAG
FT                   QRKVLNIFPSIDTPTCATSVRKFNEKASGLSNTVVLCVSADLPFAQARFCGAEGLERVV
FT                   TLSTMRGREFLEAYGVALSDGPLAGLAARAVVVLDGDDKVLHSELVAEIKNEPDYDAAL
FT                   KSLA"
FT   gene            340651..341529
FT                   /locus_tag="CAP2UW1_0279"
FT   CDS_pept        340651..341529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0279"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: dar:Daro_0804 regulatory proteins,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33636"
FT                   /db_xref="GOA:C7RK45"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK45"
FT                   /protein_id="ACV33636.1"
FT                   /translation="MSDTSSTPPVKQRQGIQSIEVGTRLLRALAAHGRAMMLRDVARHA
FT                   GMPPAKAHRYLVSFMRMGLVEQDANTGRYDLGEFALELGLASLARLDPVRLAGPVLDDL
FT                   CEHIGETVALAMWGNHGATCVRWVEAGGPVTVTLRTGVVMPLTSSATGLAFAAFYRSPY
FT                   LRKMLDAEVQATAELRHAAPAAVLSALTVQLDEIRRHGIARASGSVTPGINGFSAPVFG
FT                   HGGRMVAAITCLGIIGNFDLDWDSPMAQATRDAAATLSRRLGYGTVDDGVADRRSAEQA
FT                   GRPGTADGACA"
FT   gene            341522..341779
FT                   /locus_tag="CAP2UW1_0280"
FT   CDS_pept        341522..341779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0280"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   bpt:Bpet3113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33637"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK46"
FT                   /protein_id="ACV33637.1"
FT                   /translation="MRDCRPDCGACCIAPSITTPMPGHPCGKPAGEPCLSLTADWRCAL
FT                   WGRPERPAFCAGLQPSAEMCGDNRHQAIAWLSALELASRP"
FT   gene            341813..342637
FT                   /locus_tag="CAP2UW1_0281"
FT   CDS_pept        341813..342637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0281"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: dar:Daro_3911 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33638"
FT                   /db_xref="GOA:C7RK47"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK47"
FT                   /protein_id="ACV33638.1"
FT                   /translation="MDLLLLLKALILGIVEGVTEFLPVSSTGHLILAGDLLNFNDDRGK
FT                   LFEIVIQSGAILAVCWEFRAKIVQVLLGLPSDRAAQRFALNVLVAFLPLAIIGLLFGKA
FT                   IKASLFNAPVVATAFIVGGLVILWAERREHRIRIESIDDLTLLDALKLGLAQALALIPG
FT                   TSRSGATIIGGLFFGLSRRAATEFSFFLAIPTLIGATIYQLYKERALLSFDDLGMWVVG
FT                   FVAAFVSAFWAVRGLLRYISTHDFSAFAWYRIAFGVVVLVTWHYDIVAWTSG"
FT   gene            342639..343211
FT                   /locus_tag="CAP2UW1_0282"
FT   CDS_pept        342639..343211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0282"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   dar:Daro_3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33639"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK48"
FT                   /protein_id="ACV33639.1"
FT                   /translation="MAGPRILYLHGFCSSPASWKARLLGDHLAAAGLADRFVCPTLPPA
FT                   PFAAIADAEALLAGGDGPTTLVGSSLGGYYAAWLAEKHDLRAVLINPAVMAPVLLGGLV
FT                   GTQTNFHSGEKFEFTTEHVEQLRSLEAASVTPARYLLLVETGDAVLDYRRAVERYAGSR
FT                   QIVIEGGDHSFTHFPELMPQIIEFCGL"
FT   gene            343220..345136
FT                   /locus_tag="CAP2UW1_0283"
FT   CDS_pept        343220..345136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0283"
FT                   /product="ribonuclease II"
FT                   /note="PFAM: ribonuclease II; KEGG: dar:Daro_3909
FT                   ribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33640"
FT                   /db_xref="GOA:C7RK49"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK49"
FT                   /protein_id="ACV33640.1"
FT                   /translation="MHVLFEEDGAFRTATIVADNDSSLQVETASGKRSKIKSTSVLLRY
FT                   GEPAPAALLEQAEALAGSIEHDFLWECLGDGEFSFSDFANDYFGHVATPVEASALLLAL
FT                   HSAPIYFHRKGKGRFRKAPPDILQAALAGLEKKRQQALSIERMIGELKAFSLPAEFSPL
FT                   LGQLLYKPDRNRGETKALEAACLDTGLSAAHLLARCGAIRSAYDYHLQRFLLEQFPRGT
FT                   DFPDVATPLLPSDLPRADVRAFSIDDAATTEIDDAFSLQTLPGLGWRVGIHIAAPSLGI
FT                   APGSPLDAIARERLSTVYMPGAKITMLPDAAVDRFTLSSGRAAPAVSLYLTVTPDFEVT
FT                   AHESRVEIVPVVANLRHHDIEPLFNEQTIAAGLTDFAFRDELLTLWQLANACEGRRGKP
FT                   SAMQGNHDYNFRIDGDLADAEACRVEISARRRGSPLDKLVAELMIVANSTWGGLLAAQG
FT                   VAAIYRVQTGGKVRMSTAPQAHEGLGVKQYAWSSSPLRRYVDLLNQWQLVACLNGDTPP
FT                   FAARSDALFAAMRDFDLTYSAYADFQRSIERYWSLRWLRQQGLETIEATIVGRENLARL
FT                   DHLPLVQRVPSAPELKPGQRICLRIESIDYLTLELACRYVETLAVAGSPAIAADDEVLE
FT                   AVD"
FT   gene            345138..346022
FT                   /locus_tag="CAP2UW1_0284"
FT   CDS_pept        345138..346022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0284"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: dar:Daro_3908
FT                   TonB, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33641"
FT                   /db_xref="GOA:C7RK50"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK50"
FT                   /protein_id="ACV33641.1"
FT                   /translation="MNAGARKGSPHVPDGRRLWLALGVSLLLHVVVLSLHFTFPDAARA
FT                   FQDRALDIILVNSRSARKPSEAQALAQANLDGGGNSEEKRRAKTPLPPAPRHQDGDDLD
FT                   HSQKRIQELEAHQQRLAAQTRSRTTVAPAADKQVQPEPTPSVSGRDLAHSALAMARLEG
FT                   EIAKEVDDYNQRPRKKFIGTRADEYRFAQYNEEWRLKVERVGTLNYPEAARGKLYGSLI
FT                   LTVSIRSDGTVASVEINRSSGHKVLDDAARRIVAMAAPFAAFPPAIRHDTDVLVITRSW
FT                   NFTQRDSLETKAR"
FT   gene            346030..346854
FT                   /locus_tag="CAP2UW1_0285"
FT   CDS_pept        346030..346854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0285"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: dar:Daro_3907
FT                   shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33642"
FT                   /db_xref="GOA:C7RK51"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK51"
FT                   /protein_id="ACV33642.1"
FT                   /translation="MSDRYCVFGNPVGHSKSPAIHAAFAAQCRQDLSYEAILAPLDGFA
FT                   ESMRAFAAAGGCGANVTVPFKEQACRLATRLAARAELAGAVNTLVFNGPDILGDNTDGA
FT                   GLLRDLSTNLTCRIAGQRVLLLGAGGAARGVVGPLLDARPAALVIANRTAGRARELAQR
FT                   FAGPAPLLGCAYPEVAGLSFDLVINATSASLTGELPPLPGGVFASGSLAYDMMYGQGPT
FT                   PFLVFAGSHGAACLADGLGMLVEQAAEAFHVWRGVRPETAPVLAMLRAALAR"
FT   gene            346851..347546
FT                   /locus_tag="CAP2UW1_0286"
FT   CDS_pept        346851..347546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0286"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: dar:Daro_3906 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33643"
FT                   /db_xref="GOA:C7RK52"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK52"
FT                   /protein_id="ACV33643.1"
FT                   /translation="MSQLARWLKRLVLGFVALLLLYQLWLFGWVLWWNWVNPDNTRFMS
FT                   IRLDELRVKDPQAQLKKQWAGYDRISANLKHALIAAEDAKFVDHEGFDWEGIQNAIEKN
FT                   QKKGRIVAGGSTISQQLAKNLFLTPAKTPWRKAEEAVITLMLEAVWSKQRIFEVYLNVI
FT                   EWGNGVFGAEAAARHYYGVSAAQLSREQAARLAGMVPSPRFYDRNRNAPGLARKTAIIL
FT                   ARMPSADVP"
FT   gene            347623..348132
FT                   /locus_tag="CAP2UW1_0287"
FT   CDS_pept        347623..348132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33644"
FT                   /db_xref="GOA:C7RK53"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK53"
FT                   /protein_id="ACV33644.1"
FT                   /translation="MKLRTVFLLLILGAIAAFSALNWNHFIAPTTLSLGLTEIQAPLGV
FT                   IMLGVVAFLTAFFLVFVVYVQASALFDSRRHAQELQLNRELADKAEASRFTELRSFLEA
FT                   ELQKLAGVRSGGSPVTADPAILARLDRLEKELLTAVEQSGNSLAACLGEIEDRLERNAA
FT                   APPPRQ"
FT   sig_peptide     347623..347682
FT                   /locus_tag="CAP2UW1_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.800 at
FT                   residue 20"
FT   gene            complement(348180..349604)
FT                   /locus_tag="CAP2UW1_0288"
FT   CDS_pept        complement(348180..349604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0288"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mms:mma_1202 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33645"
FT                   /db_xref="GOA:C7RK54"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK54"
FT                   /protein_id="ACV33645.1"
FT                   /translation="MNFAEIGLHPAILKALTDSGYSEPTPVQQQAIPPAIEGRDLMVSS
FT                   QTGSGKTAAFMLPALHRFALQERPAAVPRPSERGAARPRGHDRQRFQAAQPRMLVLTPT
FT                   RELALQVTAATEKYGRQLHHVRAVAILGGMPYPKQMELLGRNPEILVATPGRLIDHMSS
FT                   GKIDFSQLQILVLDEADRMLDMGFIEDIERIVAATPGSRQTLLFSATLDGTVGELAQRM
FT                   TRAALRIQVDATSARHDNIEQRMHFVDDLAHKNRLLDHLLRDATIDQALVFTATKRDAD
FT                   TVSDRLNVAGLNAAALHGDMHQGARNRTLAAMRRGQVRILVATDVAARGIDVPTITHVF
FT                   NYDLPKFAEDYVHRIGRTGRAGRNGLAISLVHHAEHFNVRKIERFTKQPIPVEIVIGHE
FT                   PTRRPIAVKPRPAGKPAWKGSDNRGLGQPAGRTDNRFSKPSAPKRDGAGRAPYHEAAKG
FT                   SHGGVASGSRRTYGDR"
FT   gene            complement(349863..350456)
FT                   /locus_tag="CAP2UW1_0289"
FT   CDS_pept        complement(349863..350456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0289"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: eba:ebA2295
FT                   chorismate:pyruvate lyase, 4-hydroxybenzoate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33646"
FT                   /db_xref="GOA:C7RK55"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK55"
FT                   /protein_id="ACV33646.1"
FT                   /translation="MNIARRQVWRPSLPRTADSTPLLGWLRDRGSLTARIRSRGRFAVR
FT                   VLRQGLGIPTADEARLLGLDPGVHAWVREVALSCNEQIVVFAHTVLPRRPRGPLTVWLS
FT                   RLGERSLGALLFAHAGFTRGPMAFHRLDRRHALFTAAWAALQLAEQSPATLWARRSRFG
FT                   LGGQSVLVSEVFSPRLAQLPEPGKESWTNGKPVL"
FT   gene            complement(350484..350924)
FT                   /locus_tag="CAP2UW1_0290"
FT   CDS_pept        complement(350484..350924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0290"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   dar:Daro_3253 protein of unknown function DUF192"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33647"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK56"
FT                   /protein_id="ACV33647.1"
FT                   /translation="MYRSALSTFLVLLFALPVLADELPRVDLTAGFYRIQAEVAARDPD
FT                   RMQGLMHRRSMPANHGMLFVFAQAARHCMWMRNTLLPLSVAFLDEEGRILNIEDMQPQT
FT                   EDNHCAAKAARYALEMNLGWFAGKGIKPGTRIGGIEQSPRPQ"
FT   sig_peptide     complement(350862..350924)
FT                   /locus_tag="CAP2UW1_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(351017..351343)
FT                   /locus_tag="CAP2UW1_0291"
FT   CDS_pept        complement(351017..351343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spu:576916 hypothetical LOC576916"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33648"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK57"
FT                   /protein_id="ACV33648.1"
FT                   /translation="MQETDSRVVLCLTAAALSLCCAGSLAVPKAAEHEDAPVSYGEAAA
FT                   PPKPTNKAAAKTAAPTGRQAVERPQAGKSAGAAAPKASKRPTLGKVAAPKKPPEQAARS
FT                   TRKK"
FT   sig_peptide     complement(351263..351343)
FT                   /locus_tag="CAP2UW1_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 27"
FT   gene            complement(351408..352997)
FT                   /locus_tag="CAP2UW1_0292"
FT   CDS_pept        complement(351408..352997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0292"
FT                   /product="cytochrome d1 heme region"
FT                   /note="PFAM: cytochrome d1 heme region; KEGG: dar:Daro_3260
FT                   cytochrome d1, heme region"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33649"
FT                   /db_xref="GOA:C7RK58"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK58"
FT                   /protein_id="ACV33649.1"
FT                   /translation="MTRRQSLAAIALVAALAGTPALVAAAGVQALYREHCSACHGESRL
FT                   GGIGPALLPENLERLRKADAVKVIREGRVATQMPAFGDKLNADEAQQLAEWIYSKVSPA
FT                   PVWGEAEIRNSQVVDAQAAAQPARPGLGLKGADPLNLFIVVETGDHHVSILDGDRLERV
FT                   HRFPSRYALHGGPKFSPDGRFVYFASRDGWITKYDLYNLVVVAEIRAGLNTRNAAVSGD
FT                   GKWVMVGNYLPHSLVLLDAKDLSLVKVIPTLDAAGARTSRVSAVYDAAPRQSFIAALKD
FT                   VPEVWEISYDPDAEAVAEGLVHDYQYKEGHFKPGMFTPRRTLLQDHLDDFFFTQSYLEI
FT                   LGSSRSTPKGQVIFLDGRKKIADLDLPGMPHLGSGITWKWTDPAGRERTVMASPNLNEG
FT                   LVTVIDLGSYQNVRQIRTLGPGFFMRSHENSRYAFTDSMMSPQHKNTLQVIDKQSLEVV
FT                   AEIKAQAGQTLAHVEFTRDGRYALASLWEMDGALLVIDAQTLKEVKRIPASKPVGKYNV
FT                   WNKISRSEGTSH"
FT   sig_peptide     complement(352920..352997)
FT                   /locus_tag="CAP2UW1_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.457 at
FT                   residue 26"
FT   gene            complement(352994..354190)
FT                   /locus_tag="CAP2UW1_0293"
FT   CDS_pept        complement(352994..354190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0293"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dar:Daro_3261 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33650"
FT                   /db_xref="GOA:C7RK59"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK59"
FT                   /protein_id="ACV33650.1"
FT                   /translation="MFRISQYMQELSAPRQPGPKLNPPAPVVIWNLIRRCNLTCKHCYS
FT                   ISADTDFPGELATDEIFVVMDDLKGFRVPVLILSGGEPLLRPDIFDIARRAKSMGFYVG
FT                   LSSNGTLIDAANIARIADCDFDYVGVSLDGIGETHDRFRQMPGAFDASLKGIRLCRDLG
FT                   LKIGVRFTMTQDNAQDLPRLLELVEDEGIDRFYFSHLNYAGRGNRNRQDDAQHRLTRWA
FT                   MDLLFDTCRDYQERGLHKEFTSGNNDADGVYFLHWVQKNFPDNAANIRARLVQWGGNSS
FT                   GVNVANIDNLGNVHPDTMWWHYSLGNVRQRPFSAIWTDVSDPLMAGLKQFPRSVSGRCG
FT                   ECRHFDICNGNTRVRAQQLTGDAWAEDPGCYLDDEEIGVAPGRERVPLTPYIKIRRAS"
FT   gene            354475..355299
FT                   /locus_tag="CAP2UW1_0294"
FT   CDS_pept        354475..355299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0294"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   rso:RSc2662 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33651"
FT                   /db_xref="GOA:C7RK60"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK60"
FT                   /protein_id="ACV33651.1"
FT                   /translation="MNAQDISRWQDLAVQYASDFGIKVLAAIAFWVIGRWLIHRVGSLV
FT                   QSALERQKVDATIMRYLGTVINVTLNIVLVIGILGYFGIQTTSFAALFAAAGVAIGLAW
FT                   SGLLSNFAGGVFLIILRPIKVGDFVTVGGITGTVKEVGLFVSAINTPDNVLTLVGNNKI
FT                   FSDTIQNFSTNAYRRVDLKAQLSGAADHAAAMALLKEKIATIPNVLADPAVDVEILEFN
FT                   LVGPVLAVRPYCHTDHYWQVYFDTNRTIRESLAAAGFPAPMPAQAVFVSQQP"
FT   gene            355352..356512
FT                   /locus_tag="CAP2UW1_0295"
FT   CDS_pept        355352..356512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0295"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   dar:Daro_3768 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33652"
FT                   /db_xref="GOA:C7RK61"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK61"
FT                   /protein_id="ACV33652.1"
FT                   /translation="MAARFLPGNRLTLLNSGAEYFPALIRAIDEATHEVHLESYIFEDD
FT                   VTGREVADAMARAARRGVTVRVLVDGFGAREFADRLQPRLVAAGVQAMVYRPDIARFQL
FT                   RRHRLRRLHRKLVVIDGDIAFVGGINVIDDLNTPHQVPPRYDYAVRVEGPLLTPIQEAM
FT                   HRLWELVLWAKLTRRYRLTRAPRKEPPARGEQTAAFLVRDNIRHRRDIEEAYLEAIATA
FT                   QEDILLANAYFLPGRRFRKALHDAVRRKVRVVILLQGRVEYRLLHYATQALYSKLLTAG
FT                   IRIFEYRRSFLHAKVAVIDRHWATVGSSNIDPFSLLLAREANIVVRDGNFADELRNSLQ
FT                   GAMQSGAHELHAESWKRLRWPSRLLRWASYNLVRVLVGIAGYGRKP"
FT   gene            complement(356494..357453)
FT                   /locus_tag="CAP2UW1_0296"
FT   CDS_pept        complement(356494..357453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0296"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   dar:Daro_3769 glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33653"
FT                   /db_xref="GOA:C7RK62"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK62"
FT                   /protein_id="ACV33653.1"
FT                   /translation="MSLSRPIADPALGRYRGRFAPSPTGPLHFGSLVAAVGSYLDARAS
FT                   GGDWLLRIEDVDQPRTLPGAADAILRTLEGFGFEWDGEVLVQSRRLDLYRAALVDRQVS
FT                   GDVYACACSRREIAANSPPAAVDGGLVYPGICRNGLAVGRTPRAWRMRVADCEIAFDDR
FT                   VQGHVGQNLERAIGDFVLLRADGQFAYQLAVVVDDAAQGVTEIVRGVDLLESTPRQIWL
FT                   QQRLGLPTPRYAHLPIVTNAAGEKLSKQTRAAAVDPAAGSAPLAAALGFLGHAVPQDLG
FT                   RAPLADFWRWAIAAWSIERVPRGRREYRAAPATQGLRP"
FT   gene            357574..358461
FT                   /locus_tag="CAP2UW1_0297"
FT   CDS_pept        357574..358461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0297"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: dar:Daro_0629 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33654"
FT                   /db_xref="GOA:C7RK63"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK63"
FT                   /protein_id="ACV33654.1"
FT                   /translation="MTDRWITPADAAAILAEAMPYIKRFHGKTIVVKYGGNAMTDDSLK
FT                   QCFARDVVLLKLVGMNVVVVHGGGPQIESLLSRVGKKGQFIQGMRVTDDETMEIVEMVL
FT                   GGQVNKDVVNLINQAGGKAVGLTGKDGSFIRARKLMLANQDNSEDLIDVGQVGDITQID
FT                   PSLIGHLESGGFIPVVAPIGVGKGGETYNINADVVAGKIAEILKAEKLVLLTNTPGVLD
FT                   EAGNLITGMTPKQIDDMVANGTLSGGMLPKIGAALDAARNGVKSVHIIDGRVEHALLLE
FT                   ILTDHGVGTMIKSH"
FT   gene            358565..359131
FT                   /locus_tag="CAP2UW1_0298"
FT   CDS_pept        358565..359131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0298"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: dar:Daro_0628
FT                   HAD-superfamily hydrolase subfamily IA, variant
FT                   3:pyrimidine 5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33655"
FT                   /db_xref="GOA:C7RK64"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK64"
FT                   /protein_id="ACV33655.1"
FT                   /translation="MVAYIHEHLGVDRDEATRLRQDYWQRYGATLLGLVRHHGTDPQHF
FT                   LWHTHQFPDLKHMLVCERGLKAMLRRLPGRKIVFSNAPLRYSEAVLELLGISNCFDAVY
FT                   SVERLRFQPKPAVGGFRELLRSERLRADRCIMVEDSLSNLTTARRLGMKTVWVSRSTRR
FT                   PLAVDVRVPSLLDLPGHLSRLQTVS"
FT   gene            359151..363134
FT                   /locus_tag="CAP2UW1_0299"
FT   CDS_pept        359151..363134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0299"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pau:PA14_07500 hypothetical protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33656"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK65"
FT                   /protein_id="ACV33656.1"
FT                   /translation="MREPASPEQQLLEYKAILDHSGIAVVCTRSRLVYRCNPRAEELFG
FT                   WPAGTLVGQLDAVFLPDDASCDALRGTVRPQLRVGKIVDLETRLARRDGSTFVAHLIAR
FT                   AIDPAAPRLGTVWIVRDVTQEVLTRDTSARLLREQQLIFENAETGIVILRERIIQRCNR
FT                   RFAELLGYAADELVGQSTRLYYPSEEAWLETGRRAYAAIAETGIYHGDTIFRRRNGESF
FT                   CCHITGSMMNRANPDEGYVWLYEDVSEKRASAAAMDALLREQTLIFEAAPIGIAFVRDR
FT                   IIQRCNPSLERIFGYSPGQLIGQSTRCFFASEEAWREKGERAQLLIDECGSFVGEVQYC
FT                   KSDGLPIWCRVTGSLANPGEPGDGLVWLFEDVTEKRQADRAMEALLREQALIFERAPTG
FT                   IAFLRDRVIQRCNPSFERIFGYAPGQLLGQSTRVCFASEAAWREAGERAYAVADESGKF
FT                   IGELEYCRADGTPIWCQVTGSLLNPANPAEGYVWLFEDVTARRAAEEALVESLWEQQLI
FT                   FDNAMIGISYHRNRMILRCNRRCEEIFGYLEGGLAGQPTRVLFASDEAWEAVGRQVYGE
FT                   SASGETFDGELLYQRRDGTPIWVHAIGRTIGESADSETWIWAYADVTAQRAAEQALRQS
FT                   HLELEQRVADRTLELSQQLHFMRQLIEAIPGPVFYKSQEGRYLGCNQAFLELIGKSRDE
FT                   VVGATVYDVAPADLADRYKAADDELLARLGSQVYEARVLDADGHYRDVIFHKATYGKPG
FT                   ENGGGLVGVMLDITERKRMEARLLQAATVFDSSAEGITITAPDGNIIAVNRAFTEITGY
FT                   TEDEVIGRNPRMLQSGFQDRRFYLDMWQALGTQGRWRGELWNRRKDGQTFLESLTISAV
FT                   KDAQGKVAHYVGVFSDITELRRAHDQLDHQAHHDPLTGLPNRLLLGDRLHKALQRAHRD
FT                   ETGLAVFFIDLDRFKNINDTLGHQVGDRVLCEVAWRLGRLMRESDTVGRLGGDEFLIVI
FT                   EDVGEPTAVSHIAEKILNVLQASPVTVEHEFFVGASIGISVFPQDGADAETLMKNADVA
FT                   MYRAKERGRNTYEFFTKDLTQTSLARLQMETDLRRAIERGELRVYLQPQFSLATGKVVG
FT                   AEALVRWLRPQQGLVLPGEFIKLAEESGLIVPIGEWVQGTAACQWATWVAAGLAPGVLS
FT                   VNVSGVEFARGRIQQTARRTLELSGLPARFLELEITESAIMSHAENSVQVLDNLRAMGI
FT                   SLVIDDFGTGYSSLAYLKRLPLNKLKVDQSFVRGLPNDTEDCAIARAVIALGHSLQLTV
FT                   IAEGVETEAQREFLTGEGCDEMQGYLRGRPMPFDDYHARFLSG"
FT   gene            363127..364221
FT                   /locus_tag="CAP2UW1_0300"
FT   CDS_pept        363127..364221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0300"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rme:Rmet_4573
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33657"
FT                   /db_xref="GOA:C7RK66"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK66"
FT                   /protein_id="ACV33657.1"
FT                   /translation="MAEAPLPGSGPRLAFVDALKAVASQLIVLHHLAFYGPMSDHAHSL
FT                   LPNLVSWLSQEARIAVQAFLVIGGFLAAQSLAPSGVLLAPRPLSLLWRRYLKLVIPYLA
FT                   AVLLGIACAAIARRLMTHDSLPGLPTLPQVVAHAFLLQSILGYEGLSAGVWYIAIDFQL
FT                   FALLLGILWLARRLGQGAGRAAFVGALLVGALALASLYHFNRDADWDVWGVYFFGSYAL
FT                   GVLIYWATARKQPIAGWLLLLVVPVVTALLVDYRSRIAVALVVALALGLARCTGFLDSW
FT                   PRSRLIAGLGKISYSVFLVHFPVCLVVSGLFARFAPPTAGVNLAGMVIAWLASMAAGAL
FT                   FYRLVESRAPVRRRCPAAGFKQKP"
FT   gene            complement(364205..365221)
FT                   /locus_tag="CAP2UW1_0301"
FT   CDS_pept        complement(364205..365221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0301"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   eba:ebA1071 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33658"
FT                   /db_xref="GOA:C7RK67"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK67"
FT                   /protein_id="ACV33658.1"
FT                   /translation="MDYTGSFPTRRMRRMRRDDFSRRLMRESRLDVDDLIYPVFVLAGV
FT                   GRVEPVASMPGVERQSLDQLLKTAERALALGIPALALFPVVDASGKSSGAEEAYNPDGL
FT                   VPHVVAALKKEFPELGVITDVALDPYTSHGQDGLIDADDPRGYVLNDETLEVLARQALS
FT                   HAQAGADIVAPSDMMDGRVARIRGALDAAGHIHTRILAYSAKYASSFYGPFRDAVGSAG
FT                   NLGKGTKHSYQMDPANSDEALREVALDLAEGADMVMVKPGMPYLDIVRRVKDEFKVPTY
FT                   VYQVSGEYAMLKAAAQNGWLDEQACVLESLLACKRAGADGILSYHALSAAAWLKASA"
FT   gene            complement(365409..366113)
FT                   /locus_tag="CAP2UW1_0302"
FT   CDS_pept        complement(365409..366113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0302"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   dar:Daro_0625 cell division checkpoint GTPase YihA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33659"
FT                   /db_xref="GOA:C7RK68"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK68"
FT                   /protein_id="ACV33659.1"
FT                   /translation="MPLFQQAAFHTTVADLRDLPSDSLCEVAFAGRSNAGKSSAINTLA
FT                   NHSRLAFVSKTPGRTQHLNYFRLADGKYFVDLPGYGFAKAPEEIRSQWEGLLAPYLRHR
FT                   EVLRGLVLIMDSRHPLTELDVQMLRWFAPTGKPLHVLLSKADKLTRQEQVLALREVHAV
FT                   LQEFGENGSVQLFSSLKKSGVREAETVLAGWLGLTMREETPPPAGLSTEKKARPKQRAA
FT                   MGWGARNAGKPR"
FT   gene            366245..366880
FT                   /locus_tag="CAP2UW1_0303"
FT   CDS_pept        366245..366880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0303"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: dar:Daro_0624
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33660"
FT                   /db_xref="GOA:C7RK69"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK69"
FT                   /protein_id="ACV33660.1"
FT                   /translation="MIRTTVLAVLLAASFPAFATEQAKAKPDLAKAKEIAEGVCVACHG
FT                   ADGNSPAPANPILAGQISEYLYKQLSNFKAADGKPAVRNNAIMGGMVAALSDEDMRNLA
FT                   AYFSQQKMKPSLAKEEKLLAEGKTLWRMGDFEKGIPACAGCHGPAGAGLPVQYPRLAGQ
FT                   YAEYTASQLKTFRSHERANDSEKVMRTIAGKLSDHQIAAVAEYAAGLR"
FT   sig_peptide     366245..366304
FT                   /locus_tag="CAP2UW1_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            367009..367440
FT                   /locus_tag="CAP2UW1_0304"
FT   CDS_pept        367009..367440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0304"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   dar:Daro_0623 CBS"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33661"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK70"
FT                   /protein_id="ACV33661.1"
FT                   /translation="MKTLRQILADKSGPLVIVSPDDAVFHALQVMADHNVGAVLVLDGK
FT                   QLVGIFSERDYARKVILFGKASKDTRVREIMTDKVLYVTPDRTVDECMAIMTEKHFRHL
FT                   PVLDDDGRVVGIVSIGDVVKETICEQQFIIQQMEKYITG"
FT   gene            complement(367546..368184)
FT                   /locus_tag="CAP2UW1_0305"
FT   CDS_pept        complement(367546..368184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0305"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: dar:Daro_0602
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33662"
FT                   /db_xref="GOA:C7RK71"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK71"
FT                   /protein_id="ACV33662.1"
FT                   /translation="MEATRICLVRHGETNWNAQQRIQGQIDIGLNAAGLAQAAAAARWL
FT                   VGQPVVALYSSDLLRARQTAESIATTLKLLPILRPEFRERRYGLFEGLTYAESRAAYAA
FT                   DYLSFERRDPDFVIPCGGESLQQLHERVSTGLRLLAAGHRGETIVVVTHGGVLDIVNRL
FT                   VRGNPLSSPRDFLIPNAAINWVSAHGDAWRLEVWGQTEHLAKFGLDELP"
FT   gene            368668..369141
FT                   /locus_tag="CAP2UW1_0306"
FT   CDS_pept        368668..369141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0306"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: azo:azo2931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33663"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK72"
FT                   /protein_id="ACV33663.1"
FT                   /translation="MQKSLHIDPGKCTGCLQCEMACSYENTGLFNPATSRIKVFDFHHE
FT                   GRKVPYTCTQCAEAWCLNACPVEAIKIDAGTGAKVVVDAICVGCKVCTIACPFGTINYN
FT                   HGSGKVQKCDLCGGDPACASACPTSAITYIDADWTGLERMRQWAQKTDSAARV"
FT   gene            369154..371001
FT                   /locus_tag="CAP2UW1_0307"
FT   CDS_pept        369154..371001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0307"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: azo:azo2930 probable
FT                   aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33664"
FT                   /db_xref="GOA:C7RK73"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK73"
FT                   /protein_id="ACV33664.1"
FT                   /translation="MAWTRKVLRVNLTQGSCVSEPLNMAWAAQYLGQRGLASKYLVSEI
FT                   DPLVDPLAAENKIIYATGPLTGTMASTGGRYSVVTKGPLTGVIACSNSGGFFGAELKAA
FT                   GWDMIIVEGKSPRPVYLHIENDKAVLLAAEDLWGRTVWDTEGTLKKRHQDPLLRVSSIG
FT                   RAGENQVLFAAIVNDLHRAAGRSGVGAVMGSKNLKAIAVRGTLGVGNIADPKSFMAAVA
FT                   AGKKVLAENAVTGQGLPTYGTQVLMNVINEMGASPTRNHRDVQFEGARKISAEAMHEKR
FT                   TTDGKTHLVTNQACFGCTIACGRISRIDETHFSVETKPQYWGASGGLEYEAAWALGNAN
FT                   GVDDLEALQYANLVCNEDGMDPISFGATVGAVMELYELGILTRDDIGLEAPFGSAEALC
FT                   RLAEMTARGEGFGKVVGLGSKRLCTRYGRPDLSMTVKGQEFPAYDGRALQGMGLAYATS
FT                   NRGACHLRGYMVSSEVFGIPVKTDPRETAGKPELLKAFQDATAAVDSSGLCVFTTFAWT
FT                   MNDIQPQIQSACEGDWSLESLLQTGERIWNLERDFNLAAGITGKDDTLPPRLLNEPCKT
FT                   GASKGMVAELGKMLPEYYSLRGWTPDGVPTAATRARLGL"
FT   gene            371003..372253
FT                   /locus_tag="CAP2UW1_0308"
FT   CDS_pept        371003..372253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0308"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ajs:Ajs_3945 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33665"
FT                   /db_xref="GOA:C7RK74"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK74"
FT                   /protein_id="ACV33665.1"
FT                   /translation="MASHVIIGNGPAGVVAAETLRRVDPHSEITLIGDEAEPPYSRMAI
FT                   PYLLMGRIGEEGTYLRKDAGHFEGLRIRLRQGRVTALDTGARRLRLADGSGLAYDRLLI
FT                   ATGAHPVRPPIPGIDSPKVLTCWTLADARAIAATVNPGARVLQMGAGFIGCIIMESLAA
FT                   RGPRLTVVEMGDRMVPRMMDEVAGAMIRRWCEDKGVGVRTGRQVVAIAPAGEALRVTLD
FT                   DGEAIEVDVLISATGVKPNIAFLAGSGVAVDAGILVDEAMQTNIAGVHAAGDVAEAVEL
FT                   GTGRRVVNAIQPDAVEQARIAALNMAGQAATLRGTFVFNVLDTLGLISVSFGQWQGVPG
FT                   GETASLVDQADYRYLRLVFDGDRLVGANSIGHTEHIGVLRGLIQGRVRLGPWKDRLLAN
FT                   PLQLSEAYLARGLAALH"
FT   gene            372253..372507
FT                   /locus_tag="CAP2UW1_0309"
FT   CDS_pept        372253..372507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0309"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: lch:Lcho_1819
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33666"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK75"
FT                   /protein_id="ACV33666.1"
FT                   /translation="MEIVFKLFASLSDHLPAAARRTNALPLEVADDCSVAALIDSWSLP
FT                   PRMVHLVLVNGEYIPPSQRAGRLLTAGDVVAIWPPIAGG"
FT   gene            372526..372789
FT                   /locus_tag="CAP2UW1_0310"
FT   CDS_pept        372526..372789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33667"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK76"
FT                   /protein_id="ACV33667.1"
FT                   /translation="MTLTLREFERQLRPLLAGWSVDRLAEGWRLRQEARTVDICCRPLP
FT                   ALPLGALALPRLAVSIDFAGSEPLQEAAFIDDFMHCFRRGGG"
FT   gene            372808..372910
FT                   /gene="ffs"
FT                   /locus_tag="CAP2UW1_R0006"
FT   ncRNA           372808..372910
FT                   /gene="ffs"
FT                   /locus_tag="CAP2UW1_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            373033..374694
FT                   /locus_tag="CAP2UW1_0311"
FT   CDS_pept        373033..374694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0311"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dar:Daro_0806 AAA ATPase, central region;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   AAA ATPase central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33668"
FT                   /db_xref="GOA:C7RK77"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK77"
FT                   /protein_id="ACV33668.1"
FT                   /translation="MSYQVLARKWRPRTFANLVGQEHVVRALTHALTEQRLHHAYLFTG
FT                   TRGVGKTTLARILAKALNCETGVSATPCGTCSACLEIDSGRFVDLLEVDAATNTRVDEM
FT                   RQLLENAVYAPTRGRFKVYVIDEVHMLSTSAFNAMLKTLEEPPEHVKFILATTDPQKIP
FT                   VTVLSRCLQFNLKQMTQPLIASHLKHILEVEAISADTGALHLLARSAAGSMRDALSLLD
FT                   QAIAHGSGKVEEAQVREMLGSVDLDQLFSILDALLAGDAAALLRIADDMTARSLSFDAA
FT                   LQEMASLFTRLQIAQLAPRAIADDMPERSRVLELATALDPEFVQLAYQIAVHGRQELPL
FT                   APDEQAGFIMTLLRLYTFRPVLDDEGAGRSTGTAPSVPRPRAAPTPRAAVPAAATGSQR
FT                   TPASADGALVGGSVPPAAAASVPAVEPDRPAGDWHAILAALKISGMARELGQHCELRDL
FT                   AGARMVLRLSPAHRHLLIKPAQDKLQQSLAEHFGRPLQLAIELDEVSGDTPAATAQRDR
FT                   RERQDRAIASVEKDGFVREIIDTFDATLIESSIKPI"
FT   gene            374734..375057
FT                   /locus_tag="CAP2UW1_0312"
FT   CDS_pept        374734..375057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dar:Daro_0807 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33669"
FT                   /db_xref="GOA:C7RK78"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK78"
FT                   /protein_id="ACV33669.1"
FT                   /translation="MMKGGIAGLMKQAQQMQENMKKAQEQLAQLEVEGQSGAGMVKVLM
FT                   TCGHDVRRVAIDPSVMDDREMLEDLVAAALNDAMRRAEQVSQERMAGFSAGLNLPPGFK
FT                   MPF"
FT   gene            375057..375659
FT                   /locus_tag="CAP2UW1_0313"
FT   CDS_pept        375057..375659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0313"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: dar:Daro_0808 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33670"
FT                   /db_xref="GOA:C7RK79"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK79"
FT                   /protein_id="ACV33670.1"
FT                   /translation="MNAPSSLESLIEALRCLPGVGPKSAQRMAYHLMQHDRPGADRLAD
FT                   ALQLALAALRHCQRCNTFTETEICSRCLSAKRDPSQLCVVETPVDMNMMEQTHAYSGLY
FT                   YVLMGRVSPLDGIGPAELHLERLLARCGDGLVREVIIATNYTNEGEATAHYLSEMLRSR
FT                   GVSVSRIARGVPVGGELEYVDSGTLAQALRERRPLAG"
FT   gene            375760..376356
FT                   /locus_tag="CAP2UW1_0314"
FT   CDS_pept        375760..376356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0314"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="7.1.1.8"
FT                   /note="KEGG: dar:Daro_0809 ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; TIGRFAM:
FT                   ubiquinol-cytochrome c reductase, iron-sulfur subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33671"
FT                   /db_xref="GOA:C7RK80"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK80"
FT                   /protein_id="ACV33671.1"
FT                   /translation="MSNECKVDGGRRRLVVATAAIGGVGALAAVVPFLSSMLPSERAKA
FT                   AGAPVEVDLASLEPGQMMTVEWRGKPVWIINRSAPMLETLPKLNDSMADPKSEKPMQPA
FT                   YCKNETRSIKPEIMVAVGICTHLGCSPSAKFKKGTEDGMDAAWLGGFLCPCHGSTFDFA
FT                   GRVFKNKPAPDNLEVPPHMYLSEKRILIGEDKKGA"
FT   sig_peptide     375760..375846
FT                   /locus_tag="CAP2UW1_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.865 at
FT                   residue 29"
FT   gene            376360..377679
FT                   /locus_tag="CAP2UW1_0315"
FT   CDS_pept        376360..377679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0315"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: dar:Daro_0810
FT                   cytochrome b/b6, N-terminal:cytochrome b/b6, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33672"
FT                   /db_xref="GOA:C7RK81"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK81"
FT                   /protein_id="ACV33672.1"
FT                   /translation="MASNTEFEKYKSDGSLQGNLLEWVDARFPATSMWRGHLSEYYAPK
FT                   NFNFWYFFGSLAMLVLVIQIVTGIFLVMHYKPDASLNANGIPVAFASVEYIMRDVNWGW
FT                   LIRYMHSTGASAFFVVVYLHMFRGMLYGSYRQPRELIWIFGTLIFLCLMAEAFMGYLLP
FT                   WGQMSFWGAQVIVNLFSAIPLIGEPLSIWIRGDFVVGDATLNRFFSFHVIAVPLVLLGL
FT                   VAAHILALHEVGSNNPDGVEIKKRKDVHGHPLDGIPFHPYYTVKDIVGVVVFLMVFSII
FT                   VFFAPEGGGYFLEYNNFLPADPLKTPLHIAPVWYFTPYYSLLRAMVWPLFGIDAKFWGV
FT                   VAMGAGVVILAFLPWLDRSPVKSIRYRGPIFKTLLTIFVISFVILGFLGTQPPSYAFFG
FT                   VIPSAPVAQVLSAYYFLYFLTMPWWSKIDKYKPEPDRVTM"
FT   gene            377693..378403
FT                   /locus_tag="CAP2UW1_0316"
FT   CDS_pept        377693..378403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0316"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: dar:Daro_0811 cytochrome
FT                   c1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33673"
FT                   /db_xref="GOA:C7RK82"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK82"
FT                   /protein_id="ACV33673.1"
FT                   /translation="MKKLLTALLFAPAVALASGAGVHLDKAPDVQGDKAALQSGARTFV
FT                   NYCLNCHGASFVRYSRLTDLGLTDQQVKDNLMFTAVKIAEPMRVAARPDEQKLWFGAAP
FT                   PDLTLVARARASEEGSGADWLYTYLRSFYVDEKRPTGWNNTLFPNVGMPNVLWELQGQQ
FT                   ALNKDHHLELLAPGKLSPAEYDKQIADLVGFLVWMSEPDAGFRKRLGFGVLGFLVVLFA
FT                   VAYPLKKAYWKDVK"
FT   sig_peptide     377693..377746
FT                   /locus_tag="CAP2UW1_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.614 at
FT                   residue 18"
FT   gene            378507..379103
FT                   /locus_tag="CAP2UW1_0317"
FT   CDS_pept        378507..379103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0317"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dar:Daro_0812 glutathione S-transferase,
FT                   N-terminal:glutathione S-transferase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33674"
FT                   /db_xref="GOA:C7RK83"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK83"
FT                   /protein_id="ACV33674.1"
FT                   /translation="MMNLYSGTTCPFSHRCRIVLYEKGMDFQVIDVDLFAKPEDIAIIN
FT                   PYGRVPVLVERDLILYEPNIINEYIDERFPHPQLMPADPIMRARARQLLITMEREVFAY
FT                   IEPLERNSKTADKARQQIRDRLTEMAPVFVKQKHMLGEEFSMLDVAIAPLLWRLDHYGI
FT                   ELSRLAAPLMKYGERIFSRQGFIDALTPSEKAMRK"
FT   gene            379179..379595
FT                   /locus_tag="CAP2UW1_0318"
FT   CDS_pept        379179..379595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0318"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   dar:Daro_0813 ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33675"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK84"
FT                   /protein_id="ACV33675.1"
FT                   /translation="MDLPSTKPYLIRAIHQWCCDNGFTPYLAVAVDARTRVPREHVRDG
FT                   QIVLNVDYEATGNLAIANDGITFQARFGGVARDIAIPIGNVAAIYARENGAGMAFEPES
FT                   DSPADTPGAPESGAPEGEPEPPPPAGRPKLQRIK"
FT   gene            complement(380125..380682)
FT                   /locus_tag="CAP2UW1_0319"
FT   CDS_pept        complement(380125..380682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_1155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33676"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK85"
FT                   /protein_id="ACV33676.1"
FT                   /translation="MISSVSRLQAAFSPEVAIDDRGGGRPVDAEKSSPVRNGLSVEEQR
FT                   QVEVLRATDRKVRAHELAHIAAGAGLTGAASFTYQLGPDNQRYAVAGEVSIDISSGGDP
FT                   EEAIAKAQQIRAAALAPADPSPQDRKVAALATKMEDSARQELASQGSAASQSVTDARVG
FT                   GALAAYQAQADGPRSAGFSVFA"
FT   gene            complement(380697..381398)
FT                   /locus_tag="CAP2UW1_0320"
FT   CDS_pept        complement(380697..381398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33677"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK86"
FT                   /protein_id="ACV33677.1"
FT                   /translation="MSSPCGRASLGDSISNSICCLSHLLDTHALTPFALGLLRNKFSML
FT                   SPKFAGMRCRGAISDTTVGSPPGMAWRPGASRHGLLSQAALACLPIFRFGQPFRLAEGQ
FT                   GGCVCRAPGSACSVQAADAHCVHPCIRASAGADRSMVVVGEWAAGIYQSLLGGRSRSSC
FT                   RAVQSRRGTVRYRSTGSAGVSAAVSSPLRAAVPTSEATTVADVSHRAAEVAWSRRLESS
FT                   RCRGYSLQVGV"
FT   gene            complement(381512..381799)
FT                   /locus_tag="CAP2UW1_0321"
FT   CDS_pept        complement(381512..381799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0321"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   dvl:Dvul_1443 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33678"
FT                   /db_xref="GOA:C7RK87"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK87"
FT                   /protein_id="ACV33678.1"
FT                   /translation="MAKFFPFDAVEYLGDEATIAEYTTAALEDSNPDVFLTAVRDVARA
FT                   RGMSQLAKDAGLGRESLYKALTPGAKPRYDTMRKFLHALGVKLSASPIHS"
FT   gene            381834..382082
FT                   /locus_tag="CAP2UW1_0322"
FT   CDS_pept        381834..382082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33679"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK88"
FT                   /protein_id="ACV33679.1"
FT                   /translation="MARLMSRFCEDLSPPNKQIEHLSTTDEIDAIARTEMDPHFRNSRA
FT                   DWFTVSEVAMFGRADAKNYASTAYLVRQCRKPAVKFI"
FT   gene            382470..386345
FT                   /locus_tag="CAP2UW1_0323"
FT   CDS_pept        382470..386345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0323"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; FAD linked oxidase
FT                   domain protein; KEGG: dar:Daro_4121 protein of unknown
FT                   function DUF224, cysteine-rich region:FAD linked oxidase,
FT                   C-terminal:FAD linked oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33680"
FT                   /db_xref="GOA:C7RK89"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK89"
FT                   /protein_id="ACV33680.1"
FT                   /translation="MNARLREIPYNYTSFSDREIVIRLLGAEKWALLDELRAERVTGRS
FT                   ARMLYEVLGDIWVVQRNPYLEDDLLANRERRVALVGALRHRLREIEKRRQGNDRVRELL
FT                   GAADAAVNAFERHFADTAKRRARVRKVLARHTRRDNIAFDGLARVSHVTDATDWRIEYP
FT                   FVVLHPDSEDEIAPLVRGCIELGLTIIPRGGGTGYTGGAIPMTPLSAVINTEKLIDIGA
FT                   VEEMQLPGCDRRSATIRTGAGVVTARVSEAATAAGRVFAVDPTSAEASCIGGNIAMNAG
FT                   GKKAVLWGTALDNLAWWKMVDPSGHEMEVTRLDHNLGKIHEQEVARFEIRRFRRDGRTL
FT                   YGPPEILEIPGHRFRKAGLGKDVTDKFLAGLPGVQKEGTDGLIVAARWILHQMPQHTRT
FT                   VCLEFFGQVREAVPAIVEITDYFKPGGGGRQAGVLLAGLEHLDERYLRAVGYATKAKRK
FT                   AETAGRPKMVLLGDITGDDEAAVMSAASEVVRMCNLRSAEGFIAVDAETRKKFWLDRAR
FT                   TAAISRHTNAFKLNEDVVIPLPRMGEYCDGIERINIELSIRNKLALCDALDKLLRGDLP
FT                   LHRGDADLDKELLIGERRTMALDAVAGVRARWQWLLDNLDLPLTEAETQFARLGVRVES
FT                   LRNRAAEPTLFHRLQDYSLRVSWKSELKPQLEDIFDGVVYRPVLERIAAIHREILRSRL
FT                   FVALHMHAGDGNVHTNIPVNSDHYEMLQTAYAVVERIMRLARSLDGVVSGEHGIGITKL
FT                   EFLSEAEIQPFRDYKARVDPSGRFNQGKLLPGADLGNAYTPSFSLLGTESLIMEQSEIG
FT                   NIATMVKDCLRCGKCKPVCSTHVPRANLLYSPRNKILATSLLIEAFLYEEQTRRGVSLR
FT                   HFDEFNDVADHCTICHKCVTPCPVDIDFGNVSIRMRNLLREQGKKKFVPAKALAMAFLT
FT                   VKDPATIKLVRKLMIDWGYRAQRLAHRLAKSLGLTRGQTRQPPATLGAPALRAQIIHFI
FT                   NKPMPAGLPKRTARALLDIEDDKVVPIIRDPQKVGAADYDGDAVFYFPGCGSERLFSQV
FT                   ALATQAILYEIGAQTVLPPGYLCCGYPQTAAGEADQGQTITTDNRVLFHRVANTLNYLD
FT                   IRTVIVSCGTCMDQLEKYHFEQIFPGCRLLDIHEYLLEKGIRLDGVGGTRYMYHDPCHA
FT                   PMRTMPGIKVVNQLMGQPVDLSERCCGESGTLAVTRPDVSTQVRFRKQEEIEKGAGRLR
FT                   ADGFAGEVKLLTSCPSCLQGLSRYNDDAGTQADYIVVEIVKRLLGEDWMAHYLQRANNG
FT                   GIERVLL"
FT   gene            386408..387193
FT                   /locus_tag="CAP2UW1_0324"
FT   CDS_pept        386408..387193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33681"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK90"
FT                   /protein_id="ACV33681.1"
FT                   /translation="MTQAVPRTNFNRSKLVRLLADLSIVDIAESKPDFAERLSQWLDLS
FT                   DAITLHAVQNAGAASWSAAPSCGQAVAAVAMEEEYARVRTALVNSITTSCSSAIGETRM
FT                   KLPTPEPDATIETAAAYQLAYQPFRRLHLAQQASMEASVRALRSSVRRALARASAPLRQ
FT                   LAALDEALDNTLCVREHQLLATVPMLLERRFEQLLKAHQQPLADTRQADSRAARPPPAE
FT                   WLSVFCRELQGMLLAELDLRLQPTAGLIEALRNEANEVK"
FT   gene            387190..389064
FT                   /locus_tag="CAP2UW1_0325"
FT   CDS_pept        387190..389064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0325"
FT                   /product="protein of unknown function DUF802"
FT                   /note="PFAM: protein of unknown function DUF802; KEGG:
FT                   bxe:Bxe_B0803 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33682"
FT                   /db_xref="GOA:C7RK91"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK91"
FT                   /protein_id="ACV33682.1"
FT                   /translation="MNRGVFALVFLLGAMAVVWVGVGFVGSNALALAMTAIIAAVYLFG
FT                   ALEIREFRRATASLAMALAAIPDKLSSLTEWLDRLHPSLQNPVRLRIEGERIGLPGPVL
FT                   TPYLVGLLGMLGMLGTFLGMVVTLNGAVFALEGTTDLQAIRSALAAPVKGLGLAFGTSV
FT                   AGVAASAMLGLLSALSRRERMLTAQLLDTRIATVFRGFSLTHQRQETFRALQLQAQALP
FT                   DLVDKLQAMLEQIERRDEQWHARLLANQENFHSEAKDVYTHLAGSVEKSLKDSLTDGAR
FT                   AAGETIQPAVEAAMTGIARETQLMHARMIDSAQIQLDGFSARFGDTANRVSETWLAALA
FT                   THQSTSEGVTRGMDRSLAAFTTTFEQGTESLLASLGEALRTALANQVSGDRQRLEGWTR
FT                   SLESMAASLQHEWQQASAQTLAQQQRICSALEEPMTRLLETASEAPRAAAEVIGKLRQE
FT                   MTNSMARDNQLLEERSRTMETLNSLRAAMDHASTEQRAAIDSLVASSATLLGNAGSQFA
FT                   ELVAAQSARLSDIAAHVTSSAVEISSLGEAFGFAVQSFSEANEKLIANLQRIEVSMDKS
FT                   TARSDEQLAYYVAQAREIIDLSIMSQQKVVEELRQITGKQATTTDQAS"
FT   sig_peptide     387190..387285
FT                   /locus_tag="CAP2UW1_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.495 at
FT                   residue 32"
FT   gene            389064..389708
FT                   /locus_tag="CAP2UW1_0326"
FT   CDS_pept        389064..389708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0326"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: pol:Bpro_0505
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33683"
FT                   /db_xref="GOA:C7RK92"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK92"
FT                   /protein_id="ACV33683.1"
FT                   /translation="MDNGDAGMEQTAPVWAVFGDLMSGLLGAFVLILVGVLGVQLELAT
FT                   HLEAEVQKRQMEEKRRMALEKALAIPLATGRVTLNNGRIGISGSVLFALNSDQLQPAGR
FT                   LLLKSLVAPLRVYLGERDELLMVSGFTDDVPIQHGNSRFVDNWELSAQRALTVTRALID
FT                   EGMPSSLIFAAAFGTEQPVASNADDRGRSQNRRVEMAPVPKASNVKIPADG"
FT   gene            389701..390438
FT                   /locus_tag="CAP2UW1_0327"
FT   CDS_pept        389701..390438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33684"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK93"
FT                   /protein_id="ACV33684.1"
FT                   /translation="MAEANRGGVAQSVAERAIDPAMEIAALRLTGADRLDPVRFHFIEA
FT                   LARRSRGQRGEVKRILDGKLREALAAYRRRFERTQDDARETIARAGEHDRDVADELQRL
FT                   FVAGDFSGVSRYVTRLAKSDPQVSLADLARHLAQDSPEDVDGGPAGNIESRAELKAMRY
FT                   FRNTWSRLSVDRQVTQAIEQGPENAGPLNSHRLVLRSLALMRDISPDYLNRFVSYVDTL
FT                   LWLDQADGRHRPRPGKQLTTKRR"
FT   gene            390668..390817
FT                   /locus_tag="CAP2UW1_0328"
FT   CDS_pept        390668..390817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_3118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33685"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK94"
FT                   /protein_id="ACV33685.1"
FT                   /translation="MSPAKINELFDTLRAAYARQFGFNPRHLTLAPWHVELEESRLAAS
FT                   LAGR"
FT   gene            390884..393142
FT                   /locus_tag="CAP2UW1_0329"
FT   CDS_pept        390884..393142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0329"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: acr:Acry_3541 helicase, RecD/TraA family;
FT                   TIGRFAM: helicase, RecD/TraA family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33686"
FT                   /db_xref="GOA:C7RK95"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK95"
FT                   /protein_id="ACV33686.1"
FT                   /translation="MSDAPAGELDRLAGLVERVTFHNPENGFCVLRLKVKGERELITLI
FT                   GHTPIVSPGEYAAASGHWVTDREHGRQFRAVFVKISPPTTLTGIERYLGSGMVRGIGPI
FT                   YAGKLVKSFGAAVFDVIEQSPERLREIPGIGAVRASRITAGWADQKIIRGIMVFLHAHG
FT                   VSTARAVRIFKTYGQGAVDVVRENPYRLAQDIRGIGFLSADTIAQKVGIAKDSPLRAQA
FT                   GISYALTEASAQGHCGLPYAELVPLAVKLLDIPESIIETAIAQEIADEVLVPDTVEGQP
FT                   SVFLAPLYYAEQSLAAQVRRLTTAASTLPDFAADKAIPWVEQKLAIELADSQKEAIRLA
FT                   LSAKLLVITGGPGVGKTTLVNSILTIMSVKGVKPLLCAPTGRAAKRLGESTGLEAKTIH
FT                   RLLEVNPLNGQFKRNADNPLECDVLIADECSMIDVPLANQLLKAVATSTVMILVGDVDQ
FT                   LPSVGPGQFLADLIDSGSVPVIRLTEVFRQAASSRIVRSAHQINRGVFPSLPGKGEASD
FT                   FYLVAAEEPEVIAQTVVDLVQTRLPRKFHVDPVRDIQVLCPMNRGITGARGINQALQAA
FT                   LNPPGEHSVDKFGNRFSVGDKVMQIENNYDRDVFNGDIGFVTGIDRDDEELAVTFDGRV
FT                   VTYPFGELDELVLCYATTIHKAQGSEYPVVVMPISTQHYMMLKRNLIYTGITRGKTLVV
FT                   LVGQKRALAMAVKGKEVERRWSKLKERLSMPGKCSCDVGDAAVAADVDGHSVRERRPV"
FT   gene            393306..393746
FT                   /locus_tag="CAP2UW1_0330"
FT   CDS_pept        393306..393746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0330"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   dar:Daro_4120 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33687"
FT                   /db_xref="GOA:C7RK96"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK96"
FT                   /protein_id="ACV33687.1"
FT                   /translation="MSESDLDDFDDCVLCGAPGGEVVWESALCRVVMVDDADYPGYCRI
FT                   ILHRHLREMTDLPEKERTQLMNVVFAVERAVRCLYQPDKINLASLGNMTPHVHWHLIPR
FT                   WRDDRHFPFPVWAAPQRANSPGRRLVDGRQLGDGIIAALRST"
FT   gene            393787..395397
FT                   /locus_tag="CAP2UW1_0331"
FT   CDS_pept        393787..395397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33688"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK97"
FT                   /protein_id="ACV33688.1"
FT                   /translation="MSAVLANTAPASLRIPDLETGFQVLSRLPLANSQQAAVEMNAFLD
FT                   CLLQAPPAAGVYLQILEQTRISLCFIEEDLARRFTNKPLPLGDLEELAFQEVVGTWLKA
FT                   ARSYSHCAQLQDADGGSADADRLALILHRCIYYTGMAIVEHHRARRQLPAGLWLNLHGF
FT                   YASAEEWGIATLAVQDPLDPLGRSTHCAAALVALLLTELSGPYSLSIRELGLVRRWASN
FT                   WSPLVTIHAAIPGEPLPHCVVDLMQDAGLCASSECLVTENLRRLDTSRLAMQLSRLREQ
FT                   LQQRMAPAQIGLGEDCTAVQCHRLLKRVFKPWTLVRAGRQFRRHRAAGIAKVCSGFVGM
FT                   HYYISGTEFNQPDNARIYSRQEFDSLFAFRHMVDPTQQLTMRPSQQGFALDDWEVLDQC
FT                   ANGFRLLRSNAGRKLEPGQLLSLCPHDGSAHLLAQVVWLRQEQSGGLVAGIAALPGRPR
FT                   AVAVRPVAERPGHGEHYSRAFLLPAVPAVGAEETLVIPQGWYRRERVLEMHTDTASHVR
FT                   LQRLVAEGSDFERVTFAAA"
FT   gene            395901..396524
FT                   /locus_tag="CAP2UW1_0332"
FT   CDS_pept        395901..396524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC4267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33689"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK98"
FT                   /protein_id="ACV33689.1"
FT                   /translation="MGVCPRVVLGGSEILEITAMQWTIRAILLGSTLVAGQVSAQPQPE
FT                   GFLCCNMRSDGSWISDINYAQRGKTIIPVGTPVKVTGYGRHRVYLLVAGGKQALGNDYS
FT                   RDLEMDAFVTRYVVKKDPRLQIATFPAKIREAITSAKLTTGMTREQVTMSVGMPVSSEN
FT                   PKLDANIWRFWREGDAEFQVVFDESGRVSEIATDPPTRSLVVLP"
FT   gene            complement(396639..397598)
FT                   /locus_tag="CAP2UW1_0333"
FT   CDS_pept        complement(396639..397598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0333"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; sigma-70 region 4
FT                   domain protein; KEGG: rpb:RPB_1819 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33690"
FT                   /db_xref="GOA:C7RK99"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7RK99"
FT                   /protein_id="ACV33690.1"
FT                   /translation="MSEAHALNRVILSLYHEGREVPLGSFQAWALEQLQCLIVFDSAWW
FT                   GNAAANPPALHQMHLYQCDESILEAYPPYLEQDLFRAALIARPGTTVNLSDLTTRERHV
FT                   RTPLYREFARRFKVEWSLGTLVIEPVSSLYEFLTLWRHDPGRPFSEAERQTKELLMPHL
FT                   VETHRAVRLRHFLKVPADHDREWAVVDARAFLREASPAFIARLRAQWPGWSGSSLPEPL
FT                   ASHATRGSPYVSAAVHFDVTPCGQLRYLVARSEGALAQLSGREREIATRYAGGETYSAI
FT                   AASLSLSPTTVRNHIAHCFHKLGVNNKAELARRLERKA"
FT   gene            397901..403450
FT                   /locus_tag="CAP2UW1_0334"
FT   CDS_pept        397901..403450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6767 outer membrane
FT                   autotransporter barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33691"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA0"
FT                   /protein_id="ACV33691.1"
FT                   /translation="MPARAPRFTVKPTLLAILLAFPAQQALATACTWNPASGNWATAGN
FT                   WSCAIVPGINDDALIAAGNAVTIDAAQAVRNLNNGGGVNIDAFLLTLSGAGSTTNTGTI
FT                   NVGSASTATLQVSAGHNIANTGGIINIANGSVLNQFGSTITGGTISTTGTGKVVGFNSN
FT                   SNILTGVTLNGTLDLATGTSIERVTGGLTLNGAVNINNNSVLSFSGDQTLSGTGSIVLG
FT                   NTGASNRALGLEGNTTLTIGSNIVVRGENGTLGQTYLSGGTQSLINNGRISSDVSGGKF
FT                   SLTPSNGVTNNGVLEAKNGGTLVLDANVTGTVGSHIDVGAGSTILQNGVGLNGVINAAG
FT                   GGSFRAANSNSNTLTAATFNGTLDLATATGIERVAGGLALNGAVNINNNSVLSFSGDQT
FT                   LSGTGSIVLGNTGASNRALGLEGNTTLTIGSNIVVRGENGTLGQTYLSGGTQSLINNGR
FT                   ISADVSGGKFSLTPSNGVTNNGVLEAKNGGTLVLDANVTGTPSGSIVAGAGSTVLQNGV
FT                   TLSGTINSAGTGNFRVSNSNSNVLSGVSFNGPLDLASATSVERVTGGLTLNGTISVNNN
FT                   SVLSFNGDQTLDGAGTIVLGATGASNRALALEGNTTLTVGSAIAVRGQNGTVGQTYLSG
FT                   GTQVLVNNGQILADVGGGLIDLSAQQTNNAGTLGAANGGILRLNNNVNNTGSGHIDSAK
FT                   DSTVFQNGVTVAGGTINTVGTGRFSASNSNGNVLSGVSLNGTIDLASATGIERVANGLT
FT                   MTGGSIVKINSNSVLSFSGGNQTLGGSGTIELGSTGGSNRALSMEGNTTLTVGPNVVIH
FT                   GVNGTIGQTYLSGGTQNLVNSGTINADGGGTITVGVSGALTNDGLLRAQNGTLSVADPV
FT                   SGSGTLQVDSTGVMNLANSPNTQGKLVMGAAGSTLNIGTKNLTINTDYTNAAAGTGNAF
FT                   NRRTGISGAGQVVAGGDVAQAITGAAVTNGDTTNATLTINNVRVGSTTYNYQIANKGTT
FT                   GPLLRGALQTNVNGANLTDARLSGAGVTASNYTTGGPGSNTGDLGVTFTAAAAGALAPL
FT                   SGQVLNLRSNFDNIADQKLNIVLAGGAAAYNAAVGSTTPAPTVTVANQHVGASKLASLT
FT                   VANTATAGAFSEDLNARFGINTGAASNNGASINGLLAGANNSSAMKVGVDTTSAGAKSG
FT                   TVTLNYETAGAVNGVSNGLGVAAANAPQVLNVTGDVYRLAQPNTIESINFGNVLFGSTQ
FT                   TRTLTVSNLAATDGFSEALNAAFGSIGGINAASFSGAGGITGLLAGNTDSTSMVVTLDT
FT                   KSTGTKTANVQILLKSNGDAIGNGLGLTDLGTQVINLDGVISGTVGNLATAGLSPTTVN
FT                   FGKFREGTVTSQTQQLTVSNLTTGPGEGLNASFGVVTGGASNNGGTIASLATAASNNTA
FT                   MSATLNGLATAGAKSGTQTVNFVSDGSFNSGVTTPLPAQVVSLSADVYRLAVAGGTNAV
FT                   HLAAKRVGDAAATGTLTLANTAAADGFSEGLRGSIGAAPAGFVVSGPASTALLAAGASE
FT                   ARTVSLSTATAGNFGGNVDLALVSNGAGTSGFGDESIGSKSVALAGKVYTAAVGKLATD
FT                   TVDFGIVRVGDTVSTRNITVQNTADLTALNDTLRADLSGLSGGGALTAGGPVSGIVAGS
FT                   SGTLSLALNTSAAGVFDKSATVTFLSQNPDMTDVSAGASGSVLVKAQVNNLANADFDLL
FT                   SSLGRLTQTGTSYDLDLGNIVIGKSIAAALQVDNDVAGPADFLRGSFDFTAADDFTFKG
FT                   WRDFLALGAGDALGGLELDFTAADLGLVEDTITFKGFGYNASDTAGLGQSRSLRIHANV
FT                   VRDGGGSIPEPATSLLLTIALASLLLQRRRAMLH"
FT   sig_peptide     397901..397987
FT                   /locus_tag="CAP2UW1_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.834 at
FT                   residue 29"
FT   gene            403522..403806
FT                   /locus_tag="CAP2UW1_0335"
FT   CDS_pept        403522..403806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33692"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA1"
FT                   /protein_id="ACV33692.1"
FT                   /translation="MSTLQYRVLVLLGALALVLAIVNAVMFSNNRQAQNELAARGQYIQ
FT                   QSLQLEPLYQSLIKSLADLAARDNDAQLRELLSSQGISFSANPQTGTLR"
FT   sig_peptide     403522..403623
FT                   /locus_tag="CAP2UW1_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.860 at
FT                   residue 34"
FT   gene            403812..404111
FT                   /locus_tag="CAP2UW1_0336"
FT   CDS_pept        403812..404111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33693"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA2"
FT                   /protein_id="ACV33693.1"
FT                   /translation="MDERKPASFFLPVLLLALAAVVWSGFQASQLYQERASLANLRSNQ
FT                   ETTLKNAEKMRSQLDALAAGTQKLASAGNKNAQVVVTALQQRGITINPDAKKPQ"
FT   sig_peptide     403812..403886
FT                   /locus_tag="CAP2UW1_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.403 at
FT                   residue 25"
FT   gene            404345..405988
FT                   /locus_tag="CAP2UW1_0337"
FT   CDS_pept        404345..405988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0337"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: dar:Daro_4199 cobalamin B12-binding:radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33694"
FT                   /db_xref="GOA:C7RKA3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA3"
FT                   /protein_id="ACV33694.1"
FT                   /translation="MRVTLVHPAGFNFVPGQPDFSVLANRMPPIGIMQLASWLEKHGHP
FT                   TELHDCLGPYAPPGIEANAEIVLATRPDLVGISATTSSFMDGVDLAIYIKQKRPAVKIV
FT                   FGAVHVSSIGAPILEHFPEIDYLCIGEGEGCMLDLANGKPLRDIDNLVFRDAGGRIVCN
FT                   PRRHRILDLDELPFPAYEKLAGFPHAYHLPLFAYDKRYGATMITSRGCPYTCSFCDRTV
FT                   FERLYKTNSAQYTYEHMRHLRDRFGVYHINFYDDLFTAHRKRVTELCQLLIDKPLGMNF
FT                   NCAIRTGHTSDEMLGMLKKAGALMVSMGIESADPGMMERHKAGVTLPEVKKTVEQIHAA
FT                   GLRAKGLFIFGLPGETPETLRHTSDFILSLDLDEMNMTKFSPMYGAPIWDECVSGKEGE
FT                   FIEDWRLMNCLNFVFKPHGFSSREEMDALYNWHVKRYYDSKAYRRRFAKRLWQHRWSLW
FT                   HVVRHLPETIAAARYFSANKEQLELAKRDFARHPRQPVGLQPFLSPELKADAIAAMSPI
FT                   KISRRPVRPAPVPEACCTPPALGATASGTV"
FT   gene            406043..407380
FT                   /locus_tag="CAP2UW1_0338"
FT   CDS_pept        406043..407380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0338"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG: dar:Daro_4197
FT                   monooxygenase, FAD-binding:FAD dependent
FT                   oxidoreductase:tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33695"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA4"
FT                   /protein_id="ACV33695.1"
FT                   /translation="MQDEAGGTDRRECDVLVIGGGPAGSTVAPLLVEKGYRVVLLEKAR
FT                   HPRFHIGESLLPANLPLFERLGVAGDVRAIGMEKWGAEFVSPQHAMPQAFHFADAWDKS
FT                   MPYAYQVKRAEFDTILIRNAAKKGVEVHEGCKARAVDFPRDDKAVVRARYDDGREVEWT
FT                   ARFVVDASGRDTFLANRFQIKHRNPRHNSSAVYGHFSGALRNDGQAAGNITIFWFEHGW
FT                   FWFIPMKDDVTSVGMVTWPYFMKTRGERSIERFLMDGIATCPALARRLAGAQLIHQVEA
FT                   TGNFSYVSERTHGANYLLLGDAYAFIDPVFSSGVLLAMHSGVIGSAAIDTCLKTPAEAT
FT                   AALKRFDQLMQHGPKQFSWFIYRVTNPIMRDFFMGPKNIFRVKEALLSVLAGDIFGKTP
FT                   IWRSIHMFKLLYYIANAIQPRRAFMGWRRRRFNIRRVDDPALSSAP"
FT   gene            407377..408405
FT                   /locus_tag="CAP2UW1_0339"
FT   CDS_pept        407377..408405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0339"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: dar:Daro_4196 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33696"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA5"
FT                   /protein_id="ACV33696.1"
FT                   /translation="MSLAFCSDLRRPLPAAGDAFDEKCVLGGALVGNPSASRSPWPWPV
FT                   QAVLAPVLGDTRDSVQERWTADGECQAGEFKGIAFRRSRDILFGVIELDEHAFSAAGET
FT                   RSLQAATEEAYRRIFQLLAAQDLPHLWRVWNYLADINRDTNGLERYRQFNIGRYDAFVA
FT                   FDRAATGNVPAACTIGLRQGRLSVAFIAGRLAARPVENPRQVSAYYYPAEYGPRSPTFS
FT                   RAVLLTLPGQASLFISGTASIVGHRTVHPGDVAGQSREALANVEALIVEAKRLSPAAAF
FT                   TQAGLAYRVYVRHAADYPVVRDVLAERLGEAAEVLFVQADICRHDLLVEIEAIASTALG
FT                   SC"
FT   gene            408405..409253
FT                   /locus_tag="CAP2UW1_0340"
FT   CDS_pept        408405..409253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0340"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   dar:Daro_4195 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33697"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA6"
FT                   /protein_id="ACV33697.1"
FT                   /translation="MAASNWRRTGRLMAAGVACLSAVAMAAEEKPLWELGAGVAAFSFP
FT                   YYRGSDQTNNFVLPVPYFTYHGDFFKADRHGIRGSFFDSDRIDLSVSLALSPPGSSDDI
FT                   RARSGMPNLDATFEIGPQMNITLWRSENRARFLKLLLPLRAAFTVESSPQDIGWVFHPR
FT                   LNMDITDLPGMPGWNLGLLAGVVFGNQRQNAYYYSVAPQYATATRPAYQADGGYAGTQY
FT                   LVAISKRFPKFWLGAFARYDNLSGATFEDSPLVRQKDYFAAGLSVNWILGESSTRVRVD
FT                   D"
FT   sig_peptide     408405..408485
FT                   /locus_tag="CAP2UW1_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            409246..410049
FT                   /locus_tag="CAP2UW1_0341"
FT   CDS_pept        409246..410049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0341"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   dar:Daro_4194 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33698"
FT                   /db_xref="GOA:C7RKA7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA7"
FT                   /protein_id="ACV33698.1"
FT                   /translation="MTDSRGGKPLWVAYERLAMALGLGALALGCLIWLPFAMLLHPLLP
FT                   RRLGQPLGRFAARTGFRGYLGVLSALCACRFDLDELDQLRDAGPLVLVANHPSLLDAVL
FT                   VLARVPDTVCVMKAELMDNLLFGAAARLARFIRNDAPLRMILDAGEELDRGARLLIFPE
FT                   GTRTTAFPVDRCLPTAGLIARRSQVAVQTLLIEFSTPYLGKHWPLFRRPTLPLHCRIRL
FT                   GRRFNPPRDVAAFAAELESHFRAELQPPWPTTVASAAFPHARNAH"
FT   gene            410070..410828
FT                   /locus_tag="CAP2UW1_0342"
FT   CDS_pept        410070..410828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0342"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dar:Daro_4193 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33699"
FT                   /db_xref="GOA:C7RKA8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA8"
FT                   /protein_id="ACV33699.1"
FT                   /translation="MPVASSTHLVIIPSYNPGPQVVDTVRAARAQWTPVWVVVDGSTDG
FT                   SVASLQALAHDDDGLQVIVLPENRGKGSAVLEGISQARVAGFTHALTMDSDGQHPADLI
FT                   PAFMAASQNRPEAMVLGKPVFAADAPALRVNGRKVSNGWANLETLWMGIGDSLYGFRVY
FT                   PIAPLQRIMLANRWMRRFDFDPEAVVRLCWAGVPPLNRDAPVRYLRPDEGGVSHFRYLR
FT                   DNTLLTWMHTRLFLGFLLRLPWLLARKLGG"
FT   gene            410918..412117
FT                   /locus_tag="CAP2UW1_0343"
FT   CDS_pept        410918..412117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0343"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pol:Bpro_1412
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33700"
FT                   /db_xref="GOA:C7RKA9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKA9"
FT                   /protein_id="ACV33700.1"
FT                   /translation="MNTTEIFLIAMAIIFTLPWLIWRVGRTDYYAPLVVVQIVTGILLG
FT                   PGVLGRFSPDAYAFVFNPAVVQSLNGIAWWAVMLFVMIAGVELDLRQAWAHRRESSITA
FT                   GLALGTPLAFGCLAAGLMLLHDGWIGPRAMAWQFVLGIGMACAVTALPILILLMEKLAI
FT                   LRQPIGQRILRYASLDDIAIWGVLALILMDWGRVGRQLGFLVAFALLGYAFRALMRRLA
FT                   ERDRWYVALIWLTVCAFGADWSGLHFMVGAFLAGAIMDTEWFDQERMDLLRHHVLLVVM
FT                   PVFFLSTGLRTNWTLGGEAVFVAAGVLLGASVGGKLLGAHLAGRLLNWAPGEASIIGWL
FT                   LQTKALIMIIFANILLDKQVISSEAFTALLLMAVASTMLTVPVVGPKLQRLREIVLRSQ
FT                   "
FT   gene            412587..414650
FT                   /locus_tag="CAP2UW1_0344"
FT   CDS_pept        412587..414650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0344"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: aav:Aave_3359 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33701"
FT                   /db_xref="GOA:C7RKB0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB0"
FT                   /protein_id="ACV33701.1"
FT                   /translation="MLPLTVLRRFDAVLAPSKEAVLKRHAELSSKGIPNIDAILNYRAK
FT                   DEDGTALGFHNHSQLDFPELKGDPDNIGRHLADYIAGFSENIRKIFERFEFEKEIEKLE
FT                   ESNRLYQVVAQFAEIDLHPRKVDNITMGLVFEDLIRRFNEAANETAGDHFTPREVIQLM
FT                   VNLLLEPDTSVLTQAGVIVTICDPACGTGGMLAEAQNWIRAHNEQATVKVFGQDYNPRS
FT                   YAVAASDLLIKGHKDGQVMLGNTLTDDPFPEHRFDYLLANPPFGVDWKAERKVIDRWPN
FT                   FRGYSGKLPRINDGALLFLLYMMSKFQDYKSGDRDKPGSRTAIVFNGSPLFTGGAGSGE
FT                   SEIRRWIIERDQLEAIVALPEQMFYNTGIGTFIWVVTNRKAAHRKCKIQLIDARERYTP
FT                   MKRSLGDKRRYLDQTALDAVTREHGAMENSKTSRVFDNTDFGYRRITVLRPLRLRFEIT
FT                   DEARERFLNTCPDLFDALQAVQDELGNEPLLDWNQAWDTIQQVFRTLPDDVEGWAKGAK
FT                   GTAHKKIFRDCFTTVDPDAAPVIAKHHKVEPLNRAALFPGQALPADITKDELYALLGLH
FT                   KLPSPRARGAGAEGVCIEYEPDPALKDTESVPLKEDIVSYVLREVRPYVADAWIDRETL
FT                   DEQDGGIGKVGYEINFNRVFFQYQPPRPLREIDAELAEVEKRILGLLSEVTQ"
FT   gene            414647..416548
FT                   /locus_tag="CAP2UW1_0345"
FT   CDS_pept        414647..416548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0345"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: tbd:Tbd_2681
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33702"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB1"
FT                   /protein_id="ACV33702.1"
FT                   /translation="MTAQELLERLNLLDENERIEAKRADEIGKSLLETVCAFANEPGLG
FT                   GGWLLLGVTREELALFPAYEIQGLDHPDKISADLASQAAGIFNRPLRLDIQAEVLDGKT
FT                   VIAVFVPEAAPQDKPLYLKAQGLPRGAFRRIGSTDQHCTDDDLIALYQGRQHESFDAGL
FT                   VPDGTLDDFSPEALADYRQSRRDTNPDAEELRWSDEDLLQALGCVRLNEHGKWQPTVAG
FT                   LVLFGKPVALRRTFPMTRVDYIRVPGREWVPDPERRFDSLELRDPLFRLIRRVQAAILD
FT                   DLPKAFGLDEGDLQRTDSPIVPQRVIREAVVNALMHRSYRSHAPVQIIRYSNRLEIRNP
FT                   GFSLKSPDHLGEPGSLPRNPKLAAALYDTRFAETKGSGVRVMREMCEKAGLAPPLFESD
FT                   RGQDQFVVRLFFHHFLGPDDLAWLARFKNLHLSEAEARALVVAREVGAIDNAAWRDTNK
FT                   VDTLTASQSLKKLRDAGLLQQKGRGSATWYQPTGKMLGDDDSLSSNPDGLSSNPGALSS
FT                   NPGALSSNHLGLSSNPDPLADPARRALLNELSGELAAQVGAIGQRRPPEEVRDLVVALC
FT                   QHRDCRAEELALLLARNVETVRQNYLRPLLRAGRIRMTRPEVPNDPEQAYRVVEERP"
FT   gene            416545..416658
FT                   /locus_tag="CAP2UW1_0346"
FT   CDS_pept        416545..416658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33703"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB2"
FT                   /protein_id="ACV33703.1"
FT                   /translation="MMRSNIAAMPRVNRHEIDAELAGVEPRILELLGEVTE"
FT   gene            416658..417911
FT                   /locus_tag="CAP2UW1_0347"
FT   CDS_pept        416658..417911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0347"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="KEGG: aeh:Mlg_1791 restriction modification system
FT                   DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33704"
FT                   /db_xref="GOA:C7RKB3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB3"
FT                   /protein_id="ACV33704.1"
FT                   /translation="MLATLFSSRRLKYAATINDETLSESTDADFELAYIDIGNVDSQGR
FT                   FHDIVNHRFDDAPSRARRIVRDGDVIVSTVRTYLQAIASVENPPDNLIVSTGFAVVRPS
FT                   NELDHRFCKYALRASSFLWGVESRSTGVSYPAINASDLGDINVSLPELGAQRLIASYLD
FT                   RETARIDGLIAEKERMLALLEEKRAALISRVVTRGLDPNSPLKPSGQEWLGEIPAHWPT
FT                   TKFSWDVFISEGQVDPEDDRFLEMILVAPNHIESRTGEVTHTETSADQGAMSGKYFCKQ
FT                   GDVLYSKIRPALRKVVLAEDDCLCSADMYALRPSKRLMPEYLQYFLLSEDFSVWAELES
FT                   ARVAMPKINRETFSAIRIPVPPLEEQERIVLEIRDGAKRIDLQRKAVRGSVELLKERRA
FT                   ALITAAVSGQIPLEEMTG"
FT   gene            417908..418483
FT                   /locus_tag="CAP2UW1_0348"
FT   CDS_pept        417908..418483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33705"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB4"
FT                   /protein_id="ACV33705.1"
FT                   /translation="MTRTCWIIAGPNGAGKTTFALEYLPTVAGCAHFINADLIAAGLAP
FT                   LAPERELLAASRIFLRELETRIVAGESFAFETTLAGRAYLRMVDRLRRDGWRVDLIYLA
FT                   LPSAEMSKLRVAERVAHGGHAIPEADIERRFPRSLRHLLNDFSRRVDRCICFMNDGENP
FT                   ELVFEQCGDQRTILRADYYQLLLERAER"
FT   gene            418480..418665
FT                   /locus_tag="CAP2UW1_0349"
FT   CDS_pept        418480..418665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33706"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB5"
FT                   /protein_id="ACV33706.1"
FT                   /translation="MNAKQITTPSPEGQKQLDALRKSVANVLEKKRRLGQYAVTWENGK
FT                   PVVRGEDAPVVPARAR"
FT   gene            418717..424652
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0350"
FT   gene            419877..421403
FT                   /locus_tag="CAP2UW1_0351"
FT   CDS_pept        419877..421403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0351"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33707"
FT                   /db_xref="GOA:C7RIX3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX3"
FT                   /protein_id="ACV33707.1"
FT                   /translation="MYEIRQMIQRLRLGESNRAVARAQGVGRDTVARVRDIAAAQNWLE
FT                   ATSPLPDDATMARYYQTAGGGAVKNASHLSTVEPFRENVLEWHRQGIAVSSIRQALARR
FT                   YGYGGSVHAVYRFLRSEAAPAPVATVMLDFAVGEQAQVDFGSGPLITDRHSGEVFKTWF
FT                   FVMTLSWSRHQYAEVVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRACYYEP
FT                   TVQRAYAELALGYAFVIDPCPVADPAKKGRVESGVKYVKGNFMPLREFHSLAHANAQLE
FT                   AWIQGEAGNRLHGSTRERPLMRFNETEQALLQPLPAVAPTCPTWAKAKLHGNGHVQHAY
FT                   CHYSAPFRLIHQTLWLEITPDVVRLYHEHELVAIHPRLFKAGTRSTVADHLPPDAQAYF
FT                   MRDPQWCLTQATAVGPACRAVVESLFAKRVLDQLRAVQGLLRLADQFGRNRLDAACSRA
FT                   LNFGTPSYRTIKQILQTGLDQQPELIDAPTLEAPYLSGGHFRRQPSDLLH"
FT   gene            421459..422262
FT                   /locus_tag="CAP2UW1_0352"
FT   CDS_pept        421459..422262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0352"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:ebA3781 transposition helper
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33708"
FT                   /db_xref="GOA:C7RIX2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX2"
FT                   /protein_id="ACV33708.1"
FT                   /translation="MNPMLPLEPLLKQLRLSGILDSLEARNRQAIEAKLAYTDFLALLV
FT                   EDEVARRDQRQFAQRLRKAQVVGDKTLERFDCSHSPSVNHALIAELATCRFVLEQAPVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHAKLLAQLHAARATDSFERKLRQLARVD
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTTLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDRAYQIILDGETRRKPRPLPEVRSPVQATAGRDASKPPPAAR"
FT   gene            424801..426315
FT                   /locus_tag="CAP2UW1_0353"
FT   CDS_pept        424801..426315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0353"
FT                   /product="protein of unknown function DUF1214"
FT                   /note="PFAM: protein of unknown function DUF1214; protein
FT                   of unknown function DUF1254; KEGG: xau:Xaut_0423 protein of
FT                   unknown function DUF1214"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33709"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB8"
FT                   /protein_id="ACV33709.1"
FT                   /translation="MNEQPTSQRLRRVSIGLTVLSLVLLGACGKQVEPQVDRVAAEAKA
FT                   KLEAEAKAVEAAAKEAEARVIAIESYVYAYPLVTMEMTRRIMTNVEAPQGSRAPMGHFV
FT                   RMRSYPDASYRDVTAPNADTLYTTTWIDVSKEPWILSLPDMKDRYFLFPMLDGWTNVFQ
FT                   VPGKRTTGTKAQTYAITGPGWSGELPAGVTEYKAPTGLVWVLGRIYSTGTPEDYKAVHT
FT                   LQDKISVVPLSAYGKPYSPPPGTVDPAIDMKTAVREQVNALDATAYFKLFAELLKTNPA
FT                   AADDAPMLAKLSKIGIVPGQDFDVAKLDPAVAKGLAGAPKPAQDLIMDWMKAGIVAGDM
FT                   KLENGWLFTTKTGLYGTNYLQRALVTAIGLGANRPEDAVYPTSTGPDIAAKYNGEKKYV
FT                   LRFEKGQLPPVNGFWSLTMYDADYFFVDNKLNRYTLSQRNKLKANADGSVDLYIQNESP
FT                   GKSKESNWLPAPTGDFILMMRLYWPKEQAPSILDGSWKVPEVKEAS"
FT   gene            426422..426631
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0354"
FT   gene            426848..427117
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0355"
FT   gene            complement(427127..427717)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0356"
FT   gene            complement(427724..428017)
FT                   /locus_tag="CAP2UW1_0357"
FT   CDS_pept        complement(427724..428017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0357"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   smr:Smar_0994 MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33710"
FT                   /db_xref="GOA:C7RKB9"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKB9"
FT                   /protein_id="ACV33710.1"
FT                   /translation="MTISDSPPDSLSHLQTWVGQRYSTVDQARGPEKTFLFFVEEVGEL
FT                   ATALSRRNAENIEEEIGDVLMWLVSLANLTGTDLRDCVAAYLRRNSGTKPKV"
FT   gene            complement(428014..428523)
FT                   /locus_tag="CAP2UW1_0358"
FT   CDS_pept        complement(428014..428523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC0"
FT                   /protein_id="ACV33711.1"
FT                   /translation="MKFGGFLNLKSDRLLVIANFAFPSRYSEQDRIWSEIEAVHRCLRP
FT                   GGKLITIGWDETFNDELNEMWYRFVPDGITARNFEEWRQSRAAGFHSARNSQLTWFRRR
FT                   LRVNLQFPSVDSAARVMGYLFGRSAIWDVLHKHKTTWTMSLGITVDTREQLKTILDKRS
FT                   EKDLGK"
FT   gene            complement(428592..429950)
FT                   /locus_tag="CAP2UW1_0359"
FT   CDS_pept        complement(428592..429950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0359"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p2A146 probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33712"
FT                   /db_xref="GOA:C7RKC1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC1"
FT                   /protein_id="ACV33712.1"
FT                   /translation="MSHFIVTDRKTDYLLPPSLDDWLNQDHLARFIVEVVDQLDLSKLT
FT                   RQYAGRGSKAYHPATLLAILVYGYATGIFSSRRLERATYDSVAFRYIAAGSHPDHDSLA
FT                   TFRRRFLDELSDLFLQVLAMAKEMKLLKLGNVCLDGTKIDANASRHSALSHGHIEKLEA
FT                   QLKAEVQELFSLAEQADQADVPDGVSLPEEIKRREDRLAAMAVAKAKIAARAEERYQRE
FT                   KADYDEKMARRAAKEEAAGKKLGGKPPKAPEPGARDSDQINLTDEESRIMPVAGGGFEQ
FT                   AYNAQAGVDAATMLVVAVGVTQAPNDKEQVEPMLATLKAQAEVLGPVESLIADSGFCSE
FT                   KNIKACEAASIDPVIAVARDEHHPDWRERHSEPAPLPENATPVQALSHRLKTKAGRALY
FT                   ALRKQTVEPVFGIIKSVMGFRQFSLRGLKKVTGEWTLVCLAWNLKRMAKLRPQ"
FT   gene            complement(429922..431391)
FT                   /locus_tag="CAP2UW1_0360"
FT   CDS_pept        complement(429922..431391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA4317 phycocyanin alpha phycocyanobilin
FT                   lyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33713"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC2"
FT                   /protein_id="ACV33713.1"
FT                   /translation="MTAVAYGQMVAELVAGQVTSLMDHALSEAVLRRLARELDACSAFK
FT                   TTIPHLLSQFARNVPRTYDWNCGSLLQHAPAEPLFSSIPADGALRTRLRESIGLTWCLG
FT                   QFLLRDQRIIDFLEETVALADNPQSWWRAAFSLERIGLVEAVSYLKAALKYQGVPDLDL
FT                   CLNSLGNEKSRIGILLQSDSRNLEKAIIPRLRAVVGSRSSISGTKEDLLAAVWLLARLN
FT                   HHDQHIRAALKRLARDQDYEIQFYSLHAISRLGSPHFVDDLLEFLRHDTPHLRVIAAEG
FT                   LGRIDLPRSAEGLRQRLRLEINDEVVGTITESLYALTNYYSRQNSFIARTVGASENGMI
FT                   VDKGDKWYGNPSIYHEFSACQDPENVCFGLLQHLLEGAEIVNPIDLGSGTGRLAWYFLE
FT                   HFAFEGQMFCLDVSEEMCRFLNQRATRECIGSDRIVIRQGAIEAAASVVGEQSSSLAAC
FT                   RTFGLLPTGYAIIMPFEATEGRHVPLHRHRP"
FT   gene            complement(431388..432041)
FT                   /locus_tag="CAP2UW1_0361"
FT   CDS_pept        complement(431388..432041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33714"
FT                   /db_xref="GOA:C7RKC3"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC3"
FT                   /protein_id="ACV33714.1"
FT                   /translation="MKQLLATILLGAGNVVAITLLKHLESRQVESLLAVIASACVGIIL
FT                   TKAGEYLLLELPLRFRPLRRLLDPRAALEGRWLEHIPGLPGNPYTVLTISYNAESKSYC
FT                   MHGRNYDINRNELRTFDSQHVSISSSLNQVLYTYTAHQSLENQSDAAGVCCMDFRSSNS
FT                   GKLDSGQGFFFNRDPQATKFSFSFKRVAGRDAESDQSIIDRMTPAPALPIAVHQ"
FT   sig_peptide     complement(431988..432041)
FT                   /locus_tag="CAP2UW1_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.774 at
FT                   residue 18"
FT   gene            complement(432901..433905)
FT                   /locus_tag="CAP2UW1_0362"
FT   CDS_pept        complement(432901..433905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0362"
FT                   /product="ATP-dependent DNA helicase, UvrD/REP family"
FT                   /note="KEGG: mca:MCA0474 ATP-dependent DNA helicase,
FT                   UvrD/REP family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33715"
FT                   /db_xref="GOA:C7RKC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC4"
FT                   /protein_id="ACV33715.1"
FT                   /translation="MSMIAPARKAPGNWRSLDPLRSYCELRGMPVQQADEDRSGFWTLR
FT                   ETQAMIGWLRTRDSALIDVPTIRQWLALQPEGRPDAHWWSYLREAVAEYALDAGDAELP
FT                   LDHFLDWLAEWGREARRRQTGLLLLTAHRAKGLEFDHVAVLDGDWLRSGANEDADATRR
FT                   LYYVAMTRARKTLALARFDRGQAWLDALPGGPSDSPAFLRRRATPLPTPPPELARRHRR
FT                   LGWRQIDLDFAARHPPGHAIHRALAALTAGSRIALRQTSAGAWRLCDAQGVDVGALSQH
FT                   FEPETHMHGIEARVAAIHVRRPRDVAEAYRSRISAQCESWEMVVPELVYAPGS"
FT   gene            433929..435338
FT                   /locus_tag="CAP2UW1_0363"
FT   CDS_pept        433929..435338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0363"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: vei:Veis_4167 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33716"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC5"
FT                   /protein_id="ACV33716.1"
FT                   /translation="MDLLRHHVLLVVMPVFFLSTGLRTNWTLGGEAVFVAAGILLGVSV
FT                   SGKLLGAHLAGRLPNWAPGEASIIGWLLQTKALSMIIVANCVSSAPTTCPMAQSYVLRA
FT                   SWACVEMGVIGCNIVGMIASHAVQITPEILSLIAGIDEFKGAWRALGTLAPDRLAALRR
FT                   VATIESIGSSTRIEGSRLSDREVQRLLSNLQIKSFATRDEQEVAGYAEVMELVFSSWQD
FT                   IALTENHIKQLHRDLLTYSEKDAWHRGNYKTTANSVVAFAEDGKQLGVVFATATPFDTP
FT                   SLMAELITWFNAERQAGQLHPLLLIGIWIVIFLEIHPFQDGNGRLSRVLTTLLLLQAGY
FT                   AYVPYSSLESVVEQSKEAYYLALRQTQGTIRTTSPNWQPWLTFFLRTLAEQVRRLNRKV
FT                   EREKLVLASLPELSLQIVEFAREHGRITMGDAIRLTGGNRNTLKQHFRALVEQGRLGQH
FT                   GAGRGVWYELR"
FT   gene            complement(435477..440702)
FT                   /locus_tag="CAP2UW1_0364"
FT   CDS_pept        complement(435477..440702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0364"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="KEGG: mca:MCA0474 ATP-dependent DNA helicase,
FT                   UvrD/REP family; TIGRFAM: ATP-dependent DNA helicase, RecQ
FT                   family; PFAM: UvrD/REP helicase; helicase domain protein;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33717"
FT                   /db_xref="GOA:C7RKC6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC6"
FT                   /protein_id="ACV33717.1"
FT                   /translation="MLQRKRRLTLPMSSFAPRCLSIDLEVGLRDGRIHRFAAVRGDQPE
FT                   TSLRFRQGNLLAALEQLDALAEGASFLLGHNLIAFDLPHLAAAKPDLRLLQLPVVDTLW
FT                   LNPLAFPRNPYHHLVKHYQDGQLQRGRLNDPLLDAQLTLEVFRDQHTALAEASPSRVLA
FT                   WHWLTTVPSRKSGLDRFFMSLRHKARPSDDEALAAIRQQLAGQVCETRLGDVLADAASQ
FT                   GWALAYALAWLSVAGGNSVMPPWVRHQFPQAGILIKRLRDTACANPACQWCRERHDARK
FT                   ELARWFGFAEFRAEPADDEGRPLQQSIVEAAIRGEHVLGILPTGTGKSLCYQIPALSRF
FT                   DKTGALTVVISPLVALMADQVAGLEARNIRSCAALNGLLSMPERADVLDRLRLGDIGIL
FT                   IVSPEQLRNHTLRKVLAQREIGAWVLDEAHCLSKWGQDFRPDYRYVGRFIREKAGNQPI
FT                   PPVLCLTATAKPAVMADILDHFRDKVGIELRCFNGGASRANLDFCVVPTSPAEKFSHIH
FT                   QILEADLPPELPGGAIVYCATRRQTEEISRFLQQKGWAVDHYHARLPPETKKNTQKAFI
FT                   EGDLRVIVATNAFGMGIDKPDVRLVIHADIPGSLENYLQEAGRAGRDSQSARCVLLYTV
FT                   EDVERQFGMSARSRLSRKEIQAILHSLRNLERKKRREGGKEGGKSSDLIATAGEILAED
FT                   EDGAFERDSATDDTRVRTAVSWLEEAALLTREENRVQVFPSSLRVASLDEARKKIERRV
FT                   IAPEYRKGLLAIVGALIGAPVDEGISTDELMLVSGLSPEKVRAAFYDLEALGLASNDTA
FT                   LTAYLHVGVERSSKKRFAQAAALESALIGLLREQHPDLSRGESSILHLRYANQHLKDAG
FT                   HADALPERLRQLLSSLAADGRDEEGGQGSMKLRRVDVESLGIELQREWSAVEATARRRR
FT                   AAAGCLLDHLLACLPAGARGNDQLAETTLGKLLAALEADLLLKAERTITPKLLDRALLW
FT                   LHEQEIIRLNKGLAVFRPAMTIRLEPDWKRKFMPGDFAPLQLHYDEQVVQIHVMAEYVQ
FT                   RGLEAMAEALHLTMDYFSLQRDEFMRRWLPDRDKELARQTTPQSWHDIVEVLNNRQQRE
FT                   IVADERESTNVLVLAGPGSGKTRVLVHRIAYLIRVRRENPHGILALAYNRHAAVQIRQR
FT                   LGELIGDDARGVAVLTLHALAMRLAGASLATQNGGTDGDLFKDIIDQAVNLLKGKDLPP
FT                   EEADQQRERLLVGFRWILVDEYQDIAPEQYELISALAGRTRPDEDGRINLFAVGDDDQN
FT                   IYAFKGASVEFIRRFEADYAAKPSFLTDNYRSTANIIEAANRLIAPAANRMKQAHPIHI
FT                   DAARKAQAAGGEWTSIDPVGRGRVQILPAGDNERTQALAVITEFERMAQLAPAWDWARC
FT                   AIIARNWRSLDPVRSYCELQGIPVQQADEDSSGFWSLRETQSMIDGLRTRGSALIDVPT
FT                   IQQWLAMQPEGRPDAHWWSYLREAVSEYALDAGDAELPLDHFVDWLAEWGREARRRQTG
FT                   LLLLTAHRAKGLEFDHVAVLDGDWLRSGANEDADATRRLYYVAMTRARKTLALARFDRG
FT                   QAWLDALVGGPADSSSHSSSHSLFDSPAFLRRHATPLPVPPPELARRHRRLGWRQIDLD
FT                   FAARHPPGHAIHRALAALTAGSRIALRQTSAGAWRLCDAQGVDVGALSQHFEPEADMHC
FT                   IEARVAAIHVRRPRDVAEAYQSRINAQSESWEMVVPELVYAPDS"
FT   gene            complement(440725..441444)
FT                   /locus_tag="CAP2UW1_0365"
FT   CDS_pept        complement(440725..441444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0365"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: dar:Daro_4188 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33718"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC7"
FT                   /protein_id="ACV33718.1"
FT                   /translation="MKRALVTGGSGGIGAAICRRLAADGCHVIVHGNRGRDKAAAVVGE
FT                   ILAGGGSAEAIIFDVTEREPTATALAEFLAAGPIQILVNNAGIHADAVFPGMSGEQWDS
FT                   VIDVSLNGFFNVTRPLILPMIRTRWGRIVTVSSIAAITGNRGQVNYSAAKGALHAASKS
FT                   LALEVASRGITVNAVAPGIIATGMVDGAFDPATIKALVPMQRAGRPEEVADLVGFLASD
FT                   QAAYISGQVISINGALI"
FT   sig_peptide     complement(441376..441444)
FT                   /locus_tag="CAP2UW1_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.536 at
FT                   residue 23"
FT   gene            complement(441441..441893)
FT                   /locus_tag="CAP2UW1_0366"
FT   CDS_pept        complement(441441..441893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33719"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC8"
FT                   /protein_id="ACV33719.1"
FT                   /translation="MLDRRWIAEHVPHHGAMCLLEAVVDWSATTISCRATSHTDPANPL
FT                   RAEDRLGAASGIEYAAQAMAVHGALLADAGGRPRQGYLTSLRGVTLHVVRLDDLPGDLS
FT                   IQAECLSGDGTNVLYHFSVSHAGHCLVDGRAAVVLDAAAANVQGRQ"
FT   gene            complement(441887..442690)
FT                   /locus_tag="CAP2UW1_0367"
FT   CDS_pept        complement(441887..442690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33720"
FT                   /db_xref="GOA:C7RKC9"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKC9"
FT                   /protein_id="ACV33720.1"
FT                   /translation="MRPPPLSVCIEGVGFLAPGLPDWPTASAVLRGEQAYAAAPSLLPV
FT                   PSLLPAAERRRASRVVKLALALGLEAVAHAEADVGTLATVFTASGADGHNCHALCEQLA
FT                   TDDRRISPTRFHNSVHNAAAGYWGIATGAMAPCQVLCAFDASFGAGLLDALAQVVVDQR
FT                   TTLLIAYDSEYPEPLHRKRPVSDCAGVALLLAPVQSVRSLARIAVTPSSDAAARLADGE
FT                   LEGLRTTIPALRSLPLLQMLARREGGSVCLDYLPPMQLRVEVVPC"
FT   gene            complement(442687..443880)
FT                   /locus_tag="CAP2UW1_0368"
FT   CDS_pept        complement(442687..443880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0368"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: dar:Daro_4185
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33721"
FT                   /db_xref="GOA:C7RKD0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD0"
FT                   /protein_id="ACV33721.1"
FT                   /translation="MTPLLVSACTLTTCLGRGLAVTLAKLRDGSSGLVPCAFETVELDT
FT                   WIGEVAGVDEQRLPPTLAHYDCRNNRLAQLALTADGFTERLLAARDRYGRDRVGIFLGT
FT                   STAGILQAELAYRRRDPHSGALPDDFSYCGTHNPFSLAAFARELFALAGPAVAVSTACS
FT                   SGAKTFAAAARQIACGTIDAALVGGVDSLCLTTLYGFASLELTSSDPCRPYDVARNGIS
FT                   IAEGAAFALLERAPAEATPGAILLLGCGESSDAYHMSSPHPHGLGARMAMAAALDSAGL
FT                   APADIDYINLHGTATPSNDAAEGKAVAALFGDGVACSSTKGATGHTLGAAGAVEAVICA
FT                   LVLTHGLLPGSPHTLTPDPAIPLDYQLRARAGRLRRVLSNSFGFGGSNCSLVFGLTP"
FT   sig_peptide     complement(443818..443880)
FT                   /locus_tag="CAP2UW1_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.720 at
FT                   residue 21"
FT   gene            complement(443966..444703)
FT                   /locus_tag="CAP2UW1_0369"
FT   CDS_pept        complement(443966..444703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0369"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: dar:Daro_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33722"
FT                   /db_xref="GOA:C7RKD1"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD1"
FT                   /protein_id="ACV33722.1"
FT                   /translation="MTTPFLPTLLDDASRPFRASGHFAYHYARGKLSSDCIFRELLKRG
FT                   VFPAEARFLDLGCGQGSLFSWLLAARALYEKGVWPGDWAAAPKPLSLRGYELMARDVER
FT                   AALAFGRPHPIVDIRQGDMRAVDFGAADVVTILDALHYLPHADQDAVIDRIRKALPSGG
FT                   LFLTRVGDAGAGLPYHICNWVDHAVTFARGHRLPRLFGRKLTEWVGLLESLGFVVHSEP
FT                   MSDGKPFANTMLVCRVPATSPCR"
FT   gene            complement(444700..445500)
FT                   /locus_tag="CAP2UW1_0370"
FT   CDS_pept        complement(444700..445500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0370"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   dar:Daro_4179 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33723"
FT                   /db_xref="GOA:C7RKD2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD2"
FT                   /protein_id="ACV33723.1"
FT                   /translation="MPQRWKPSPTIQMSFAVHGAASLAVLATPGHWPWALGALAANHLV
FT                   LTAAGLLPRSTLLGANLNRLPAAAKARREIALTIDDGPDPEVTPRVLDLLDSAGTKASF
FT                   FCIGSRARRSPALCREIIARGHRIENHGDSHSRAFATFGLRRIRADIAAAQHTLTDITG
FT                   QAPRFFRPTAGLRNPLLDPVLARLDLQLASWTRRPFDGREGDPQRVYRRLTSGLDAGDI
FT                   LLMHDGYAARTPTGEAVILAVLPRLLHTIAAHRLNPVTLTTALT"
FT   sig_peptide     complement(445378..445500)
FT                   /locus_tag="CAP2UW1_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.551 at
FT                   residue 41"
FT   gene            complement(445506..446153)
FT                   /locus_tag="CAP2UW1_0371"
FT   CDS_pept        complement(445506..446153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33724"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD3"
FT                   /protein_id="ACV33724.1"
FT                   /translation="MSPRLPTVGRTSGAPALLVLLPGAYMSAADFVNAGFFTAVTRRRL
FT                   PLDLLAVDLDLSLISSGEALPALQENVLAPARAAGCRHIWLGGISLGGLLALCHCADAP
FT                   GSIDGLCLLAPYPGSRLTARAIAQGGGLANWQPSAEELADPEFRMWRWLQKPPPDFPVF
FT                   VGYGAEDRFAAGMRRIADCFPPAASQVVPGGHEWPVWQILWNNFLDRRLLPV"
FT   sig_peptide     complement(446070..446153)
FT                   /locus_tag="CAP2UW1_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.663 at
FT                   residue 28"
FT   gene            complement(446150..448519)
FT                   /locus_tag="CAP2UW1_0372"
FT   CDS_pept        complement(446150..448519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0372"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: dar:Daro_4177 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33725"
FT                   /db_xref="GOA:C7RKD4"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD4"
FT                   /protein_id="ACV33725.1"
FT                   /translation="MTAAARRTFLLWLLAMLAGAAIVWNSRFSADMSFFLPAHPSAEQQ
FT                   VLVDQLREGSVTRLLMLAISGGDAQQRAALSRELRARLADGPELATLRNGDQHSLDADR
FT                   EYLFRHRYLLSPAVTPERFTVDGLRSAIAESIDVLASPAGLLVKRLLPQDPTGELLGLL
FT                   AGLDAGAQPNSRAGVWASRDGERALLLAQTTALGSDTDGQAAAIDAIREAFAAARAAAG
FT                   VSGANAVTGFADASLQIAGPGVFAVHARTTIKEEVARLSMISTLGIVTVLFFAYRSLTL
FT                   ISLGLLPVVSGALAGIVAVSLAFGTVFGITVGFGSALIGEAVDYSIYYFVQSERGDAAA
FT                   WRSRFWPTIRLGVMTSICGFGVLLGSGFPGLAQLGLYSLTGLLTAAAVTRFVLPQLVPA
FT                   NTPQRELGGLGEAFLRLTGRLERLRWPLVLLASAAATLLVVDRDELWNRELSALSTATA
FT                   EDLATDAALRADAGAPDARLLIVVTAADRELALQAAERAGAQLDGLVTAGVIGGYDTPA
FT                   RFLPSEATQEARRASLPTAAELRQSLPLALADSPLAASKLEPFLRDVEAARTAPTLGPE
FT                   ALRGTSLALAVDTLLLPRPAGWSVLLPVRPPPGEGLRTLDADTLRSALAGSGALFIDMK
FT                   SELDALYAHYLNEAKLLALAGLAAIVGLLAVALRSPGRVLTVVAPLLLAVLVVTASLHL
FT                   AGQRLQLLHLIGMLLIVAIGSNYALFFERLGSQLQHEPRAVASLLVACLTTAIGFGTLA
FT                   TSQVPVLQALGITVGPGAVLALFFSACFAASPSPRP"
FT   sig_peptide     complement(448430..448519)
FT                   /locus_tag="CAP2UW1_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.524 at
FT                   residue 30"
FT   gene            complement(448516..449082)
FT                   /locus_tag="CAP2UW1_0373"
FT   CDS_pept        complement(448516..449082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33726"
FT                   /db_xref="GOA:C7RKD5"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD5"
FT                   /protein_id="ACV33726.1"
FT                   /translation="MKRLLVGLLLSVLAIPVLAAWDLAQLMDDLARTRGGKARFVETKY
FT                   IALLDRPVVSSGEMSFTSPDRLEKRTLTPRPETLLLDRDRLTIERGRQKLSIDLTNQPE
FT                   ALAFVDSIRGALTGNRQALEKNYALHLAGSRDNWKLTLLPSEQAIAAIVQRITITGQRN
FT                   RIRGIEYLQADGDRAVMTIEALSEQ"
FT   sig_peptide     complement(449023..449082)
FT                   /locus_tag="CAP2UW1_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 20"
FT   gene            complement(449079..449993)
FT                   /locus_tag="CAP2UW1_0374"
FT   CDS_pept        complement(449079..449993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0374"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   dar:Daro_4175 putative lauroyl/myristoyl acyltransferase
FT                   involved in LPS biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33727"
FT                   /db_xref="GOA:C7RKD6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD6"
FT                   /protein_id="ACV33727.1"
FT                   /translation="MSSGEQATSGWRHQQERSNLAILRLMVWISLTLGRRIGRLVLYGI
FT                   ALYFLFFSPQARRASRAYLGRALGRWAEWSDGYRHVLSFASTIHDRVYLLNGRFDLFDI
FT                   EVHGAEALHAALARQPGALLIGAHLGSFEVLRAVGRGRAGLKVAMLMYEDNARKINATL
FT                   EAINPAAGEDIIALGRLESMLEARDKLDSGYLVGLLADRGLADEATREHAFLGQPASFP
FT                   IGPFRIAAMLRRPVFFMTGLYLGGNRYRIHFEPLADFSRVEPGARDAAIVQAQAQYVAR
FT                   LEHYCRLAPYNWFNFFDFWQKVR"
FT   gene            complement(449990..450292)
FT                   /locus_tag="CAP2UW1_0375"
FT   CDS_pept        complement(449990..450292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33728"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD7"
FT                   /protein_id="ACV33728.1"
FT                   /translation="MRRVDFEWRVPADHPAFAGHFPGRPIVPGVVLLDRALLCAEALLG
FT                   TPAIVWQIAHSKFFSPVGPGETLVFQLQAAAGGSIAFSVRGGGREVAAGSLKPGR"
FT   gene            complement(450279..451634)
FT                   /locus_tag="CAP2UW1_0376"
FT   CDS_pept        complement(450279..451634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0376"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="KEGG: dar:Daro_4173 AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33729"
FT                   /db_xref="GOA:C7RKD8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD8"
FT                   /protein_id="ACV33729.1"
FT                   /translation="MSRVPLLGHASLDDIFAYLPAGPTTVRRFLATASALAKRLPAGRH
FT                   FLNLCQDRYRFSVGLAAGLLDGRTSLQPASQSVETLRQIQRQHADVFCLCDGAFDSLDL
FT                   PRVDFPDLSALGLEAVAGIPDIPGELVAVTVYTSGSTGLPMAHDKSWGALVRNARAEAS
FT                   RLGLLDGARHTIVGTVPAQHMYGFESTVLLAMHGNSPFWSGKPFYPQDIVCALQAVPRP
FT                   RLLVTTPFHLGTLLAADVELPTLDRLLSATAPLSRELAAAAEARLAAPLEEIYGCTESG
FT                   QLASRRLLMDAAWLPLDGVCLERDGDRIIASGGHIEGRVPLADALELLPDGRFMLLGRN
FT                   TDLISIAGKRSSLAYLDHQIRAIPGVVDGAFFQPDEASPQAIVRLCAFAVAPELSERQL
FT                   LARLRQRVDAVFLPRPLFRVESLPRNNTGKLPRAKLQALYESLRQKPRHAPR"
FT   gene            complement(451631..452302)
FT                   /locus_tag="CAP2UW1_0377"
FT   CDS_pept        complement(451631..452302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4172 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33730"
FT                   /db_xref="GOA:C7RKD9"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKD9"
FT                   /protein_id="ACV33730.1"
FT                   /translation="MTGITPATLLRGIAAAGLVIAWGWLAHAASSGEGDSNLAVAVASA
FT                   PLLAIVVILLWRVGRKWWLIAGALAVVGTLAWHWQALRHNVALLYCLQHVGTNLALGLL
FT                   FGRSLFGPGESLVTRFARLAHHGVLSHAQLRYTRQVTIAWTAFFGATAAVSTTLFLFAP
FT                   PAVWSIFANLLTIPLLGLMFAAEYLVRQRVLPPAECAGIADSVRGYRETMRQRGSRASN
FT                   R"
FT   sig_peptide     complement(452216..452302)
FT                   /locus_tag="CAP2UW1_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.806 at
FT                   residue 29"
FT   gene            complement(452299..452583)
FT                   /locus_tag="CAP2UW1_0378"
FT   CDS_pept        complement(452299..452583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0378"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: dar:Daro_4171 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33731"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE0"
FT                   /protein_id="ACV33731.1"
FT                   /translation="MSQDTSPLADDVLLAEVAELIVSALNLDLNPSEIEPDAPLFGEGL
FT                   GLDSIDVLEIALVVSKRYGFQLRSDNDDNLRIFSSLRNLAAYIARQRTK"
FT   gene            complement(452602..453855)
FT                   /locus_tag="CAP2UW1_0379"
FT   CDS_pept        complement(452602..453855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0379"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: dar:Daro_4170
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33732"
FT                   /db_xref="GOA:C7RKE1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE1"
FT                   /protein_id="ACV33732.1"
FT                   /translation="MNRCRVAITGLGLVSPFGNSLADFFQRLLNGESAVRLLRLDDPPR
FT                   ALAIPFVSCPGFAAETVLGKALAGTMDRFAQLGTAAAFAAWDDAGLGRRPGAENRERWG
FT                   VTWGTALGGTLAYEKGYRELWQKGRERISPLSVILGMNNAANAHISIQLALGGVSMSYT
FT                   VACASSSIAIGEAFRRVRSGEAPIMLTGGSDVPQAYGVARAWEALRVLASGDETTSATA
FT                   CRPFSADRSGLVLGEGGAALVLEDWEHATARGARIHGEMLGYGTTCDHAHLVRPEVDGQ
FT                   MRALRATLVDAALNPDDVDYINAHGTATVEGDPVEVDAIRAIFGSGRKKPALSGTKSMH
FT                   GHLLGAAGAMEAIVTILALREQALPPTAHLDRIDPACAGVDHVTSARCGGSLRTALSNS
FT                   FAFGGSNAVLAFRTAASG"
FT   sig_peptide     complement(453787..453855)
FT                   /locus_tag="CAP2UW1_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.933 at
FT                   residue 23"
FT   gene            complement(453859..454098)
FT                   /locus_tag="CAP2UW1_0380"
FT   CDS_pept        complement(453859..454098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0380"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   dar:Daro_4169 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33733"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE2"
FT                   /protein_id="ACV33733.1"
FT                   /translation="MDSLSLIREFLQGRLGVEPEKIVPGAFLDELGVDSLMVLELMFEF
FT                   EDRFGVTLAKDLKTPRTIGEMASLMDRLRSEEQS"
FT   gene            454285..455823
FT                   /locus_tag="CAP2UW1_0381"
FT   CDS_pept        454285..455823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0381"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: azo:azo2191
FT                   probable virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33734"
FT                   /db_xref="GOA:C7RKE3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE3"
FT                   /protein_id="ACV33734.1"
FT                   /translation="MNLLRSLATVSSMTLLSRILGFVRDFVIARTFGAGMLTDAFFVAF
FT                   KLPNLLRRLFAEGAFSQAFVPVLGEYRNKRGPEETRQLVDRVASLLFLVVLAVTLLGMA
FT                   AAPVLVYVSAPGFADEAEKFALTVSLTRITFPYILFMSLVALAGGVLNTWSRFAVPAFT
FT                   PVLLNVSFILMALFAAPLFDPPIIALGWAVFLGGALQLAFQVPSLRRLGMLPKFSIDLR
FT                   DEGVRRIFRLMAPALLGVSVAQVSLLLNTIFASFLSTGSVSWLYYADRLMEFPAGLLGA
FT                   ALGTILLPSLSRCHATGRADEYSRLLDWGLRLTFLLAAPAALALALLAVPLITTLFHHG
FT                   AFTATDVFRTRDALVAYSLGLLGLILVKVLAPGFYARQNIRTPVRIALLTLFVTQMLNL
FT                   ILIRWFEHAGLALSIGLASILNASLLYRGLRQRAIYVPQPGWLLFYARLGLAMLSMGAA
FT                   LWFVTGEAAEWLAGGLTQRLLRLSLVVAFGASVYFATLWVAGFRLHDFKRSAAE"
FT   gene            455843..456472
FT                   /locus_tag="CAP2UW1_0382"
FT   CDS_pept        455843..456472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0382"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: dar:Daro_0707
FT                   phospholipid-binding protein, PBP family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33735"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE4"
FT                   /protein_id="ACV33735.1"
FT                   /translation="MKVTSNSFKDGQPIPGDFAFCLADPEHHVCLGRNLNPHLAWSDAP
FT                   PGTHSFVIICHDPDVPSKGDDVNQEDRTVPASLPRVDFFHWVLVDLPASLGEISEGEFS
FT                   SDVTPRGKPGPHAPHDARQGINDYTGWFDSDNDMRGDYYGYDGPCPPWNDEIVHHYVFT
FT                   VFALDVGRLDVDGKLTGPQVRAAIQGHILAQASLTGTYTLNPSLKP"
FT   gene            456948..457691
FT                   /locus_tag="CAP2UW1_0383"
FT   CDS_pept        456948..457691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:788954 hypothetical protein LOC788954"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33736"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE5"
FT                   /protein_id="ACV33736.1"
FT                   /translation="MAASSLAIDVVSRRNRPVRTGTVKSRSMGSAPRQLWIRASLWSCP
FT                   QPLQPVREIAWTGPAGWLSMTLQQAARRARREPLTSGMTAPVLRESAAGQTAREGSRSP
FT                   RRGQGSRPGPLGRTRNTNAAPIRFPASTRRPYLGPADRPIGPGKRPTGTVLSRRAMAAH
FT                   PDEAPRFLSSKRPQSHQGRSSDVRENRWLTCPERVPVTVRRVVADSPLDFRSPSKATGR
FT                   CCGPFAFLRRQRRSRRCRAETSIAR"
FT   gene            complement(457678..460098)
FT                   /locus_tag="CAP2UW1_0384"
FT   CDS_pept        complement(457678..460098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0384"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: dar:Daro_3203 membrane-bound
FT                   proton-translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase; OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33737"
FT                   /db_xref="GOA:C7RKE6"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE6"
FT                   /protein_id="ACV33737.1"
FT                   /translation="MSSFLVFALVCAVIAVLYGAAMTKWILSLPAGNPRMQEIAKAIQE
FT                   GASAYLAKQYTTIALVGAVLFVLIWFALGKLMAFGFLIGAVLSGATGFIGMNVSVRANV
FT                   RTAEAARNGIGAALNVAFKGGAITGMLVVGLGLLGVAGYYAFLKGSGADFQHSVEPLVG
FT                   LAFGGSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDC
FT                   AGMAADLFETYAVTVVATMVLSAMMLKGVAGANDNLIVYPLVLGGVSIIASIVGCFFVK
FT                   SNDGGKIMNALYRGLAVAGVLALIAFYPVTTMLLGNGVTLADGSLISSMSIFWAAAIGL
FT                   ILTGLLVWITEYYTGTDFAPVKRVAEASTTGHGTNIIAGLAVSMKACALPVLCVCAAIY
FT                   ITYALAGLYGIAIAATSMLSMTGIIVALDAYGPITDNAGGIAEMSGLPKSVRDVTDPLD
FT                   AVGNTTKAVTKGYAIGSAGLAALVLFADYTHALEVNFGGGLRFDLSDHMVIIGLFLGGL
FT                   IPYLFAAMAMEAVGRAAGAVVVEVRRQFKEIKGIMEGKAKPDYSRAVGMLTIAAIREMI
FT                   IPSLLPVLVPVLVGLLLGPKALGGLLMGTIITGLFVAISMTTGGGAWDNAKKYIEDGHF
FT                   GGKGSDAHKASVTGDTVGDPYKDTAGPAVNPLIKIINIVALMIVPLMVPASTAKPVAAM
FT                   PAATVAIAVVPVAKVYFATGSAELPADATKTLEVIVVHAKANPGAKLAISGFHDPSGSQ
FT                   AVNEEVAKNRAKAVRDSLKNVGIAEERIELRKPEVTTGGGDPAEARRVEVSVQ"
FT   sig_peptide     complement(460027..460098)
FT                   /locus_tag="CAP2UW1_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.506 at
FT                   residue 24"
FT   gene            complement(460383..461036)
FT                   /locus_tag="CAP2UW1_0385"
FT   CDS_pept        complement(460383..461036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0385"
FT                   /product="Nucleoside-triphosphate--adenylate kinase"
FT                   /EC_number="2.7.4.10"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein; KEGG: azo:azo1473 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33738"
FT                   /db_xref="GOA:C7RKE7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE7"
FT                   /protein_id="ACV33738.1"
FT                   /translation="MKLILLGAPGAGKGTQAQFIRERFGIPQISTGDMLRAAVKAGTPL
FT                   GVAAKKVMDAGGLVSDEIIIGLVSDRLRQDDCQSGYLFDGFPRTLPQAEAMKAAGVALD
FT                   YVLEIDVADSEIIERMSGRRVHPASGRTYHIRFNPPKAAGKDDVTGEDLIQRDDDQEET
FT                   VRKRLQVYHSQTKPLLEYYSTWAASGDPRAPKCRKIAGVGGVDDIRKAAFDALQ"
FT   gene            complement(461168..461932)
FT                   /locus_tag="CAP2UW1_0386"
FT   CDS_pept        complement(461168..461932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0386"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: dar:Daro_3206 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33739"
FT                   /db_xref="GOA:C7RKE8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE8"
FT                   /protein_id="ACV33739.1"
FT                   /translation="MRFKVVIPARYASTRLPAKPLLDLGGRPMVVRVAERALLSGADEV
FT                   LVATDHAEVVASAEHYGLRVLLTRADHASGTDRLAEVVELAGWSDDTIVVNVQGDEPLI
FT                   DPALIAMTATRLATSGAEIATVAHPLTDAADFFNPHIVKVVCAAGGDALYFSRAPIPYA
FT                   RDHFARETGGETLPADMPAFRHIGLYAYRARFLRTYSRLTASPLEALEALEQLRALWHG
FT                   FRISVAIADHLPGAGVDTPEDARRMQEWFKKV"
FT   gene            complement(461951..462127)
FT                   /locus_tag="CAP2UW1_0387"
FT   CDS_pept        complement(461951..462127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0387"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   dar:Daro_3207 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33740"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKE9"
FT                   /protein_id="ACV33740.1"
FT                   /translation="MDARLLDILVCPICKANLEYRKVEAELVCKPCRLAFPVRDGIPIM
FT                   LQDEARPLAADEI"
FT   gene            complement(462108..463154)
FT                   /locus_tag="CAP2UW1_0388"
FT   CDS_pept        complement(462108..463154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0388"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: dar:Daro_3208 lipid-A-disaccharide synthase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33741"
FT                   /db_xref="GOA:C7RKF0"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF0"
FT                   /protein_id="ACV33741.1"
FT                   /translation="MAASGIAQRLPGWWYQRRLAPPLWPLLPLAWLFGLLVGLRRTFYH
FT                   YGLLRSYRLPVPVIVVGNLTVGGSGKTPLVLWLVRCLRSSGWRPGIISRGYGGSARQAQ
FT                   EVGEDSAFSVVGDEPVLLARRSGVPVFVGRDRVAAARALLAAHPDCDLIVSDDGLQHYR
FT                   LQRSVEVVAFDGRGMGNGWLLPVGPLREPLRRLSAVSAIVWNGPRDKALEHAAQRLPQF
FT                   DMHLVGDSFVAATGEPRRCGAGALRQRRLHALAGIGDPQRFFRQLRALGLEFEEHPFPD
FT                   HHPYRAADLAFAQDGVLLMTEKDAVKCAAIATGEAWVLPVEAAIGGPPGHAGLFEIILE
FT                   KLHGRTPA"
FT   gene            complement(463154..463570)
FT                   /locus_tag="CAP2UW1_0389"
FT   CDS_pept        complement(463154..463570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0389"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   dar:Daro_3209 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33742"
FT                   /db_xref="GOA:C7RKF1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF1"
FT                   /protein_id="ACV33742.1"
FT                   /translation="MNFRRGRGADAPEINLIPLIDVLLVIIIFLMLTTTYAKFSGLEIN
FT                   LPTADANKQPDPPSEVNVAVTANGQVLVNKAPLTTVTVAAISEALRRAAGDAKEPVIVI
FT                   NADAKATHQSVVDVMQAAQTAGYPRISFATQSPH"
FT   gene            complement(463586..464245)
FT                   /locus_tag="CAP2UW1_0390"
FT   CDS_pept        complement(463586..464245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0390"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   dar:Daro_3210 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33743"
FT                   /db_xref="GOA:C7RKF2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF2"
FT                   /protein_id="ACV33743.1"
FT                   /translation="MPPQAKVPDCEILAGDNVFSIVQAAGWPIWPLLLASIIAVALIIE
FT                   RLVALRRAKVVPPGLLQRAVAEYRKNGTTPDLIANLEADSPLGRVLGAGLRNVAASREI
FT                   MKEAIEEAGSVVSHDLERYLTTLGTIASISPLMGLFGTVVGMIEIFGSQAPSGSNPIQL
FT                   AHGISVALYNTGFGLLIAIPSMIFWRHFRALVDSFVIEMQQQAVRLVEVLHGERKS"
FT   gene            complement(464389..465600)
FT                   /locus_tag="CAP2UW1_0391"
FT   CDS_pept        complement(464389..465600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33744"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF3"
FT                   /protein_id="ACV33744.1"
FT                   /translation="MSDLTPSDSRQVAVFDDRPFFEKALIYGVRERIVEPQRLAAILDD
FT                   AAKGMVQIAEYFGTPYLRPNIEEARTRIVNLVSLYLEEGCGGDLAKAARSLRDNTFLSH
FT                   SRGGSEMLKRLWAMPEDGSYGMLVRQSQKQFLAEWSLRTPADYRQLLEQRQGYQLTVSA
FT                   ALWFAEGLGVPASTISTVSVESIIRTALLVNLAGQAAASVPNAAEFAATLAVIRKKGVP
FT                   GKGRKRIREVFQSLPDAYHAVAERELKKLEAEDLPKILDASLPLEELVQELEPLYFLRD
FT                   FGPEDAGQLDAMISKDWHRITRGKTDDSSLLTVFVCLAADTPPRPVLTRTAARTLIRKL
FT                   RADGFQRPPVLVFIRGFAPYAMQADLETLWNEFFPEAEAYLLDASDTTLTQALAFLKEN
FT                   CVVV"
FT   gene            complement(465641..466369)
FT                   /locus_tag="CAP2UW1_0392"
FT   CDS_pept        complement(465641..466369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33745"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF4"
FT                   /protein_id="ACV33745.1"
FT                   /translation="MNHPVRLKAEKLIRAGDIVGAEHALASLVETEGDDSLVVVLDDFP
FT                   AKDLLAVLRDFDSSRESVVSLLVSPEQFARAIVLETRYGDPSHERLRGMINAVIFRAES
FT                   DPGEFLEAIGNLDGGCDAFADYLCDRGESLEHFFRNGTFDLFDEGGGDALAGLTDAERL
FT                   DALSDPDTNRPVLNHSEVNDHDWMELVWLLRYQQPEVFRDVLLILRARASAESAQQAAA
FT                   DGRPAQEQRPSGEPEEESAL"
FT   gene            complement(466374..466904)
FT                   /locus_tag="CAP2UW1_0393"
FT   CDS_pept        complement(466374..466904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33746"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF5"
FT                   /protein_id="ACV33746.1"
FT                   /translation="MRLSRFFEELRSAYEAELDDLMTDSGGHDVLAERLKAKRAQVPLL
FT                   LPMIGCNPEMVAVAFHGGMRFHSPDVMRDLAAQEPEDLPAWSDLLSAVELVPWAEKLAA
FT                   TVLQNPDGDQFLVVTACLEYLQGKTGANPERPPTDDADEDEDEEGDDRDLDEAGADWLS
FT                   EQGFDRRDRFSGD"
FT   gene            complement(466901..467179)
FT                   /locus_tag="CAP2UW1_0394"
FT   CDS_pept        complement(466901..467179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0394"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   rfr:Rfer_0641 heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33747"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF6"
FT                   /protein_id="ACV33747.1"
FT                   /translation="MQDHYAVLGLASDASGEEIKRAYRRKALQYHPDRNAAAEATDRFR
FT                   AVQEAYETLSDGNLRQAYDENRRRNLLERPLETAREIWKNYLEGVLH"
FT   gene            complement(467181..468020)
FT                   /locus_tag="CAP2UW1_0395"
FT   CDS_pept        complement(467181..468020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0395"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: nmu:Nmul_A2539 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33748"
FT                   /db_xref="GOA:C7RKF7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF7"
FT                   /protein_id="ACV33748.1"
FT                   /translation="MTKDTRTFSLELFPPQTAEGAEKLRATRAQMALLKPRFFSVTFGA
FT                   GGSTRDRTLETVLDIQREGHAAAPHLSCIGSTRESIRSILEQYRAHGIRHLVALRGDLP
FT                   SGMAQPGTFRYANELVEFIRAATGDWFHIEVAAYPEYHPQARSPLDDLLAFRRKLEAGA
FT                   NSAITQYFYNFDAYAQFIDQCRRIGIEVPIVPGIMPISSYSSLARFSDNCGAEIPRWIR
FT                   KKLESYGDDSASIRAFGLDVVTQLCEKLLASGAPGLHFYTLNQASLTSTLWQRLGLT"
FT   gene            complement(468031..468381)
FT                   /locus_tag="CAP2UW1_0396"
FT   CDS_pept        complement(468031..468381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0396"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   bpt:Bpet4762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33749"
FT                   /db_xref="GOA:C7RKF8"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF8"
FT                   /protein_id="ACV33749.1"
FT                   /translation="MRLILVWLVNACALLAVAYLLPSIQVASFGSALGAALVLGLVNTL
FT                   LRPLLVLLTLPVTVLTLGLFLLVLNGLMFWLAGSLLDGFVVGGFWPAVFGAILYSLFSS
FT                   ALSSLLPTGEAR"
FT   sig_peptide     complement(468277..468381)
FT                   /locus_tag="CAP2UW1_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.608 at
FT                   residue 35"
FT   gene            complement(468407..469816)
FT                   /locus_tag="CAP2UW1_0397"
FT   CDS_pept        complement(468407..469816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0397"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: eba:ebA1874 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33750"
FT                   /db_xref="GOA:C7RKF9"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKF9"
FT                   /protein_id="ACV33750.1"
FT                   /translation="MDAITQTQDYVIADLGLAEWGRKEIRIAETEMPGLMAIREEFAAA
FT                   RPLKGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAADGVPVFA
FT                   VKGESLADYWDYTHRIFEWSDGGYSNMILDDGGDATLLLHLGARAENDPSALASPSSEE
FT                   ETILFAAIRARLASDPTWYSVRLAAVRGVTEETTTGVHRLYQMHARGELRFPAINVNDS
FT                   VTKSKFDNLYGCRESLVDGIKRATDVMIAGKVALIAGYGDVGKGSAQAMRALSAQVWVT
FT                   EIDPICALQAAMEGYRVVTMDYAADKADIFVTCTGNYHVINHEHMRKMKDQAIVCNIGH
FT                   FDNEIDVASIEAYPWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCGTGHPSYVMSSSF
FT                   ANQTIAQIELFTRTGDYPVGVYTLPKHLDEKVARLQLKKLNAQLSELTDQQAAYIGVAK
FT                   AGPYKSEHYRY"
FT   gene            complement(470091..470465)
FT                   /locus_tag="CAP2UW1_0398"
FT   CDS_pept        complement(470091..470465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33751"
FT                   /db_xref="GOA:C7RKG0"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKG0"
FT                   /protein_id="ACV33751.1"
FT                   /translation="MLWLTLLKPGDWLMMASGLAICVVSFPLAWQAGVAEKAVVRLAGE
FT                   VFSELDLSRNRRLEVPGPLGITTIVVDKRRVRVAADPGPRQYCVRQGWLARAGEIAICA
FT                   PNQVSVEIRGSQRPYDSLSY"
FT   sig_peptide     complement(470370..470465)
FT                   /locus_tag="CAP2UW1_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.581 at
FT                   residue 32"
FT   gene            complement(470465..471361)
FT                   /locus_tag="CAP2UW1_0399"
FT   CDS_pept        complement(470465..471361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dar:Daro_0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33752"
FT                   /db_xref="GOA:C7RKG1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKG1"
FT                   /protein_id="ACV33752.1"
FT                   /translation="MLHDMHLVLISGLSGSGKSIALKVLEDANYYCVDNLPSQLLQPLV
FT                   RHLGQQGYDQVAVVIDIRAGDSVAMLPRQLDALRAAGDLELQFLFLDAQDETLIKRYSE
FT                   TRRRHPLASDRLTLTEAIAEERVRLAGLAALGHHMDTSGLKASVLREWVRQFIAAGVGA
FT                   DPCQGLTLLFESFGFKNGIPLDADLVFDVRCLPNPHYDPTLRPLTGRDAPVIDFLEAEP
FT                   EVLRMRGDITGFIRAWLPSYVQDSRNYLTVGIGCTGGQHRSVYLAEWLGRKFRGCARVL
FT                   IRHRELAPVTGDAREGQ"
FT   gene            471431..472621
FT                   /locus_tag="CAP2UW1_0400"
FT   CDS_pept        471431..472621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0400"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: dar:Daro_0071 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33753"
FT                   /db_xref="GOA:C7RKG2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKG2"
FT                   /protein_id="ACV33753.1"
FT                   /translation="MATLDLSFAAALVAIRRDIHAHPELAFAETRTADLVARELTSYGL
FT                   QVHRGLARTGVVGVLRKGSSQRAIGLRADMDALPLQEKNDCPHRSRHEGRMHACGHDGH
FT                   TAMLLGAARYLAAHRDELDFDGIVYFIFQPAEESEGGAAVMIADGLFDQFPMDAVFGLH
FT                   NWPGIPVGEMAVMPGPVMAGTCAFEISVRGHGCHAAMPQEGVDTLVASSQLVLALQTVV
FT                   ARNVHPCESAVVSVTQIHAGEAWNIIPDDAILRGTIRSFKVETQELVERAVERLCNGIA
FT                   SAFGAQISVRFDHRYPPTVNSVGETEVCRRVARELLGPGKIREDELPSMGAEDFAYMLR
FT                   ERPGCYVWLGNGPGTGGCTLHNPHYDFNDEILPIGVSYWVRLVATTLRGEAATVRG"
FT   gene            472964..473644
FT                   /locus_tag="CAP2UW1_0401"
FT   CDS_pept        472964..473644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0401"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: dar:Daro_0429 response
FT                   regulator receiver:transcriptional regulatory protein,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33754"
FT                   /db_xref="GOA:C7RKG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKG3"
FT                   /protein_id="ACV33754.1"
FT                   /translation="MRILLAEDDRIIADGLCRSLRQAGYAIDCAYNGLDADTALMTNTY
FT                   DLVILDLGLPKLPGLDVLRRLRARNSSTPILILTALDGTDDRVKGLDLGADDYMAKPFE
FT                   LAELEARVRALSRRSSGTSRMIQCGSLTFDQTDRCALVNGEMLDLSARELGLLEILLLR
FT                   AKRLVSKDQLVDHLCGWGEEVSHNAIEVYVHRLRKKLEATGVNIITVRGLGYYLEKPAE
FT                   ETKS"
FT   gene            473682..475106
FT                   /locus_tag="CAP2UW1_0402"
FT   CDS_pept        473682..475106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0402"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: dar:Daro_0430 ATP-binding region,
FT                   ATPase-like:histidine kinase, HAMP region:histidine kinase
FT                   A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33755"
FT                   /db_xref="GOA:C7RKT3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT3"
FT                   /protein_id="ACV33755.1"
FT                   /translation="MLAPLLFVWPISIAFTHYFANSVASFPYDQSLREHVAAVSRQVSF
FT                   VDGQPHFALPGIAQVFLRSDEIDNVYFHLLDVDGSLIVGDTELPVPRHPQGLPRSEHGE
FT                   VLFRDDEYRGQALRVAYLYLFEPGASAARWVLIEVGETTEKRSQLANKIIASVILPQFV
FT                   IIPLAVVLVWFGLSQGLRPLTRLRDRIQARREADLSPIALRRVPEELRPLTEAFNSMLA
FT                   RMQHNVDAQRRFIADAAHQMRTPLTGLKTQAQLAMRESDPGELRHALRQILSGVDRASH
FT                   LVDQMLALARAEASGDAQQPLLPLDVDQLLREIVETWVVRALDKRIDLGYEAAGAVLIE
FT                   GNAFLLREMINNLLDNALRYTPAGGRVTARVVAQGDFAVLEIEDSGPGIADEDSQKVFD
FT                   RFYRVEGADGEGSGLGLAIVREIAELHQAAASLRPNTRHADGEEPSGCIARIVFRVQRP
FT                   PPPRGSTPDAVQTGFA"
FT   gene            complement(475132..475365)
FT                   /locus_tag="CAP2UW1_0403"
FT   CDS_pept        complement(475132..475365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33756"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT4"
FT                   /protein_id="ACV33756.1"
FT                   /translation="MDVEWVLATLNDVMDALEDAVGELERSPQAVDLLLPEVMPAIYAK
FT                   LNYAWNSRELGPEALDKIDHDALVGFPKDLPM"
FT   gene            complement(475434..475880)
FT                   /locus_tag="CAP2UW1_0404"
FT   CDS_pept        complement(475434..475880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0404"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188; KEGG:
FT                   dar:Daro_2879 protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33757"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT5"
FT                   /protein_id="ACV33757.1"
FT                   /translation="MQIWVDADACPGVIKEILFRAAQRTRIMTTLVANQMLRVPASPWI
FT                   RSWQVPTGFDVADQRIVQEMQAGDLVITADIPLAGQVIERGGYGLNPRGEFYSRENIRE
FT                   CLAMRNFMEELRSSGVATSGPASLSQSDRQVFAAQLDRFLARQR"
FT   gene            complement(475890..478634)
FT                   /locus_tag="CAP2UW1_0405"
FT   CDS_pept        complement(475890..478634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0405"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   dar:Daro_4157 ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33758"
FT                   /db_xref="GOA:C7RKT6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT6"
FT                   /protein_id="ACV33758.1"
FT                   /translation="MCATAHRLHKHGTSLPASAGLLQTMNEQGRKRIAWHYLAADEAAA
FT                   RLEASFNDGLAESEVLSRRAIHGENRITPKPGKGPLQRFALQFVQPLILVLLAAGVVTA
FT                   ALGEWVDSGVILGVTLINALIGFIQEGRAESALATLAQSVPSEVTVLRGGCKQRLASTA
FT                   LVPGDVVLLAAGDKVPADLRLFRAKDLQAIESALTGESAAVAKHGETLPEDTLLADRGN
FT                   MAYAGTVMISGQGAGVVVDTGDRTETGRISRLIAEAPDLTTPLTCRMAAFSNWLLIAIG
FT                   VLAALTFAVGLWRGESAFAMFMAAVALAVGAIPEGLPAAMTITLAIGVSRMARRRAIIR
FT                   KLPAVETLGSTTVICSDKTGTLTENQMTVREIHTGGKRTVVSGSGYSPNGKVGEGETIA
FT                   GALRECLLAGALCNDAGLNRVNRHWEVVGDPTEGALLVVARKAGLDERTLQRLFPRLDE
FT                   IPFDSARQYMATLHEIEGQRMAYYKGAFEQLLPRSQSMLDANGQSVPVRRVEIEVAARA
FT                   MAAQGLRVLAIARLAADPALTLEAMGADSGLQFVGLVGMIDPPRPKAIAAVRTCHAAGI
FT                   TVKMITGDHAVTALSIARQIGIARAGETALNGRELAALDDEGLRGVVRSVNVFARVEPE
FT                   QKLRLVRALQANGEVVAMTGDGVNDAPALKQAHIGIAMGLGGTEVAKDAADMVLTDDDF
FT                   ASIEAAIEEGRGVFDNLVKFITWTLPTNFGEGLVIVAAIVAGATLPITPLQILWINMTT
FT                   AVFLGLMLAFEPIEHNVMRRPPRPPGAPILDTGLVWRIVLVSVLLLAGSFGLFLRELAQ
FT                   GESLAEARTVAVNVFVVVEAMYLFNCRSLTRTALGIGLFSNPAVWYGVLTMAVLQALLT
FT                   YVPLMNRLFATAPIGLHQWLEILAVGVLAYVVVGIDKQWRARH"
FT   gene            478926..479936
FT                   /locus_tag="CAP2UW1_0406"
FT   CDS_pept        478926..479936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_141024 hypothetical protein
FT                   Pfam: Drf_FH1 PROSITE: ALA_RICH GLU_RICH GLY_RICH PRO_RICH
FT                   NLS_BP"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33759"
FT                   /db_xref="GOA:C7RKT7"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT7"
FT                   /protein_id="ACV33759.1"
FT                   /translation="MFSRSLGGRFWLGLLPAILVAGKVLAHPVVPDERTLQVDAEQADV
FT                   RRATDGISDATALARQASSASERVRGLPPAPTSYDDRSAVLADPLARGSDLAVPAFARL
FT                   QPGINVSAITGGVDDADPLPGLRRSVADGAFQGSATASPARAVRSAATAAADRGEDAAA
FT                   ALNELQESVVEVIAEALDVRVGKDGRVDFSVAGVEGFHVVSAAGRVTLGLDNTAVTFVQ
FT                   YGSDTPAARPVPATASPNPEPVASAGGFNPAREFVGLLIEVVQYPLLWVILFFLIVGKI
FT                   AWLVVTRRGHKRRHHSHRASQPTRLKVKRSRSRSRHKSVPAAGITGPPAASPQES"
FT   sig_peptide     478926..479006
FT                   /locus_tag="CAP2UW1_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            480120..481280
FT                   /locus_tag="CAP2UW1_0407"
FT   CDS_pept        480120..481280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0407"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   amr:AM1_5147 transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33760"
FT                   /db_xref="GOA:C7RKT8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT8"
FT                   /protein_id="ACV33760.1"
FT                   /translation="MTLLEAFSGLPDGRKGPAQRYSLAQILIMAVCAILCGADNWVEVA
FT                   DWCKDRKEWLSERFRWPLEGGTPSHDTFGDLFRVLDAHIFETRFRDWIRELAGVIDGVV
FT                   AIDGKTLRGSGKKGSNELLHMVTAYAVQSGLCLAQEGTCGKGHELAGMKALLDVLVLKG
FT                   CIVTMDALGCQTELAEKIVARGGDYVLQVKDNQKNLAEALREFFDTGAAAGFGRLTVEH
FT                   FEETEKDHGRIETRRYTWINDVTWMDRPMRAAWKKLGGVGMIESIRQIGDKVSVDQRYA
FT                   IGSCGVQTVEMFAKASRSHWGIENGLHWTLDVVFREDQCRARLGNSARNLSVLRKFVLT
FT                   TLRKEEGCKMGLNRRRLHADRNESYRESLIALAFSDRTSINCMNSA"
FT   gene            481413..483053
FT                   /locus_tag="CAP2UW1_0408"
FT   CDS_pept        481413..483053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0408"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: dar:Daro_0233 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33761"
FT                   /db_xref="GOA:C7RKT9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKT9"
FT                   /protein_id="ACV33761.1"
FT                   /translation="MLQKSASFPGIQGPIVAIVMDGYGIAKSDVGSAIAAARKPTLDRL
FT                   FATYPNITLRAHGVAVGMPSDEDMGNSEVGHNAIGAGQVYSQGASLVADAIASGSIWQG
FT                   AAWQQIVAGAKAGRGVIHFIGLFSDGNVHSHIDHLRAMIVRAREEGVQAVRVHILLDGR
FT                   DVPETSALDYVLPFEAFLAEVSSEGFDARIASGGGRMNITMDRYEANWNMVDKGWHTHV
FT                   LGEGDQFASAAAAIEALRVRFPGTIDQDLPPFVIARDGKPAGTIEDGDSVVFFNFRGDR
FT                   SIEITRAFEDAAFDKFERVRVPSVTYAGMLQYDGDLKLPRRFLVDPPAILDTMGEWFAK
FT                   AGITQFACSETQKFGHVTYFWNGNRSNKFDGETYQEVPSDVVPFEQRPWMKAAEIADAM
FT                   IEALKSGQYRTLRCNFANGDMVGHTGSFRAATMAIEAVDLQLARILPVIDALGGVALIT
FT                   ADHGNADEMYEIDKKTKQPATNADGSFKAKTAHTLNPVPLILYDNASGGKLGLTQTETA
FT                   GLSNIAATIANLLGFEKHAKWDESVLVVR"
FT   gene            complement(483158..484402)
FT                   /locus_tag="CAP2UW1_0409"
FT   CDS_pept        complement(483158..484402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0409"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: dar:Daro_0207
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33762"
FT                   /db_xref="GOA:C7RKU0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU0"
FT                   /protein_id="ACV33762.1"
FT                   /translation="MTAFARRNGVLHAESVSLIDLAARFGTPCWVYSRAALEASLAEFE
FT                   RELAGLDALVCYAVKANSNLAVLDVFARRGAGFDIVSGGELRRALAAGADPRRIVFSGV
FT                   GKTAAEMELALAADILCFNVESAPELDRLSAVAGRLGKTAPISLRVNPDVDAKTHPYIS
FT                   TGLKENKFGVAYEEALALYRHAASLPNLTISGIDCHIGSQLLDPAPFAAALDKILTLVD
FT                   QLAANGIVLHHIDLGGGLGIRYRDEDAPTVQAYLQPMLQKLRDRHLQVLLEPGRRLVGN
FT                   AGLLLTRVEYLKPGEVKNFAIVDAAMNDLARPALYGSWHDIVPVVAPQGATRPWEIVGP
FT                   VCESGDFLGHGRDLALATGDLLAIMSAGAYGMAMSSNYNSRPRAAEVMVDGADVHLVRR
FT                   RETAEELYALEQRLP"
FT   gene            484639..484956
FT                   /locus_tag="CAP2UW1_0410"
FT   CDS_pept        484639..484956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0410"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: dar:Daro_0208 frataxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33763"
FT                   /db_xref="GOA:C7RKU1"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU1"
FT                   /protein_id="ACV33763.1"
FT                   /translation="MNDNEFNELADATLTQIETALERSGADLDFAMVSDSVLEIEFADR
FT                   SKIIVNRHDAAKEIWVAARSGGFHYRWDGSCWQDTRSEEELMAALSRLISEQAREPVLL
FT                   S"
FT   gene            complement(484981..485436)
FT                   /locus_tag="CAP2UW1_0411"
FT   CDS_pept        complement(484981..485436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0411"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   nmu:Nmul_A2388 ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33764"
FT                   /db_xref="GOA:C7RKU2"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU2"
FT                   /protein_id="ACV33764.1"
FT                   /translation="MSNFDREKAISVLNQIMELELAGVVRYTHYALMVYGYNRIPIVGW
FT                   MKKNAEESLMHAGRAGEMVTLLGGHPSLGIGPLLESDTHDVGDMLRESLEHETQAREAY
FT                   GRLLEIVAGKHILLEEYARELIVDEELHADEVNKMLRRPGETGAFQF"
FT   gene            complement(485621..487033)
FT                   /locus_tag="CAP2UW1_0412"
FT   CDS_pept        complement(485621..487033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0412"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /note="PFAM: Carbohydrate-selective porin OprB; KEGG:
FT                   bpd:BURPS668_0296 carbohydrate porin, OprB family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33765"
FT                   /db_xref="GOA:C7RKU3"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU3"
FT                   /protein_id="ACV33765.1"
FT                   /translation="MLIARNKLTNLLGAALLASFLGQPLTTLGAAADNPADLGKVIAAG
FT                   KAPEGDSVAASDATDDTPNWQESTLTGDWGGARKRLYDAGVQADLMYTADYLRNNAGGL
FT                   QHGGAYMGHTDLVLQFDGEKLFGWTGGSAFLQLISNTGGRVNLNYVGSLMGVDNLEAPV
FT                   NRTGVFKAWLQQAFLDDRASLRLGLYPIDSEFYVTDASGVFLHPSFGMAAEVANFGSLA
FT                   GPSIYPTSTYAARLRVDPDPAWYAMLAVSRGIPSERIATAGPNVSWPKGTGSMLIGEVG
FT                   FSPAKAGLLRESTPAEAKDDFVPISKLAVGMWRFSPRFPQLVAVDAADEPLLATHWGAY
FT                   FLAEQTVFRVPESNRDLAAFVRYGFTDGRTNTLDYSLSVGFSFRGPFAGREKDTFGIAA
FT                   TRAHAGPQGRAQLSDELGEPLSSAAETAVEMTYRAQLAPGVVLQPLVQRILNPGLYLPN
FT                   ATVAGVRLQLAL"
FT   sig_peptide     complement(486935..487033)
FT                   /locus_tag="CAP2UW1_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.525 at
FT                   residue 33"
FT   gene            complement(487080..487415)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0413"
FT   gene            complement(487424..487630)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0414"
FT   gene            complement(487624..487971)
FT                   /locus_tag="CAP2UW1_0415"
FT   CDS_pept        complement(487624..487971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0415"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   dar:Daro_1696 cobalt transport protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33766"
FT                   /db_xref="GOA:C7RKU4"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU4"
FT                   /protein_id="ACV33766.1"
FT                   /translation="MKHHQNLILLILVVLLAVFPLWLVEKPAPAADGKAVEIFAGADDK
FT                   AKDLIGDISPNYTRWFEPLMEPASGEIASLLFALQAALGAGFIGYYFGVSVTREKYAAR
FT                   RKAADEGAGAY"
FT   sig_peptide     complement(487900..487971)
FT                   /locus_tag="CAP2UW1_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.777 at
FT                   residue 24"
FT   gene            complement(487968..488645)
FT                   /locus_tag="CAP2UW1_0416"
FT   CDS_pept        complement(487968..488645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0416"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   dar:Daro_1697 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33767"
FT                   /db_xref="GOA:C7RKU5"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU5"
FT                   /protein_id="ACV33767.1"
FT                   /translation="MHIMEGFLPIEHAVGWSVASAPFVIYGIHAVKQHIQENPEQRMLL
FT                   GVAAAFTFVLSALKLPSVTGSCSHPTGTGLGAILFGPAAMAPIGMVVLLFQALLLAHGG
FT                   LTTLGANIFSMAIVGPFAAAGLFRLARSLKLSFAVSVFIAASMADLLTYVTTSVQLAWA
FT                   FPDLEGGFVASFVKFAGIFAITQIPLAISEGLLTVVIFNALIRFNPQELQKLKLLGGRE
FT                   AHA"
FT   misc_binding    complement(488777..488986)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 116.87"
FT   gene            complement(489049..489510)
FT                   /locus_tag="CAP2UW1_0417"
FT   CDS_pept        complement(489049..489510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0417"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   nmu:Nmul_A2388 ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33768"
FT                   /db_xref="GOA:C7RKU6"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU6"
FT                   /protein_id="ACV33768.1"
FT                   /translation="MSDFDRDEAVAVLNQIMELELAGVVRYTHYALMVYGYNRIPIVDW
FT                   MKKNAEESLVHAGRAGELVTLLGGHPSLGIGPLLETYQHDTGDILRESLEHETLARAAY
FT                   YRLLEIVAGKNILLEEYARDLIVDEEMHADEVNKMLRRPGDTEAVRAVP"
FT   gene            complement(489655..491001)
FT                   /locus_tag="CAP2UW1_0418"
FT   CDS_pept        complement(489655..491001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0418"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /note="PFAM: Carbohydrate-selective porin OprB; KEGG:
FT                   bvi:Bcep1808_5348 carbohydrate-selective porin OprB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33769"
FT                   /db_xref="GOA:C7RKU7"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU7"
FT                   /protein_id="ACV33769.1"
FT                   /translation="MSIPTHKLKTLASALLLSSFFGQPLAALAATDEADATDDTPNWQE
FT                   TTLTGDWGGARKRLYDSGVQVDLMYTADYLRNNAGGLQHGGAYMGHTDLVLQFDGEKLF
FT                   GWTGGSAFLQLISNTGGRVNLNYVGSLMGVDNLEAPVNRTGVFKAWLQQAFLDDRASLR
FT                   LGLYPIDSEFYVTDASGVFLHPSFGMAAEVANFGSLAGPSIYPTSTYAARLRIDPDPAW
FT                   YAMLAVSRGIPSERIATAGPNVSWPKGTGSMLIGEVGFSPAKAGLLRESTPAEAKDDFV
FT                   PISKLAVGMWRFSPRFPQLVAVDAADEPLLATHWGAYFLAEQTVFRVPESNRDLAAFVR
FT                   YGFTDGRTNTLDYSLSVGFSFRGPFAGREKDTFGIAATRAHAGPQGRAQLSDELGEPLS
FT                   SAAETAVEMTYRAQLAPGVVLQPLVQRILNPGLYLPNATVAGVRLQLAL"
FT   sig_peptide     complement(490912..491001)
FT                   /locus_tag="CAP2UW1_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 30"
FT   gene            complement(491004..491276)
FT                   /locus_tag="CAP2UW1_0419"
FT   CDS_pept        complement(491004..491276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33770"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU8"
FT                   /protein_id="ACV33770.1"
FT                   /translation="MFEELVAYGAVLGATTYATWRLMPGALRVALAERWATLAPRFGFA
FT                   DAAPDPARRQASASGSSSCGGCSGCASKPTSIKVVVVTNKNTNAQ"
FT   gene            complement(491278..493149)
FT                   /locus_tag="CAP2UW1_0420"
FT   CDS_pept        complement(491278..493149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0420"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: aav:Aave_1161
FT                   ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33771"
FT                   /db_xref="GOA:C7RKU9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKU9"
FT                   /protein_id="ACV33771.1"
FT                   /translation="MSTANGSLRLALLGNPNCGKTALFNLLTGSRQKVANYPGVTVDRK
FT                   EGQLTTPSGKQFRVLDLPGAYSLNAVSIDEEITRDVVLGMLGGEPRPDILVCVSDATNL
FT                   KLNLRLVLEVKRLGLPMVLALNMNDLASKRGIEIDVPALARELGVPVVRTIAVKRGGAS
FT                   ELISQLDTALPDDVAHPPVWLPPDVADVTATQREVRRILAATVREPALDTRFDERIDRV
FT                   VLHPVWGMLILAATLFLMFQAVFSWASVPMDLIKSGVQAFGVFLTEQMPDTILRSLLVD
FT                   GIVAGVGSVLVFLPQILILFLFILALEDSGYLPRAAFLLDRLMGTVGLSGRSFIPLLSS
FT                   FACAIPGIMAARTIANWRDRLATIMIAPLMTCSARLPVYALIIGAFIPESTVAGVFNLQ
FT                   GLVLFGLYVAGVVSAMAVAGVLKLTVAKGLQHPLMLELPSYRWPHGRNLLLGLIERARI
FT                   FIMRVGNIILALMVVLWFLSSFPAAPDGAVGPAIQYSYAGMLGQALEVIFAPIGFNWQI
FT                   SIALVPGMAAREVAVGALGTVYALSATGDDVAEQLAPMLAAGWSLPTAFSLLAWYVFSP
FT                   QCLSTLAVVKRETNSWRYPLLMAGYLFALAYGAAFVTYRVALALTGG"
FT   gene            complement(493146..493427)
FT                   /locus_tag="CAP2UW1_0421"
FT   CDS_pept        complement(493146..493427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0421"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: dac:Daci_2175 FeoA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33772"
FT                   /db_xref="GOA:C7RKV0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV0"
FT                   /protein_id="ACV33772.1"
FT                   /translation="MSSMDLITLFDLPTGQEGTVRSGPVAADGETADHELALRLFEIGF
FT                   IEGERVRVVARGHPGGDPVAVRVGNTMFALRRFEAERVLVAPLRGVVA"
FT   gene            493768..493911
FT                   /locus_tag="CAP2UW1_0422"
FT   CDS_pept        493768..493911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33773"
FT                   /db_xref="GOA:C7RKV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV1"
FT                   /protein_id="ACV33773.1"
FT                   /translation="MRMIAIYDSAKSLYDGGASRQKERPMRSLLFNTFLAGLLLWLVMA
FT                   GI"
FT   gene            493935..494144
FT                   /locus_tag="CAP2UW1_0423"
FT   CDS_pept        493935..494144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33774"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV2"
FT                   /protein_id="ACV33774.1"
FT                   /translation="MPANDLWAGALSLVLIHDETGCPHSALNAARLLDRLCEMEGLDAD
FT                   TRNLCERASGRLSAARPKHDPLRA"
FT   gene            494186..495511
FT                   /locus_tag="CAP2UW1_0424"
FT   CDS_pept        494186..495511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33775"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV3"
FT                   /protein_id="ACV33775.1"
FT                   /translation="MSDVPFLRVAAADIATEQGRRDALAGLPHAPRPVAADNASLGSRR
FT                   RKLWDLQAKFHCPVVGVCFEVNELRTLISRIMHFPRETTDFMLHTTAVGACETRSRLSE
FT                   VLQKYLERRFPLAIRRFSGARSAEGVRALWRESCKTGSDIPGALWASWTHPACDASLAQ
FT                   EIYADIHMIQHQVGSGTRADLAALQAVQAENAELRKQLHEARADAEAQGLERSREAQIL
FT                   VRQIADLRASLAGKEGMLATVTGQFDTLRQSLPELKARQSLARRASDAEARATALRASV
FT                   AGLEGEVERLGRLVQHAEETIEHLLAAEASAAGQGRPVLDEPPPDLAGKRILCVGGRSG
FT                   SVDAYRKMVEQRGGSFLHHDGGLEENLNRIDAALAAADLVVCQAGCISHNAYWRVKEQC
FT                   KRTGKPCVFVRGAGVTSFGRVVGAAGAGNEESGVDRLSSATE"
FT   gene            complement(495561..495917)
FT                   /locus_tag="CAP2UW1_0425"
FT   CDS_pept        complement(495561..495917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33776"
FT                   /db_xref="GOA:C7RKV4"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV4"
FT                   /protein_id="ACV33776.1"
FT                   /translation="MTASFVTRTHWRWLFWLTALAVLVLSLLPPSPHLPDTGWDKSNHL
FT                   LAFAVLAVLGLRSYPGSRGPLLAGLLAYGGLIEGLQSLTPDRFAEWADLLADAVGLLLG
FT                   WGLATAWSRWRSTG"
FT   gene            complement(496137..497318)
FT                   /locus_tag="CAP2UW1_0426"
FT   CDS_pept        complement(496137..497318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0426"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: ppd:Ppro_0822 iron
FT                   permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33777"
FT                   /db_xref="GOA:C7RKV5"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV5"
FT                   /protein_id="ACV33777.1"
FT                   /translation="MIPRRLLAFLLAVLAILGTPSGAAAAIDGAAVAAEISRRGDAAVA
FT                   AYDPANRLATASELSSLYFAVFEGSGMEVDLGIRSPSLKNELEVLFGVVNGQAMQGVAA
FT                   ADLQSSWLALRDRLNVAAALYGTPETDGFLPALLKSALILIREGVEAMLVVSALTAYLR
FT                   RAGAADRVWVLYAGVGVAIPLSLLTGWAMTSAIRAAGASRAVVEGATMLLAAAVLFYVS
FT                   FWLLSKSESRRWQAWIAGRVDSAISRGSLIALGGAACLAVYREGAETVLFYHALLASHA
FT                   DHGGAIIAGIGLASGLLALVYLVLNRMALRLPHATFFAVTAVLVYGIGLVFLGQGIIEL
FT                   QAAGRLATTPLPGFPRVSWLGIGPSLQGVTAQGGMILLPWLAWTWQRTRRRVS"
FT   sig_peptide     complement(497241..497318)
FT                   /locus_tag="CAP2UW1_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.586 at
FT                   residue 26"
FT   gene            complement(497385..499550)
FT                   /locus_tag="CAP2UW1_0427"
FT   CDS_pept        complement(497385..499550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0427"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ppd:Ppro_0821 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33778"
FT                   /db_xref="GOA:C7RKV6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV6"
FT                   /protein_id="ACV33778.1"
FT                   /translation="MSSPSSLNDARWSAAHPDGKPPTPGASGLTAPAAWPLALTALALL
FT                   AHAPMLPLPAWLPLGLALASRRLPRRPWAGGLRLAGLLVCCTVAGQVFGWLSSDALRLS
FT                   LLATLALKWAESRSQREYALVAAAACVAVAVGLLHWSGGVGLLFVVLSACLLVAVYSGF
FT                   SPPDGSTTPLHKGLGILREAAQRLLVTLPLAAVLFLFFPRIPGPLWDIGMTFGLPLPAS
FT                   IEKSNQGLGISGRLKPGQTQTGASDGQAVLVAEFRDWVPPTSLLYWRGPVFYDFDGQEW
FT                   RLDADYTAGNGRRIMQAGWRRSADFRAGLQSASQEVHYRIRLTPHGGLWLYGLDLPARL
FT                   TTESFIAADWQVLAHLPVREEISYELSSWLEWTAGGELLPALRQRALALPQDSNPRLRA
FT                   FGAALTSAGDTDTVLQQALATLANGGYRVRDRFTPPTGADALDTFWFETREGNAEFFAA
FT                   SFVVLMRAAGIPARLVTGYRGGKLMALTDYVLVKRSHAHAWVEIWDQGKGWRRVDPIDI
FT                   VAPERFASGSTSAKPAPPTSPRATPAAAPRSPAGSPTPLPSGSFASTGVPHSPADAGWT
FT                   PADLAGWLGRWAFHLDGERQQALLPGKGGGLAWIWLLAIAAGGSAGVFAVGLLWGRWRE
FT                   QRRCPLPQRAWQRACRRLASKGLCRGSAECPSDFARRVAGERPAWAAAMTRLADAYGAW
FT                   RYGSTPDAVAADVPIAARHLINRILAE"
FT   gene            complement(499547..500443)
FT                   /locus_tag="CAP2UW1_0428"
FT   CDS_pept        complement(499547..500443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0428"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   ppd:Ppro_0820 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33779"
FT                   /db_xref="GOA:C7RKV7"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV7"
FT                   /protein_id="ACV33779.1"
FT                   /translation="MIGRYVRVRSLPLLPTTAGTYWLLAVLALLATAINYANNLIFALA
FT                   FMLLAVWLQAAASCRRNLATVGWQVDLPRPVFAGESLSIVGALTDRRGHRRYGIALSTG
FT                   KANSLPVGVAADGEATLSLALRTDRRGALTIADLALVSCHPLGLWRARRALPAVEALVY
FT                   PAPGGASPLPARAMRSAHRQTAADDFQGVRAHVPGDPLRRINWRVFARSGEAVVNAFDG
FT                   GHGGDALWLEWETCRGDTETRLAQLTRWVLEAERSGREYGLRLFGKVLPPARGHLQREK
FT                   CLTSLALCEVDSQVGRR"
FT   sig_peptide     complement(500330..500443)
FT                   /locus_tag="CAP2UW1_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.664) with cleavage site probability 0.354 at
FT                   residue 38"
FT   gene            complement(500440..501366)
FT                   /locus_tag="CAP2UW1_0429"
FT   CDS_pept        complement(500440..501366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0429"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: maq:Maqu_1752 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33780"
FT                   /db_xref="GOA:C7RKV8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV8"
FT                   /protein_id="ACV33780.1"
FT                   /translation="MPLANAPTDSPHQAMAAVNAVLLGKNDVVRLAIACLIAGGHLLIE
FT                   DLPGMGKTILALALAKTLGLSFRRVQFTNDMLPGDLTGAAIFVREKGEFVFHPGPLFTQ
FT                   LLLADEINRASPKTQSALLEAMEERQVSSDGITRPLPEPFFVIATQNPVDQLSTNPLPE
FT                   AQLDRFLMRLSLGYPDAAAELAMLRGEDRRHLLERQAPALTIQQLLALQKAARAVHASD
FT                   ALLAYIRQLAEHTRHSAGLAYGLSPRAALALLAAGRAWALLEGREHVLPADIQRVFPAV
FT                   AMHRLDRGDARAADTAAAAILEAVALP"
FT   gene            complement(501502..502974)
FT                   /locus_tag="CAP2UW1_0430"
FT   CDS_pept        complement(501502..502974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0430"
FT                   /product="protein of unknown function DUF1111"
FT                   /note="PFAM: protein of unknown function DUF1111; KEGG:
FT                   lbl:LBL_0763 thiol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33781"
FT                   /db_xref="GOA:C7RKV9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKV9"
FT                   /protein_id="ACV33781.1"
FT                   /translation="MNDASERPVRHWLPVAVGILVAALLALGWAVWKTEYAWRDAYGDG
FT                   DLSELRAADPRALTAGDMTTFHKGFKPFGQAAENLPWQYEKLFDDGDGLFERPFQPAVR
FT                   EIRYNTRDGLGPLYNATACGACHFRDGSVEEPYTSGQGMNGIFLRLSVADGKGGWAAPA
FT                   GYHSQLRDKAVAGVPPEGLGVIDWQEMPGSFPDGEAYSLRKPSFRVLNPGYGRLPDGVI
FT                   FEARSAPRLPGMGLLEAIDEDTLLAIAKSQANHSDGVSGRPNWVTDPETGKRVIGKFSL
FT                   KANVAHLRAQAAGAAFNDMGLTSPLHPRELCLAGQSACAEAPAGGTPEVPELSEEQLQA
FT                   LTIYLQLLAVPARRNLDDADVGLGGRLFAEVGCGVCHLDTVRTGNSHPIKRLRGQTIHP
FT                   YSDLLLHDLGPDLAGRPDGEASAQEWRTPPLWGIGLTRKANHHTVFLHDQRARSLQEAI
FT                   LWHGGEASPAKARFMALNKAGRAALIKFLESI"
FT   gene            complement(502990..504090)
FT                   /locus_tag="CAP2UW1_0431"
FT   CDS_pept        complement(502990..504090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcu:pc1077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33782"
FT                   /db_xref="GOA:C7RKW0"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="InterPro:IPR035163"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW0"
FT                   /protein_id="ACV33782.1"
FT                   /translation="MKTPHLGAWRVVVALLVSPPALADLFASGSMVVFTADGQREIALA
FT                   PAPAPTLTVFTPDGTRAVTIDADWPRIQGNGYLNLSAGYRHDKLSFNIAADRRGGATPN
FT                   VLSELTWEIPAAELRLGGGWTHASGFTAKAYLAYARASSAGKVQDSDYALNDRQGEFSR
FT                   SYADPRDSRMLDASFGAGWRFPVGGLSSITPMLGIARQESELRSRQGRQVLWDSDQAKR
FT                   VGIAGSVPLGEFAGLDSSYQPVWESVWVGLDGEFRPSERLSLRGGVKQHWFRYQAEADW
FT                   NLRDDLSHPVSFRHQGEGTGWQAEVAADWLVVPGHKLTVNLSGGKFTLQDGSDTTYFRN
FT                   GRSVELRLNEVISDTWSARLGYQIDY"
FT   sig_peptide     complement(504019..504090)
FT                   /locus_tag="CAP2UW1_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(504087..506399)
FT                   /locus_tag="CAP2UW1_0432"
FT   CDS_pept        complement(504087..506399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0432"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein; NolW
FT                   domain protein; KEGG: ppd:Ppro_0818 type II and III
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33783"
FT                   /db_xref="GOA:C7RKW1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW1"
FT                   /protein_id="ACV33783.1"
FT                   /translation="MKQGFRAAPFAALFAALAAAQPLAFAQTAGASTGTLPTRTANPAA
FT                   VRPSPLPTGILGDIQLTQVRLADAARMLSQVGKTNVVVTGKVAEQIVSLYLRDTTVENM
FT                   VRNLCRAAGVWYRFDATSKTYVVMSGDEYQKDLAIVRDEQTAVFSLRHHNVVATANALK
FT                   ALFGNRVFLSLPIEEMPPTSLGSGTRTSNNTGNRGTPTTRGAGNRANTGNNGDTGSTFF
FT                   GGASFDQGPSAGSAGPLGSSRGTAAGAAGSAANYDPASDLGRMSQDRLGGQLRLDANGQ
FT                   PLLGMAEIQDMAGRQGPPVYITYNRLNNLLLVRTGDEQALRQIAELVGQMDKQPRQVLL
FT                   EMKILEVRLDNGFRSVFDIGFAGTSKSTGPLPVGVLPTTVPDQYARNAGTTGMFDIEQD
FT                   ATMLWQYMSKSLSLRFQLLAQENKLKVLSSPMLVAANNHPARLFIGDERVLTVGASSQS
FT                   ITGTTGATNTQITVETERRDVGQTLSILPRINGDRSVTLTIDQDSSTVRLRDGTIPIAT
FT                   GTGGVVYFPIDTVSTANLQVTAHAQDGMTVAIGGMIRDSLERDEEKVPVLGDIPVLGYL
FT                   FKRDVRASIRSQIVLLITPRVLESPLEANSVAQVKTQDFNALTATIPSTPVIPALVNNP
FT                   PAVPPSAIAGGRDGDVAFAGLARAAAAAVRLQDPTAPPPEGLIAVPLNDHGRLSLANGM
FT                   EARPSASWQRDGLYVTALQVISMSAQPSTLAPTMIPGRWAAMVLESSKLTPAGSAGSWT
FT                   WAYAISRRPFEQSLGQP"
FT   sig_peptide     complement(506319..506399)
FT                   /locus_tag="CAP2UW1_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 27"
FT   gene            complement(506396..506992)
FT                   /locus_tag="CAP2UW1_0433"
FT   CDS_pept        complement(506396..506992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33784"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW2"
FT                   /protein_id="ACV33784.1"
FT                   /translation="MKPAEPLGQVGALLLLTLSALAPAAHAQNRALDLAHDKTTDLHPT
FT                   LRAGLGTLGRYADTVTRQTKAVAGSHQGEAPSSERAGQVLPPAPAPAGRRGEPGNDPFE
FT                   VSPQLREGRSTNRFTGLPGASILELQKQVQLRALIITPQGRAVQLFVRGAETITVMDKE
FT                   LIDLGSLGTFLVHIERDGVTLYNPSLPQGKKVVLR"
FT   sig_peptide     complement(506909..506992)
FT                   /locus_tag="CAP2UW1_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(506989..507453)
FT                   /locus_tag="CAP2UW1_0434"
FT   CDS_pept        complement(506989..507453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33785"
FT                   /db_xref="GOA:C7RKW3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW3"
FT                   /protein_id="ACV33785.1"
FT                   /translation="MGMHGFIMHKYVLLLHVLAATVWTGGHLVLALAVLPRVLRERSPA
FT                   DLLRFESAYEKVGMPALVVQVLSGVWLAWNLVPDPGAWFAADNFVTRLIGLKLGLLAAT
FT                   LALATDARLRIIPQLSTDNLDAMARRIRLVTALSVLFVVAGVTFRTGAWA"
FT   gene            complement(507461..508693)
FT                   /locus_tag="CAP2UW1_0435"
FT   CDS_pept        complement(507461..508693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0435"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   ppd:Ppro_0816 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33786"
FT                   /db_xref="GOA:C7RKW4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW4"
FT                   /protein_id="ACV33786.1"
FT                   /translation="MATFSYIGLNPQGKELRGQIEAGDLAQARRVLRDQGLRVLELFAG
FT                   TSGGRSPRERLCELWRLLRSGLSVRNSDLMLFYRQMQLMLRAGHTILEALEAAGRLSAR
FT                   PRLSSLLDRCAQRISAGSSFSAALARESSTFPRLAVKLAEAGEASGELDAVFERLAVLT
FT                   EKRADVRRQMMTALTYPAIVTLVSIGVISFLVGSVVPRFAVFLQARGKAVPWAARTMME
FT                   MADWLGRWGFTLVMALLGLVVGFIALRRLPAARLLVDRLMLSLPVLGGTLMAASLAQVA
FT                   WTFGLLLKSRLTVLEALRSVAQVAGNAALTRALQLAAEQVLEGRALTVALARAPIPPLL
FT                   QHMAAIGERSGEMEAVMEALGNHYQKDLDARVKLLSSLIEPLLTLLIGGIVGFVYYAFF
FT                   QAVLAVSTGGG"
FT   gene            complement(508704..510311)
FT                   /locus_tag="CAP2UW1_0436"
FT   CDS_pept        complement(508704..510311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0436"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: ppd:Ppro_0815 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33787"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW5"
FT                   /protein_id="ACV33787.1"
FT                   /translation="MIVNEAALINAGLQAGLFDRELVNRLRSQARIARQSLLDALSHEL
FT                   RLPRTSFYLALAEAHGLPYAPLDTWILDRASATRLPGTLIKRHPMAPMRTPEGTLYLAI
FT                   SDPADQIGVDTARRILGAGTPLAVAEPEAIAPLLAQFAPGEARDTTGDEPVALFERLVR
FT                   EALLRRASDIHIESIKEGTRVRLRVDGRMQAWGALLPRQLGEGMISRIKVLAGMDIAES
FT                   RAPQDGGLNYPANDGSDPMEMRVASVPAKFGERLTLRVMQSDPERQTLAALGMPPVMVE
FT                   RLQKALAHPHGIVLVTGPTGCGKSTTLYAVLRELDANALNILTAEDPVEQVIAGITQVQ
FT                   VSGKVDFAGALRSFLRHDPDVILVGEIRDFATADVALKAATTGHMVLSTLHTNTAVGAI
FT                   TRLADIGCERFLVGATLHGVIAQRLVRLLCTHCRQARAPTVDEGRLLGVRERDGCHIHE
FT                   PNGCPRCLGTGYRGRVGLFEALWLDGELAERIANSAGERELAQAAGGYWRLADDARDKV
FT                   LRGVTSLAEARPYLHPGL"
FT   gene            complement(510308..511414)
FT                   /locus_tag="CAP2UW1_0437"
FT   CDS_pept        complement(510308..511414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0437"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: ppd:Ppro_0814 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33788"
FT                   /db_xref="GOA:C7RKW6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW6"
FT                   /protein_id="ACV33788.1"
FT                   /translation="MTHASLSPANAHAALDALLATVVDKQASDLHLAGGRPPYWRLHGA
FT                   VAPMSATVWPHAAMHELLTALLAAGQQRDLADKGSVDLGYTSRAGERFRINVFRSLGEL
FT                   ALAARHLPARCASFTELRLPESLRDLAHLASGLVLVTGITGSGKSTTLATLINEINSTM
FT                   PAHILTIEDPVEFVHRPAQAIITHRELHTDVPDFAGAVRAALREDPDVILVGELRDNDT
FT                   MRAALMAAETGHLVLSTLHTADATGAVERFVGAFPGQEQSVVRHRLSLVLKAVIAQQLL
FT                   PAVGRAGRVAAVEVLQVTPAVANLIASGRTAQIYSAIESGRDSGMQTFDQALAGLARDH
FT                   LIAVDDGRRLARDPLGFDRLLRNGRGAG"
FT   gene            complement(511418..512143)
FT                   /locus_tag="CAP2UW1_0438"
FT   CDS_pept        complement(511418..512143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33789"
FT                   /db_xref="GOA:C7RKW7"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW7"
FT                   /protein_id="ACV33789.1"
FT                   /translation="MQENQTRKTLRLRLRHLRATLRRLSDKDKNTYAAVAAALCLALYF
FT                   GLIWPRGHTRLSQLAYELEKQATRDKLAAKQPARPPAPLPSLGGKNLVEARRELSELHR
FT                   QVDETRNEVARLNGSFVPLDDSLAMNALKTGLTSLAEAGDMEVLALEHVYLRNEDKERA
FT                   PTSQMVHEAAQGNPFKRPLIVMRARASYHGLMQFLDGLSRLPYVAAPVSSDISVQVERH
FT                   PETRAPVRQWLDVQIRFAV"
FT   gene            complement(512151..514055)
FT                   /locus_tag="CAP2UW1_0439"
FT   CDS_pept        complement(512151..514055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33790"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW8"
FT                   /protein_id="ACV33790.1"
FT                   /translation="MTGISEDRRPAASAHAVAVADGKPVPRRWLAKAKARASAARARLA
FT                   SLRARLGAGEQPWLLLAWDIASLKAAVHVGAAGTSRIVATAESKQARFADALDEVRTLL
FT                   AGQSGVSPRRVALAARTLLPGVIDLPVAPDKPRPARQMRELLQSELEPILAEFGGLWSL
FT                   GALLEARGHLSPVDRERVTLEEAVRREGRRTPLRYGETALEMALIDRAGLDECLELQGH
FT                   LQNLDGDVVAGWRGRFAAGRPLWLGCGVAAGNHRHWREALAERNLCLTVCLPLAWLVSE
FT                   PTSSGEDRRDGAVATICLELHREEVVAVHRQDGAVLATRSEGRLERRLRPDWLARLLSE
FT                   WNSETRCSLELVCLHADDEAAAQGICDDLSLCTGYPARLRTAGETWQGVWFTLASEAAS
FT                   QASRLPRIVERELRDSLWKSHDFRRLAGIGVLVAALGVIEGVQQYRLYRLNATVAERSR
FT                   LEREKSQTSQRESQFTAELNELAASLDASRRQLEPLVNDRERLTAIVAMRQKLPDLLQL
FT                   LAEAVGTDAVLDSLRNSKVGSNATSVQVVAWSASYTGAQAFVGRIAERTHALGYAVAQT
FT                   EIVERKGRNNKLGHEVSFWLVPAGDDLESALPPAQAATGKPPANPAGGISAGSTAVRP"
FT   gene            complement(514052..515134)
FT                   /locus_tag="CAP2UW1_0440"
FT   CDS_pept        complement(514052..515134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33791"
FT                   /db_xref="GOA:C7RKW9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKW9"
FT                   /protein_id="ACV33791.1"
FT                   /translation="MMHISATPVRSGESIESVRSIGRGFTLIELLVVVAILSAASLLAF
FT                   GIVTEDRAQIRYDDTRLRLQSLRRAILGQLGPVNPDVVGGFVADNGDLPSDLATLLRSG
FT                   SLLAQGVQSPLFDPVPDAATCANNGGETPLSDSGAVLVKGHRGDYLGGLSLNGRFRDGW
FT                   GNESSDPATDALNFGWSLEGASPSLTVASLGNDNAAGGSDFAADRALRITASDWQVPLQ
FT                   GWSVRLVARTDIPATQPLSVSLLVFRNTAAGGQWRRYSTPLSSVCLDGNGDGLVGGSAC
FT                   PQSSVTLSFTANCKAGDTSSGDTFVPQGRHLLLVTGHTGALWSSGDSPYWDTPINTRQS
FT                   VARIDAVAGMALPEARLELR"
FT   gene            complement(515143..515670)
FT                   /locus_tag="CAP2UW1_0441"
FT   CDS_pept        complement(515143..515670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33792"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX0"
FT                   /protein_id="ACV33792.1"
FT                   /translation="MQASPFLQVPARAAARLVVGVLLTSLASASLAVDASPAGRAALTA
FT                   APSSDPAASYRDVDLKKLVAGSRTEVPGQRVIFAPSPIKFRATLAALPAPQKADYLLAA
FT                   LAMMKISNPPKVSQRIGLDYGGDRALAAYIDDAIADRLANEAKPGQVLTFYAFHVYNHS
FT                   RGPALLVTSFAD"
FT   sig_peptide     complement(515572..515670)
FT                   /locus_tag="CAP2UW1_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.760 at
FT                   residue 33"
FT   gene            complement(515688..516608)
FT                   /locus_tag="CAP2UW1_0442"
FT   CDS_pept        complement(515688..516608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33793"
FT                   /db_xref="GOA:C7RKX1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX1"
FT                   /protein_id="ACV33793.1"
FT                   /translation="MALSKAGDLRDCGFTLIELLVVCGILAALSYTAWGTYIGIQEGAE
FT                   DEIARAEMQRLADGLRRFKADTGYYPGQGPFVLSSPGTLETAVSATRIDCTPVGGILRT
FT                   WAAPNLDADRDAWFASPVNLALLLEAPALCGNHPLAHLNRWSPDARRGWHGPYLDSKSR
FT                   LWVDHGADFNASTVVFTAPDGTGSPLAGAKLLDIPAFGVGPRYRAAGPSWSTCSSQAAI
FT                   TGNCMLGWREVTRESIGYDASRHELPARARPFAVFGLANGDHPRIVYWGRDGRYGGRNT
FT                   ADPCRPNLSHPDDYGDDDQVLCLND"
FT   gene            complement(516727..517665)
FT                   /locus_tag="CAP2UW1_0443"
FT   CDS_pept        complement(516727..517665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33794"
FT                   /db_xref="GOA:C7RKX2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX2"
FT                   /protein_id="ACV33794.1"
FT                   /translation="MLNKLMAMTKAELKSTIQAIDATAVKGRALRRQLASIKKKEGGFT
FT                   LLELLVVVAILAAIAGTATIMLQDTDRKGSAAAHVAMMDELSKGIQTFRVLNGGNYPDN
FT                   FDSLLKNATNTLAGATGLAPLLSADLLGNLTLSTITAADVAALNSVGITTARVIDTTAT
FT                   PDGGTATDCATGAAIQALLASKVGNTTPQNIFRPVAANGCGFAANATLTAGDVAYVWAS
FT                   AGNLRVNAGAADKLVAFGVGPDSTLFNPSTIGALSNTPVYRHVANTEYNRFIVLWNVST
FT                   TGGQATFQAIVDGAGDTKDEELGEVDNVRRT"
FT   gene            complement(517843..518052)
FT                   /locus_tag="CAP2UW1_0444"
FT   CDS_pept        complement(517843..518052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33795"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX3"
FT                   /protein_id="ACV33795.1"
FT                   /translation="MEAPGRSAALEATNAAVLIKLNELYKEAIAHDGFAEIKVEIRILR
FT                   RGQKEVILHCGKQYRFVVDYAPGN"
FT   gene            complement(518497..519474)
FT                   /locus_tag="CAP2UW1_0445"
FT   CDS_pept        complement(518497..519474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0445"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="KEGG: eba:ebA4678 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase; cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33796"
FT                   /db_xref="GOA:C7RKX4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX4"
FT                   /protein_id="ACV33796.1"
FT                   /translation="MSNWYADNSLSIGRTPLIRLNRVADGATATLLAKIEGRNPAYSVK
FT                   CRIGAAMIWDAEKRGLLGPGKELVEPTSGNTGIALAFVAAARGIPLTLTMPETMSIERR
FT                   KLLVAYGAKLILTEGAKGMSGAIARAEEIAAADPERYVLLQQFKNPANPAIHESTTGPE
FT                   IWDDTDGAIDIFVSGVGTGGTITGVSRYIKTTRGKPIVSVAVEPTASPVLTQARAGEPL
FT                   KPGPHKIQGIGAGFVPQVLDLSLVDVIEQVSNEEAVDYARRLAREEGILCGISCGAAVA
FT                   AAVRHARKPENAGKTIVVVLPDSGERYLSSILFDGIFDANGQAL"
FT   gene            519788..520579
FT                   /locus_tag="CAP2UW1_0446"
FT   CDS_pept        519788..520579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0446"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mpt:Mpe_A2852 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33797"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX5"
FT                   /protein_id="ACV33797.1"
FT                   /translation="MDMQLRNRLALVSGSTAGIGYAIAAALAGEGARVIVNGRTQAAVD
FT                   TAVTAIRSATGSDVLGFAGDLSTADAAAALVRENPDIEILVNNLGIFEPQPFADIADAD
FT                   WMRFFATNVLSGVRLARLCLPAMRRADWGRIIFISSESGVQIPAEMIHYGVTKTAQIAV
FT                   ARGLAESLAGTGITVNSILPGPTRSRGVNDFVDALAKAEGQSFAEFEKTFFAQVRPTSL
FT                   IKRFATPEEVAALVTYVASPLASATTGAALRVDGGVIKSAF"
FT   sig_peptide     519788..519862
FT                   /locus_tag="CAP2UW1_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.612 at
FT                   residue 25"
FT   gene            complement(520612..521028)
FT                   /locus_tag="CAP2UW1_0447"
FT   CDS_pept        complement(520612..521028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33798"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX6"
FT                   /protein_id="ACV33798.1"
FT                   /translation="MKLMIRVLAVLAAVALAIPSSHAQTLTGTQARKSAQADAFLAYEK
FT                   ALLAGGLDAAQPYMTAAKFEELNGMLKTWGEDGFKQFLDRMRGGAQGEARRKQIEKVEL
FT                   TGGYAVLEARDSPQVLTVQHLTKTKDGWQVDVRR"
FT   sig_peptide     complement(520957..521028)
FT                   /locus_tag="CAP2UW1_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(521253..522761)
FT                   /locus_tag="CAP2UW1_0448"
FT   CDS_pept        complement(521253..522761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0448"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0977 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33799"
FT                   /db_xref="GOA:C7RKX7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX7"
FT                   /protein_id="ACV33799.1"
FT                   /translation="MKSIIARPDAVMAGSAEHRPAARWALASLSLSMLLSSLGTSIANV
FT                   GLPTLAQAFGATFPEVQWVVLAYLLAITTLIVSVGRLGDITGRRRLLLAGILVFTAASL
FT                   LCGVAPTLWLLIAARAAQGLGAAIMMALTIAFVGETVAKEKTGSAMGLLGTMSALGTAL
FT                   GPSLGGVLIAGLGWRAIFLVNLPLGILTFLLAHRYLPVDRRKPKTDRASFDHVGTLLLA
FT                   LTLAAYALAMTLGGRESAPVNLPLLLTAAFGLGLFVLAETRAASPLMRLAMFRDAALSA
FT                   SLAMSALVSTVMMATLVVGPFYLTRALGLDAALVGLVVSVGPLAAALAGVPAGRLADRL
FT                   GAQRMTVIGLAGMAAGAFTLSRMPAAFGLPGYIAPITAITVGYALFQTANNTAVMTDIR
FT                   PDQRGVVSGMLNLSRNLGLITGASVMGAVFALASTTNDITMAHPEAVAHGMRMTFAVAA
FT                   ILIVVGLAMALGSRNRAGRASLHATPQTSPLPLTNDLARPGRLR"
FT   gene            522908..523840
FT                   /locus_tag="CAP2UW1_0449"
FT   CDS_pept        522908..523840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0449"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pna:Pnap_1659 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33800"
FT                   /db_xref="GOA:C7RKX8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX8"
FT                   /protein_id="ACV33800.1"
FT                   /translation="MSTADLNLLVTLDVLLAEGSVARAAQRLRLSPSAMSRALARLRAT
FT                   TGDPLLVRAGRGLVPTPRALELREQVGPLVQAAEAALRPVEKLDLERLVRMYTLRTSEG
FT                   FVENFGPDLIARVAEQAPGVRLCFVQKSNKNSAPLRDGSVDLETGVVGKATAPELRVQA
FT                   LFRDRFIGVVRMGHPLSQGEMTPHRYATGKHILVSRRGFDRGMIDEALKPLGLERQIVT
FT                   IVSGFSTALVLARASDLIASVPERHTAKLRAGMHSFPLPIATPEITVSLHWHPRMDADP
FT                   AHRWLRGCVREVCGERLIRPSIDGGSAAG"
FT   gene            complement(523803..524450)
FT                   /locus_tag="CAP2UW1_0450"
FT   CDS_pept        complement(523803..524450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3601 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33801"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKX9"
FT                   /protein_id="ACV33801.1"
FT                   /translation="MMSVQATEVRHIRRHRHRSQAQRPAAAYGYTTGILSARESKRATR
FT                   HSVACRFIAARSHSNHDGLATLRRRFPDERSGLCLPVPVMARDMQVPEPVEHWNALSGH
FT                   GHGGHTRCVTRPISNAMSTISTSIRPSTARSGNRPPGCARRCMRPLNGESSALTGGSVN
FT                   EGASRGARQRRMVLGFVPQPNLRLVRLLDDCRRRSFPQWHFSLRQSLRRSMA"
FT   gene            524709..525947
FT                   /locus_tag="CAP2UW1_0451"
FT   CDS_pept        524709..525947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33802"
FT                   /db_xref="GOA:C7RKY0"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY0"
FT                   /protein_id="ACV33802.1"
FT                   /translation="MFGNKLRIGRGSCRDGKVAILIRTAVAGLAVSLLMHATSLYFGQG
FT                   SSIAAGSKPPALMTYPNQVVRTDKPGQIGLWIEGEDWQLRVDMPGFVDVEWPFTSPSQF
FT                   LYMTNPILQTPVSIFAERVAGADSEESCRRHYAASFEQAHEAKARALGDRGTTGPLSEF
FT                   SANGKILQAYEFGVGSDYHAKALHWLPYYQGFCFDFHFTVSSPSAEKEVLRILDSVTYL
FT                   AQKPRNTDVERLFYLYHFRIRLSVPIDWRWGFRPPPGGPIGGIELRQPEKGEVFSFLIS
FT                   PLGTVKSAEDHTVDMTKERRQSKLERGEVLSPVRSKCSAEVCFSYYDVTIRGDEPQYSQ
FT                   GFATYGLRYHRDGFVRLGDSIVGISLLYSDGGTAAADHLTEKITQAKVLDLKEFRNKVE
FT                   RGDVKELMKKIPK"
FT   gene            525997..527808
FT                   /locus_tag="CAP2UW1_0452"
FT   CDS_pept        525997..527808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33803"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY1"
FT                   /protein_id="ACV33803.1"
FT                   /translation="MEIGGYKGAEEEMIFSSWLGDIREVIRPRQTAAARAIRITRLALL
FT                   FGVVLRVACGLAWASEEDASKSGTASFRVFPNQVFTTGKPGQLGLYIGGEDWHLLIDMP
FT                   GYERISEVGKPPEFFMPEHFLFMRHPASGTTASILAEKVPGADGERACREWHAPYTSKA
FT                   RDQTARHVGNRGTVGKVVEVERHGKRLQVFDSEDRQFGPRQAIFWFPWYRGHCFDIHFN
FT                   VTSPVAEEEALKIFDSLTYVPGKPVGVEISRGFGFAGRTLMRLSVPIAWQYRHRPGPPG
FT                   PVGGAELLPSSTPIASFLVFPLGTRSPGVRERSLHDEVEANRRSIERRMQFVSPVRQVC
FT                   STGTCVYFFDLSVGPFLSSDPHSYEYHRQGWADFDGRIMGLSLLYRDDSKEDAQRMTEA
FT                   FSRAQVADLAVSSPRPAATCSNPAALSAGKKLVFTTGQQGQLGLHLEGEDWHLLVDMPG
FT                   FEPDDSGAADCTDVFLGMSNQSTGIKVSVAAERVDGPTDAESCRRHYATRLQQTRDAIA
FT                   RDTPESGIVGPVVDVEMNGKIVQLVKARPPKSQVGGPDVEVKLLNWFPYYRGFCFTFFL
FT                   VFQAAEAEKEVQRFLDSVTYVNHPPPR"
FT   gene            complement(527853..530057)
FT                   /locus_tag="CAP2UW1_0453"
FT   CDS_pept        complement(527853..530057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0453"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   afw:Anae109_0984 protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33804"
FT                   /db_xref="GOA:C7RKY2"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY2"
FT                   /protein_id="ACV33804.1"
FT                   /translation="MPDATPPGADPLAAELQARLAGAIALRGPAYVPRTHHLDADGRPL
FT                   FINRLALETSPYLLQHAHNPVNWFPWGDEAFAEARRLGRPVFLSIGYSTCHWCHVMEAE
FT                   SFEDEAIARFLNRHYVAIKVDREERPDIDAVYMSAVQQLTGAGGWPMSVWLTAAREPFF
FT                   GGTYFPPRDGGRDGQRGFLPLLGALSDTFHRDPERVGQACTALVEAIRHDMQGAYGTGG
FT                   ADAAIGLPAGDVIDATVAHYRQSFDARHGGLSRAPKFPSHIPVRLLLRYHQRTGDADAL
FT                   RMATLTLEKMAAGGLYDQLGGGFHRYSTDVRWLVPHFEKMLYDNALLVVAYAEAFQVTD
FT                   RADFARVARETCDYILREMTDAGGGFYSATDADSEGEEGRFFVWREDEIRRELDALGDG
FT                   DTTEHFLAHYDVHPGGNWEGHTILNVPRPDEAAWEALAAARARLYAVRARRTPPLRDEK
FT                   ILAGWNGLMISALAVAGRVLDAPRYVAAAVRAADFVLTHLRGADGGLRRSFKDGQARQA
FT                   AFLDDHAFLAAGLIDLYEATFDVRHLRDALALAETTEHLFADPAGAWFMSSEAHESLIA
FT                   REKPAYDGAEPSGTSVALLNALRLGVLTDDERWRQIAERGLRAHARVLGERPIAMTEAL
FT                   LAVDFLATTPRQIAVVWPDSAAAAAAPLLAVVGRHFLPARALAAAPESAVAALAQTIPF
FT                   VGDKVAQGGRPTAYVCRHGRCKLPVSDAAGLEAQLREAGS"
FT   gene            530375..531310
FT                   /locus_tag="CAP2UW1_0454"
FT   CDS_pept        530375..531310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0454"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; KEGG: rfr:Rfer_1610
FT                   putative uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33805"
FT                   /db_xref="GOA:C7RKY3"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY3"
FT                   /protein_id="ACV33805.1"
FT                   /translation="MPPASPVLAAEITEIAAGLGAAPATISPKYFYDAAGSVLFERITR
FT                   LPEYYLTRTERAIMQAHGEEIGRQVGRGATVIELGAGNCEKARRLCALIEPGCFVAVDI
FT                   SADFLHQAVDGLRAAFPALDVRAVVTDLLGELALPDDIPADRRLVFYPGSSIGNFDPPA
FT                   ALALLRRMRALLGEDGALLIGVDLVKDAAVLEAAYDDAAGVTAAFNLNVLTHLNRLLGA
FT                   DFDLAQWRHRALFNRERSRIEMHLEAYADTLVTWPGGSRHFRRGERIHTENSYKYPIAD
FT                   FAGLLERAGFASRSCWTDSGHAFAVLLARP"
FT   gene            531333..532604
FT                   /locus_tag="CAP2UW1_0455"
FT   CDS_pept        531333..532604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0455"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   aav:Aave_3090 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33806"
FT                   /db_xref="GOA:C7RKY4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY4"
FT                   /protein_id="ACV33806.1"
FT                   /translation="MNANDLAARYRLVRDASLALTAPLSAEDCCVQSMPDASPVKWHLA
FT                   HTTWFFETFVLERWERDFKPFHAAFRVLYNSYYNAVGDKHPRPQRGLLTRPELAGVLAY
FT                   RADVDRRVQSMLAERAADSHPDADADLAALLTLGLHHEQQHQELILTDLKHLFSHNPLA
FT                   PAYAVRPAAAEAAPALSWHDVPGGIVEIGHAGTGFCYDNEKPRHRVFLEPYRLASRLVT
FT                   NGEFLQFIEAGGYADPVHWLAEGWDWRLAENRRQPLYWQRPEDWQEFTLGGLVPLDRQR
FT                   PVVHVSYYEADTYARWAEARLPTEAEWENAAATLPLAGHFAGRREFHPAAAGADGLAQL
FT                   FGDAWEWTRSSYEPYPGFRAGAGAVGEYNGKFMVNQYVLRGGSCVTPDAHVRASYRNFF
FT                   PASACWQFSGIRLARDVEQAGSSG"
FT   gene            533328..534455
FT                   /locus_tag="CAP2UW1_0456"
FT   CDS_pept        533328..534455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_2578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33807"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY5"
FT                   /protein_id="ACV33807.1"
FT                   /translation="MGKIVDGGLATMQRELPNMIAAFRASRPQAIRPGDLEGQLASEGG
FT                   QTACHNGATDGARVVLRGDQNDSVCWGNLQRRLLRTSGQRSTMEANGMTGPCCQRLFVA
FT                   LLAASSALPLYAYDPLNRVEYLAKIKEAKAYYDEKCEKVAGIRIHRTVPDIEGLLLLKI
FT                   RPERRSRELADPMWPGAAFGREATGDSYITSFLGYEYRASKNGEMSPWRGYIGTTRNPG
FT                   GLPGYRWVEVIDEKDGQRYRYSGSVKAAGKKNPDAYRAELENDPAYDMNTYRWSLDKIP
FT                   SPSKTSPRYAVTFEDHVIPDERALWVASSTVKVLDLKTHEVLGEMTRYAISYIHAPHHS
FT                   MPWLNHSICPTMQMTGDLDSSRKFVDQILIPMKEK"
FT   gene            534458..544924
FT                   /locus_tag="CAP2UW1_0457"
FT   CDS_pept        534458..544924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0457"
FT                   /product="Hemolysin-type calcium binding domain protein"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; Ig
FT                   family protein; Haemolysin-type calcium binding domain
FT                   protein; SMART: Dystroglycan-type cadherin domain protein;
FT                   KEGG: ppd:Ppro_2370 Ig family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33808"
FT                   /db_xref="GOA:C7RKY6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR010566"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY6"
FT                   /protein_id="ACV33808.1"
FT                   /translation="MAAPTPAEMLKYANLQLAAEALYDFRAKLTPSQTPGDLISTEGHY
FT                   FDAIRPDILTTGNEHASRFAPTEAEKFVKDWIVIDHLSNTTTGFSGTLFYNEAEKQYVL
FT                   SIRSTEFIDDTLRDSVATNAMEIKEFGWAFGQISDMEAWYAQLTKPGGPLEGKHFSVTG
FT                   YSLGGHLATAFNLLRHEDGSAGNVDRVVTFNGAGVGQVGFPLSQVINDFNALRAAPESI
FT                   AARFSDAGLGTLYQTLRERLSDGHSPTADDYALLHTVSAAATDDVGLARFASERKQLSL
FT                   ALDRLKNIKQAVTLLAEVTDTKDGQPAAIPERVVAQARFEYQMALLVAQEFKTTAKALL
FT                   PAAINIVLGKSDGAPRLDNQFDVVGRETTTLVTAMVADSQWHHGANVDVFIEDQPLVRG
FT                   TIRKAAAGVYWDTGALMPINNYTQNDFGDTHSIVLLIDSLSVQHLLQTLAPTATQADIE
FT                   TLFKAASVVKAESTTGTQGRAEGDGLETLLDSLLRVFTHDDPELRQGKAKNGNGLLTGG
FT                   TWADESLRETFYDKLKALGDSPAFKEAKGKLTLTLPGRDLATAARSDFAAFLTLHTGSS
FT                   FALKAVPGQESTLEAALKAQWTAEYTAWKADQDLTPEQRANLEGTYTDRYLADRAAFLA
FT                   RLAQARLANTGEGQALRVTTLDTGLRHFKDEASGLSLQEVHALTGAAARARVVFGGDGN
FT                   DSVVGETGEDAFYGGAGSDQLDGGAGDDILEGNADADELRGGAGRDTLLGGQGNDRLEG
FT                   GDNNDTLVGGQGDDTLVGGDGEDTYVINTGDGNDHIVDTGMNFIKYNGRLVTGLFLKST
FT                   DSDDYTFAGDDGFVMRFHSPGVLTLDDTTSLTFDNYTSAEAFAASNFGIRLAQAPDASR
FT                   VTRTIVGDLRLIDLHHDDLFNYVGDPSAPAPGATDLMHNSPGNDRIILGDGFNMALAVP
FT                   DAAGYTQNYMTQRSGDDWISGGMNVDFVAGGTGRDYIEGGAGGDDLLAGGDADDVIFGD
FT                   LAATLAVQIREAGNNEPGDLVSGQGGNDALYGSSSSDLIYGGAGDDFLGGLGGDDFLLG
FT                   DVDFFLYGVWDVRRDGLNFIFDFTQILSSSRGDQYQEGPAGSGNDVIMGDKGNDAAWGG
FT                   AGNDYIDGGSDNDTLRGGDGNDRLKGGDGEDFLSGGADDDTLEGDAGNDTLIGDGGGDE
FT                   LHGAAGNDELHGDTGDALVTEQGDDRLFGDAGDDYMRGYGGNDTLDGGAGHDDLSGGGN
FT                   DDVLDGGEGNDTLFGDDGLDTLLGGTGTDYLDSGADDDLLDGGSGNDALRGGDGDDLLD
FT                   GGSGSDGLRGGDGADTLIGGTDTDYLEGGAGDDIYLFAAGDSPRDADGFVEYVVDAEGD
FT                   NTIVFSNATPTDLRIANSGGSLLITYGTNDQLLIKDGLAGSIGHYRFANGETLSYSELI
FT                   GRLVDTPMGAASGGRSFWFGGSLDDYLVATDGHTTFSGGRGDDTLIGYGGRNTYLYSRG
FT                   DGTDRIIDTSTKTDADGTALPNTLRFGAGITADDIRLAIGSLKILVGSNPDDAIHIDGF
FT                   DPDDALGTKKPPAIDRFEFADGTALSYGELLARGFDLTGTTGNDTLTGTSVNDRLDGGA
FT                   GNDSLRGGAGSDTYFWGLDSGNDTIDNSDSSLDTDRLIIGNGLLADDLIFARSHDDLVI
FT                   RVRTSGEHVLVLRHFAGAPIDRVRFADGSEWNGAEIATHLSTELSEGADIYTATLASDT
FT                   IDALGGDDLVDGLAGDDVITGGRGNDTLRGGAGSDHYRFAVGDGSDLIVDDDVTADHAD
FT                   VVEFLDVASSVVTVTRPHNGNDLVLAYGGSDRLTIQAYFAGASHQIEEFRFADSVRWNV
FT                   GDLQERVLVTGTAGKDVINGQAGTDNRLYGFDGDDSLNGAEVADTLAGGRGNDRLAGGF
FT                   GADIYLFANGDGADVINETNDTNGTVDTLRLTDLAAAAVSELARVGSDLIVRLGGSDQV
FT                   TVRQQYNAATSAGIEQITFADGLTWTADDIKARLSTLGTSAADSLTGFDGVGNRLFGFD
FT                   GSDTLSGGDRGDLLDGGNGNDWLEGLAGADTLVGGAGNDVYDIDDANDLIIEHAGEGRD
FT                   TAYSWVSFDLASQGSGVEVLTLLGSNPLGAAGNELDNVINGNAAANVLKGGAGNDTLRA
FT                   YGGSDNLDGGSGRDDLWGGEGDDTLDGGTGDDTLSGVFGADTYLFRRGSGTDRIIDDRR
FT                   LGAPVDRDNIRFDEGIRMQDLTIAVLSDESWQLTLAGSSDSLVFVKDAGSRFADGQPVI
FT                   PIESLQFADGTRVDLTGALVGTAGADRLAASFFAIPTFGPVTTATINVRIDAQAGNDTV
FT                   TGGGGNDSLRGGDGDDVLYGDSGSRSSSDDQLYGDAGDDTLYGGSSMSAREGADLLDGG
FT                   AGNDLLYHASTVRYGRGYGQDRVIGKVERIDLFDLLPSDVTLQYQPDGLYFRVKDSADW
FT                   LKLEADGRRITVEQVNFANGSSWDRRAIEAMAATQGNLAPQADVPLLPVSAREGEAFTV
FT                   VLPEIAFRDPNPGDLLTWSVNLPDEPAWLRFDPLTRTLSGTPTNADVGSHDLFVTAADR
FT                   SGASASQALKVIVADVNQAPVVNAPIETLTFREGMPIRWTIPSDTFADEDPGEVLTLHA
FT                   ALTTGDPLPSWLAIDARTGDISGIAPVGARGNLNLRITATDRAGASVATPLTLQIAAAS
FT                   PAALLGTANKDVLVGTSGNDLLNGAAGADTMRGGDGDDTYVVDERGDTVVELANQGSDT
FT                   VWSLVSHTLADNVENLVLAAGASINGTGNALRNRLTGNSGNNVLDGGAEADTLEGGTGN
FT                   DTYYVGDKDTVIEAADAGKDTIVSGIRWTLGANVENLTLTGTAAINGYGNDLANTLRGD
FT                   TNSAANVLTGGLGDDIYYLGAGDRVVEDADQGNDSVYGYATEHTLAANVEHLFLAVATA
FT                   ATLTGNDLANRLRGNAGDDRLAGLAGNDTLDGGLGADTLIGGTGDDSYTVDNLADAIHE
FT                   DADAGFDTVYSSVTWTLGEHLERLYLTGGTAIDATGNARANTLYGHANSAVNILSGGLG
FT                   DDIYYLGAGDRVVEDADQGNDSVYGYGSEHTLAANVEHLFLAVATAATLTGNDLANRLR
FT                   GNAGDDRLAGLAGNDTLDGGLGADTLIGGTGDDSYTVDNLADAIHEDADAGFDTVYSSV
FT                   TWTLGEHLERLYLTGGTAIDATGNARANTLYGHANSAVNILTGGLGDDIYYLGAGDRAV
FT                   EDADQGNDSVYGYGSEHTLAANVEHLFLAVATAATLTGNDLANRLRGNAGDDRLAGLAG
FT                   NDTLDGGAGNDVLEGGAGNDTLQDSSGSALFTGGAGNNTLSGGAGSQIYLGGTGNDTLR
FT                   TGPGNDIIAFNRGDGQDTLAAGDSGQDVLSLGGVVAYTDLSLDKVDRDLVVTIATGDQI
FT                   TFTDWYASAPGAASRSVLRLQVIAEAMADFDAGGSDPLRDERVESFDFGGLVDAFDAAR
FT                   AATPTLTHWALADALSRHQLAGSDSAAFGGDLAYQYGRSGSLAGIGVTPAIGILADPAF
FT                   GGAAQALTPLAGLQSGAQRLA"
FT   gene            545111..547264
FT                   /locus_tag="CAP2UW1_0458"
FT   CDS_pept        545111..547264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0458"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: gur:Gura_2547
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33809"
FT                   /db_xref="GOA:C7RKY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY7"
FT                   /protein_id="ACV33809.1"
FT                   /translation="MQLTTEMRRDEVLWLLGSLCSVFRIPFDATLLAQACPPPTTLATL
FT                   HEAARALGLKTGGCRIDGADWQRLPLPAIALLKPATATGAEAPRPHGAILVVKASAEQI
FT                   LYFRPGSQSAVALPIDEALQTLEPEVVLVARQSAGGDEGDIAGFARERQTFGFRWFLPE
FT                   LLKHRQIWRDVLLASLAIQLVGLATPLFTQVIIDKVIVHQSDSTLLVLAVALGMFMLFT
FT                   SGMTWLRQYLVLHTGNRIDAVLGSEVFRHLLHLPLRWFEQRPTGTLVARLQGVETIREF
FT                   VSGAAITLVLDFPFLVIFLVVMFAYSWQLSLIALALLGAIAVASVLVTPVFRARLNRQF
FT                   MLGARNQAFLTEYLSGIATVKSLQMEPDLDRRYGDLLAQYLAAGFASKQVGNTYQVVAN
FT                   GLEQLMTLAILIVGALLVMRNDGFTVGMLVAFQMFASRMSQPMLRLVGLWQEFQQADIA
FT                   VKRLGDIVDMPREAHALTPSRERSPDVAGSGGIVIEDLAFRYSEQHAWLYRQLTLRFKP
FT                   GHLSVIMGPSGCGKSTLAKLLLGFLVPIEGRIEIDGRDIRNFAANELRRFFGMVPQETV
FT                   LFSGSLYDNLVMAHPHASFEDVIVACKAAEIHDTIEQLPDGYQTAIGERGVGLSGGQMQ
FT                   RIAIARALLKRPPILIFDEAVSNLDQPTAEAFAKTINKLKGQVTMLFITHQIPRGLQVD
FT                   EVFSFSDEAGATRFEVIDEQAAE"
FT   gene            547439..547651
FT                   /locus_tag="CAP2UW1_0459"
FT   CDS_pept        547439..547651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0459"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG: eba:ebA4370 30S
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33810"
FT                   /db_xref="GOA:C7RKY8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY8"
FT                   /protein_id="ACV33810.1"
FT                   /translation="MPAIRVKENEPFEVAIRRFKRTVEKTGLLTELRAREFYEKPTAER
FT                   KRKLAAAVKRHHKRMRSQTLPPKLY"
FT   gene            547777..548226
FT                   /locus_tag="CAP2UW1_0460"
FT   CDS_pept        547777..548226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33811"
FT                   /db_xref="GOA:C7RKY9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKY9"
FT                   /protein_id="ACV33811.1"
FT                   /translation="MTLKERINEDVKAAMRARESRRLGTLRLLTAAIKQKEVDERIVLD
FT                   DAAVLAVIERMLKQRRDSIAQFAAAGRNDLVDAEQFEAELLATYRPAGLSGEEIGAAVA
FT                   RAITSSGASGPADMGKVMASLRTDLAGRADMSEVARLVKIRLTGA"
FT   gene            548270..550015
FT                   /locus_tag="CAP2UW1_0461"
FT   CDS_pept        548270..550015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0461"
FT                   /product="DNA primase"
FT                   /note="KEGG: dar:Daro_0527 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33812"
FT                   /db_xref="GOA:C7RKZ0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ0"
FT                   /protein_id="ACV33812.1"
FT                   /translation="MIPDSFIQELLYRVDVVDLIDGYVPLKKTGANFAACCPFHSEKSP
FT                   SFTVSPSKQFYHCFGCGAHGTAIGFLMEYTGVGFVDAVRELAGRAGLQVPDEPRHAAQH
FT                   GREAQALGDIMTRAAKFYYEQLKASERAVSYLKTRGVSGEIARRFGLGYAPEGWQSLAG
FT                   AFDDYESAELQVAGLVIRNEQGRLYDRFRDRVMFPIINQKGEVIAFGGRVLGQGEPKYL
FT                   NSPETPLFEKGREVFGLPQARAVIRETGTAIVVEGYMDVVALAQHGVGNTVATLGTATT
FT                   PTHVHKLLRQAERLVFCFDGDAAGRKAAWRALENSLETLPEQKSIGFAFLPDGEDPDSF
FT                   VRQGGAEAFRRLIVEAMPLSDFLLRELAGHCDLSSAEGRARLVAVAKPLIGRLQSPLLR
FT                   LQVVKRLAQLSDFSQAEVERLCELRPLVRAAPARVPRQAPSLLRPLLRLLLQKPELASG
FT                   LPLDLLPEHSAEGRAIRLLCETIAGGGTEALAYPALLERLRGSECESVLHTAAAELMQQ
FT                   PFAEDEIDSEFSGALGQLRDGEQRRVFALLQDKIQKLGVSGLSSEEKGQYLQALGARGG
FT                   IRETK"
FT   gene            550067..552013
FT                   /locus_tag="CAP2UW1_0462"
FT   CDS_pept        550067..552013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0462"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: dar:Daro_0526 RNA polymerase sigma factor
FT                   RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33813"
FT                   /db_xref="GOA:C7RKZ1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ1"
FT                   /protein_id="ACV33813.1"
FT                   /translation="MAREKVVTTKAAKAKAAADLLAQVGTQPAPVDDETRKMRLKTLIK
FT                   LGKERGFLTYAEINDHLPDDVVDAEQIESIINTFNDMGIQVYDEAPDAETLLMSDAAPA
FT                   AGADDADVEEQAEQALSTVDSEFGRTTDPVRMYMREMGSVELLTREGEIEIAKRIEDGL
FT                   KHMIQAISACPTTIAEILNCADRIARDEMRIDELIDGLIDPETSGSLEELAEELESEAE
FT                   DEDEEAAEAVEGAAAAASLLRLRTEGLERLERIRAGYTKAHALLLRKGSQDKGYLQFQQ
FT                   EISEEMMGMRFTSKTIERLCDSVRAMVEEARACERKIQRICVDTVRMPRVHFIKVFPGN
FT                   ELNIDWVDVEIAAAGKTYGAVLLRNAPNIKEEQKKLLALQDRIGIPLRELKDINKQMST
FT                   GEAKARRAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYK
FT                   FSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGLEADPATLAK
FT                   KMEMPEEKIRKILKISKEPISMETPIGDDDDSHLGDFIEDHATLAPTEAALYSSLRFIT
FT                   KDVLDTLTPREAKVLRMRFGIEMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSR
FT                   SDKLRSFLDSGNS"
FT   gene            complement(552113..552943)
FT                   /locus_tag="CAP2UW1_0463"
FT   CDS_pept        complement(552113..552943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33814"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ2"
FT                   /protein_id="ACV33814.1"
FT                   /translation="MNRIIVLAITALAAGGSLPAAAFTVDGKLDDWIANPKTWAALPGK
FT                   GIQASIEDQVGRDGRVYPGWGGQAYDAEALYAAVCDGNLYIALATGHNPRTLNQGNSYG
FT                   AGDFAIDFGKDGSYELGINVLHAESVKKGVYTFEKFGVEGGVYKNPTWAYGLWNAAGNL
FT                   APGDPDLTHPTHLTAGKLVGMAEISYTTSPVKGYGDYPEDDHYFYEMSLPLSLLLDSGW
FT                   DGKAFDIHWAENCANDSILVDPPADIPEPATLALIGLGLFGLIPRDNKKKAVTN"
FT   sig_peptide     complement(552875..552943)
FT                   /locus_tag="CAP2UW1_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            553341..555299
FT                   /locus_tag="CAP2UW1_0464"
FT   CDS_pept        553341..555299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33815"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ3"
FT                   /protein_id="ACV33815.1"
FT                   /translation="MSEMIVPGTYIDVRAEGLISAGGVATGVVAVVGTARSGPVGTPIT
FT                   LSGFSQARELFGLPDKYSIPEDGSNPLTLVRSLQLAYANGASTVVAVRVASPRAASASY
FT                   ALKDPAGNTLAVLTAATPGTWGNDIQISVSQARTPARIVGEKQTASFAQLGYHSVLPNQ
FT                   QNRIQVLRGDTRRVDNFNLVYRFVARDEAVAKNGGGSYQLANPKVSTVASINSIVVLDG
FT                   NGSPVRAYGANPPSGVTAGTILYDLAATPALNEIRINPNTSELAFAATQAPAAGQSVVA
FT                   TYAVDHADPAPGEILITVWNGDIDFHAGEAPRAVAGDVLTASYLVEAADSVEVSLTHSQ
FT                   LKESYVVPDGRSLTALAAQSKLVRAVADAGHGSGKPAPDVAAYFGTGSNVGGANGADAG
FT                   EDEYAGGLEAISNRVVNLVVLGGQDARGMGSVLVGHLKSTEETDLERIGVIGAPGVEIA
FT                   DFLGHSVAEGRLVIVGPGIRNPDGSTLPPAYTAAAVAGLIAAQSVQTSLTNKAINLPGI
FT                   AVEANRGQQAQLIERNVLTIVSRQGLRVLKGITSEGVGQPFSAIPTRRIVDYAKYGVRS
FT                   AANPYIGRLNNSRVRAALKATLDAFLTGMVEDEALTGYMLDVTATRAQEIAGQVNVVMT
FT                   IQPTFSIDFIRVVMTLQ"
FT   gene            555316..555816
FT                   /locus_tag="CAP2UW1_0465"
FT   CDS_pept        555316..555816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hau:Haur_1774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33816"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ4"
FT                   /protein_id="ACV33816.1"
FT                   /translation="MPNDVLRATDAVLVLGVEDTSTPEGEAADAVVSQYDLSNVVGRLT
FT                   NVSISVSSDVRPFYEIGRRYPTHLRPGILRVSGTAERAHVNGALLRLLLGDGSVSPPSG
FT                   PSFAQPSFNLISTLKDPAHPSQMTKVTVFGVKFDSWTYSIPSDAFVMEAITFQAMRVAY
FT                   EET"
FT   gene            555860..556423
FT                   /locus_tag="CAP2UW1_0466"
FT   CDS_pept        555860..556423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_1775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33817"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ5"
FT                   /protein_id="ACV33817.1"
FT                   /translation="MPAVRDQAVNETAADAGPQEARLLTPQELLAGSLLTYDVEVPPSI
FT                   LRPGDEDAAAAAGGRVRLRPLKVATLALIARAARDDPSLVPLLMIKESLVEPLVPLEQV
FT                   RQMHAGLVNFLVTAVNRVSGLASGEGAVRHAADSAIGETHVQFAWYFGWTPAQVADLTP
FT                   GQVAVYLAGIERQRARDSEPQPAP"
FT   gene            556420..557670
FT                   /locus_tag="CAP2UW1_0467"
FT   CDS_pept        556420..557670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:Dmel_CG32656 CG32656"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33818"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ6"
FT                   /protein_id="ACV33818.1"
FT                   /translation="MNPTPWEEPAGLALQVADALFTLPGAERAAATQHLAGVDPSAALE
FT                   SLLAAILQAGPPIGTHQESVADLPAGARTPVHSREVVSLRAASEPRAGADAGMALPADM
FT                   LPGNPLRLIDPMFASTGIAGLQSLPGTSPGQVTVATDSPPRQTPPVDSRGGTPGSSEDG
FT                   PVIPERTRQGAPTLPTPRPEGPTFGTRAADAPPIPATETKELRGGSRQARRRRNDGPGD
FT                   KREALASAQGLHAEPPRSTSSAPDGAPGNVTRTPPAQWPATASRLSTRDTSATGRPATA
FT                   ASSQILADASRKTRLVSGVADLNGLFESLLAGRRPADTQAAVLAGTRREAPVAAEGEPP
FT                   GAAGRHPDLSPASLAEAAPVPRAAPLTRADWPATAALMPADAAHDDVLLLDRLLDRWEE
FT                   RLREQAIRHLGFTGGLT"
FT   gene            557672..558268
FT                   /locus_tag="CAP2UW1_0468"
FT   CDS_pept        557672..558268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hau:Haur_1778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33819"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ7"
FT                   /protein_id="ACV33819.1"
FT                   /translation="MALEIAGVAMDKLVSIEASEAARFVRHAVPGLAGELAQDLGRPSV
FT                   RIRVRGVFYGGDAGDRLKQLRDHLLARQPVDFLCELTGDGYFSQVLVDQLDVAERAGYP
FT                   DEYDYECVVTEYVPPPPPPAGGLLDGLDAGILDEATALMDDVQNALAQVAGLTSLLAGA
FT                   SDFANPTTRLPAMLDGFTGIAGGSAASLGGIGDLL"
FT   gene            558265..561675
FT                   /locus_tag="CAP2UW1_0469"
FT   CDS_pept        558265..561675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33820"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ8"
FT                   /protein_id="ACV33820.1"
FT                   /translation="MSGATASLPNLQRASNASANAQTGLSGFLGIASALAGGGHDSPLR
FT                   GISEALGGLDQALQIDVSGLSERLPAALANIEEALPTDALRFVEEIVNRYQEVSDFLAS
FT                   SGLVRQIQPGASLETTALALIDELLNLFSARLAGLGSSLIDADTLEAVSKALATMEALA
FT                   SGSVLPADQLLEFLSRNLLGVDADLLVGARSQLDAALAILDPFSATAVEAAVAATRDAA
FT                   TTALRNLAEALREFDPNDLAAYATPEALLDTLGRALEAAFLALEALYSALTVAVARPEW
FT                   ETLFTSWAAVLAAVELADVPTVDDAVDAIAGAIESLLARLTMSLSPDDLAAQVARMAGS
FT                   LHALFSDSPLAQVRQILIDFIGRIGAELAAIPVEDVRTAVLGMLQTVQRQIEELGIAEV
FT                   RSTIEKGFQDANDFVDDNLGGDLLAGISTQLAAALGQLENIPVAELGQELASAIQAASE
FT                   LIEDLQAKLAAGLDEVRTLLASLDGIDFRPVADEVVDEIGALKSRLAAIRPESLSDVER
FT                   IAIQAGLSVLRAIDLEGMIEGELKKEFASVDAQLAQVVQAILDAWLEFRRRVGTLDGAS
FT                   LAAPVTGLLDEVGNTVLAINGAAVVAPLEKLLDELLAKARTVSPGAILEPLQEPYQRML
FT                   RTIERANPDVWVEPLHVLHAEIDRLIKLVDITPLLSTLEQKQRDLFAQARQAIADAVGA
FT                   VHLPEPLDTFHAQMTTLIVGITDAIFADPDGTLRQVNLSLSASMRPSTLFEPLDQAFDR
FT                   LLAAVETLPADDVLRALEAIRQGLGAALPAMDPANVVRGMRVAQGRLAALSPSSVAGVV
FT                   ALPELRARLAGRLSLSTANGDAGASLLARFDLTLAPLDLASDTSRLCRLSTAHAALVTA
FT                   LRQRINALDTATAQLEFQRLQSGLGRILPPFLRQPTPLAMADVRAGLATLRPSLKARRI
FT                   DLAVDGFLRQLAPLQSALDSAVDGFFKEIRQAALALHPGELKDAVADVYASLRARLAVL
FT                   DPELLAASLRSSVWDPLLDPLRAIDPAALKAHLDALFQNLLAKISGSVKDLLRQLKQAI
FT                   DAFLVRVRQALSSVLATLRQKIEAILGEVSKLVVRIDGLLVDDLFKRLLTLLANLQTSF
FT                   DQELDRVRNEFDGMLEAIPLGASAGVAIA"
FT   gene            561672..563840
FT                   /locus_tag="CAP2UW1_0470"
FT   CDS_pept        561672..563840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0470"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: afw:Anae109_2325
FT                   YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33821"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C7RKZ9"
FT                   /protein_id="ACV33821.1"
FT                   /translation="MSTLTQLRAWQAAQAAARKVIADQGLANEVHEGPAISRYTWQAGE
FT                   LAEIVEPDGERWGYAYGDDGRLLAVDRDGRRWADYRYDAADRLIEVRRPDGVLTHSYDE
FT                   QGRLVRTLRGDASPFVYRWQGERVATARSDREESHFHYDARGRVSGVDQRVDGSLLSAR
FT                   FSFDGQDRLARIDFPQWRQAIGFTWDERGRPSAIDWNGRQLAHFGTDDAARLAWCEGFD
FT                   GVREETWHEAASGRPVRQSMRRAGQEIWHCELVRDEAFRLIREGRRDYAYDFCGRLAEV
FT                   RDGQETWCYRYDALDNATLDDGLPTAVDCDLAERVRRVRQGSAERVFRHNQAGELLELL
FT                   LDGTRVARCLYDHKGRLVCKSGPAGSERYLYGPDDGLLAIADDSGQPLLIFLRLPTGVV
FT                   AMIDFRTHRQGQAVCLHCDAHGNLLFTGTGEAETALAGPFASDPWGVPLHTAGPYLYRG
FT                   RLWHADLGLYRIGCRWYDPNLRRFLTPDTHTGAPDDARLVNPFRLAGEQRMARAQILGD
FT                   WLRQPRLRNRHAYCANDPINRFDPDGHWSFGGVLLSLLGVLWTLPNTAFGLAIEVSCLL
FT                   GEVVRWLVWLFSGGKVSWQTPGFDAAASGRLNAFALVCKGGWLGSFDSLLGITFGNVIF
FT                   VNGRYQENAEWKALPDPVRPTAYGGAVTIAKSQALYEHELRHVNQYSWWGPFFHLGLPL
FT                   FGVYEWDVILNGYRNASFEKDAREHGGF"
FT   gene            563840..564901
FT                   /locus_tag="CAP2UW1_0471"
FT   CDS_pept        563840..564901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33822"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL00"
FT                   /protein_id="ACV33822.1"
FT                   /translation="MAGLRPRFSLTAGSLSADSASPLAGPSRFVVERSLDVPIDGLRVT
FT                   LAESGGVAPGDPVQLDLGDEDGLARVFTGSVAEVRPRLAGCELFCAGSLLALVDLRVSS
FT                   FYLGRSAGDVVRDLIGQAALEPGEIADGITLPRFAVERRLGAHAQLRRLAERLGYSLFA
FT                   DRAGKVHFRGLGPAAGLAAGGIGAGLATAAAGALGTLGKGGAGGLTYGKHLLGATGGLR
FT                   PAFARKLLLGGESPMSGQGEDKSFWLTATDADYQDSAGDGDELLVTDPTARTKDMAGRF
FT                   AAGYAATFARRTSEVRLTVLGMPDLELGDDSGASDAPESALNTTGYVKGLSHRFGAREG
FT                   FVTDVVVSTETSQ"
FT   sig_peptide     563840..563914
FT                   /locus_tag="CAP2UW1_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.670 at
FT                   residue 25"
FT   gene            564898..565602
FT                   /locus_tag="CAP2UW1_0472"
FT   CDS_pept        564898..565602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33823"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL01"
FT                   /protein_id="ACV33823.1"
FT                   /translation="MKELLDMVRRTVREELALRRGPQLATVIALTAHASADDTANYEAD
FT                   LRLKHDGLEITQVPIAMSHVGFAAPPRVGDLVLVEFLDHDLQQPLITGRFYHDQERAPL
FT                   FRQDEVLFEHRLPDDTVNHLRFADDGSIFLQRAVSKLEDNSEFKAGLRIDPDGIIELKA
FT                   GDKITVTLDARNEKVTIVCDGKPIDITCSQLTVDADVEIRKTLTVNGDGTIKGTGKISS
FT                   VTISGTDISGGA"
FT   gene            565602..566042
FT                   /locus_tag="CAP2UW1_0473"
FT   CDS_pept        565602..566042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33824"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL02"
FT                   /protein_id="ACV33824.1"
FT                   /translation="MADLTLKGTLNLMGTLTFKPSPGGKLKIGNAGLEALVEVMPGDPP
FT                   QCTAAPPVILPPPPASPLQPQPTVWIVSSFNKTVKAGSKCIVALGMAMQGQSGAPLWPG
FT                   MLLPSSGNPTVTVNHVPINVVNDMAVIFPSGGSAAFSASGQT"
FT   gene            566039..566779
FT                   /locus_tag="CAP2UW1_0474"
FT   CDS_pept        566039..566779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33825"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL03"
FT                   /protein_id="ACV33825.1"
FT                   /translation="MTALALRIVQPVHDTGYPPGPSIALQGSLTGDSAGLYLKWYSSLN
FT                   SAASETQPELNADHSLAILNWSAPLAEFGSHVIVLAATDQERTDLSAIKAVTRSAMSGG
FT                   APPAASAPCIVHRLVAQIRTPAANGQVLSKAAATLEFLAPARWARKDAGPPEAWVADSD
FT                   YQRINGIAMRLRLVPVGPLDPAHSADIPLTLATLPFIRADDKTWFRWAGALPANLGNGN
FT                   HTLSLSVSGGGATTSAVRQVILAA"
FT   gene            566793..567233
FT                   /locus_tag="CAP2UW1_0475"
FT   CDS_pept        566793..567233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0475"
FT                   /product="gpW/GP25 family protein"
FT                   /note="KEGG: hau:Haur_1783 gpW/GP25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33826"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL04"
FT                   /protein_id="ACV33826.1"
FT                   /translation="MASERQSLFGADLQLREGAGGSDLTLEGPVGSSGDLALAYGNANA
FT                   VQALSLRLRVRKGELALLGWPDYGSRLHELIGEPDLPRTRLKAQVFAREAVEADARVRR
FT                   VEAIEVVSIAGERTLLRLAMQVLLIDAPTPLDLVFDLALEGT"
FT   gene            567230..569182
FT                   /locus_tag="CAP2UW1_0476"
FT   CDS_pept        567230..569182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX1676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33827"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL05"
FT                   /protein_id="ACV33827.1"
FT                   /translation="MIDVGHPFSKPFQSLVDALVESLQLGVEQPASQEIIFRAGTLSYP
FT                   LKGIGPVSGLAAQITGFVAGRPAVFTLGQHYLYAVGQLVWQAPPSTVDADIAAVWFPDD
FT                   NSRLTVGYFFRDLPSGITDFNAGSVAGTLVRAMSREFKLLYEQMDQAYRRAFIDYAQGA
FT                   ALDNVVALLGVERRQALPAQGEVTFWLKKAGRNDVAIARGIRVADARGRVFKVAAPGVI
FT                   RSTLVEETSAAGKSVRVSVAIGSLLHVREKGKEVDLATVATRAGKPFGDDGVTITLKTV
FT                   PPSASLVITFQPKTPKTTVAVVAVDAGPAGNLGSGSLTVMPTPPRGVDGGVVNEKPLTG
FT                   GEAAEDDEPLRERAKHALERAGNATLNAIHYAVLNIEGVDSVEVRDASLDAAIPLGEVW
FT                   VRFSTGKPDVVAPQVERVVDRTRAAGIKAVVKQVRTLTLSGRFLVIPDAYGSSKDARQR
FT                   YRTAAIAALAGLAIGEPVSQRKLAALAFRVAGLADMGEVQLDYVRGSDAALAIDQDPFV
FT                   LDAGEQARPDAGALEVVALHALDASAASLAADGSLSLSLRILDDDGKPVHFRRLELALL
FT                   ATVRAKPATTPNQPLQQVAQVAGTISFTAAEQAAPSFAKLVIANLASLDASSIELMVQA
FT                   TAYPGMVAAKTRLTT"
FT   gene            569191..570516
FT                   /locus_tag="CAP2UW1_0477"
FT   CDS_pept        569191..570516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33828"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL06"
FT                   /protein_id="ACV33828.1"
FT                   /translation="MSFKTDRLVALFPDVYAARERDSLLHQVLDALAAELVNSDAAVKD
FT                   LLKSHWIDYAGSGGLDGLGALLGVLRRRLPDGTPEGDETFRPLLKSTVLSFIGGGTVEG
FT                   IKGAVRAALGLPYDLDLFAKQIAGPGGAVNRGISDLVAGLDRLVQIEEFSPKTEVVLGS
FT                   ALPTPVGSTATLDVNFATVEPVVPRIEWTFTQGGGRHLSLVRQDSGAGIVSRDEFVVPE
FT                   GSTLLLAGEGATGFSASIGTTDVSSWFVDLAGSLPPALPEVPAGGSRWVFSAARAGEFG
FT                   FAAYDSGDTFDAAAFTVRMAWVRYQPLTFDVVVPYFVDAAVRRILAGTGYENRFRVFKG
FT                   LSLDAIQKVVDDKRAAGVRGMVQYSLSLPGESSEKTPWEEHAVVERFSATAEHRHAETH
FT                   DTFEDLLVGALSSALETHDASEHFAIGGVFDVAVSDGSFGFQ"
FT   gene            570537..571013
FT                   /locus_tag="CAP2UW1_0478"
FT   CDS_pept        570537..571013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hau:Haur_1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33829"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL07"
FT                   /protein_id="ACV33829.1"
FT                   /translation="MHEIMDMQGRLRLLVTDRQERILVDRSHANRIVRSGRQLAAQLFA
FT                   GVEGTPPSKASHMAVGTGADAATDEQAALVGERARNPVGAPVYTEIIDSAGVKRIKVSL
FT                   QAVFDFAEANGAAPLREAGIFTAAKDGTMYNRVVFDPVTKADTFKLTLIWDIVF"
FT   gene            571039..572556
FT                   /locus_tag="CAP2UW1_0479"
FT   CDS_pept        571039..572556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33830"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL08"
FT                   /protein_id="ACV33830.1"
FT                   /translation="MPLTPDLPFPKSAGDAIRSKDWNDLVTETQRLDNAKVNRAGDAIS
FT                   GPLTIAGALGIGTTTPSAKLDVAGDLRINNSRLYLRGAGDNNHGLGWYGPGSPFAGANV
FT                   DGPVLFGFSGGALGSTDGGQKLALSWDDSGNVGMGTSTPKAALHVVGGTWLCDGTGYAV
FT                   ANNRMAKGSLTVGSLTSSFGGGSGWSDNTAGLLFETRDDTEIAIHDSGTRIASVAYYQS
FT                   SANSLTIGRDMGWGPISSVSVAGSIRAGNSDLYFTKTDHNHSGFGNTPGFAAIENAGNY
FT                   DALMILGRAGAQVPGKPAGTKARVVKLWDVLEVNGDLLVTGRIGSMNKGPGPLTAGWGG
FT                   GLRTWDVEAEGTVWSRGAFQTGPRDVAEIYFSDLELDPGDLVSLDPDADRIIRSSGPAD
FT                   PTVIGILSTEPGFLLNSQLNREAPAGDLRPYPVALCGCVPCKVSDENGPIRRGDLLTTS
FT                   STPGHAMRAEPILLDGKSLYPSGTIIGKALAAHVDGEGVIEVFVVLR"
FT   gene            572623..572829
FT                   /locus_tag="CAP2UW1_0480"
FT   CDS_pept        572623..572829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33831"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL09"
FT                   /protein_id="ACV33831.1"
FT                   /translation="MEARLRKRLEELRAEYDKGRKALDDLESQAANVRATLLRIAGAVQ
FT                   VLQEELGESPGGGENVPIPRAAD"
FT   gene            572836..573609
FT                   /locus_tag="CAP2UW1_0481"
FT   CDS_pept        572836..573609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33832"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL10"
FT                   /protein_id="ACV33832.1"
FT                   /translation="MLLALENAIANLLQRELPSLFTGAGAASATFSIDTWDFDRLSADP
FT                   VAGQPGPEDAVDELAFDPAAAAGPYALTRPPYPGPKRVYLRATSGELVALASAEVLWNP
FT                   ANPAAFSIQPLATRDLTGFDHLHIMYGVVAAATRLKTLHKLTLQIAGADAGSSEKAFAL
FT                   ALAVLVLNRDALLRDGGFAWTAGGYQAEGAVKTLKFSAGAVPAPTSRTLLLEAEVDLRL
FT                   ERLLAEDEGKPIVRILSPGRTPGSKPVDIDPAIQA"
FT   gene            573628..578661
FT                   /locus_tag="CAP2UW1_0482"
FT   CDS_pept        573628..578661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0482"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: mbu:Mbur_0937 KP-43 peptidase. Serine
FT                   peptidase. MEROPS family S08A"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33833"
FT                   /db_xref="GOA:C7RL11"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034058"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL11"
FT                   /protein_id="ACV33833.1"
FT                   /translation="MARTHAFLQLDADRAPEQTTFLRARVTVLREAGGHFWVDLDEAQV
FT                   DTFVAEGFLVSTFPAAGVLDLGPVTFRPASETPQPPAALQASPPSGDEPAFWLVHFVAP
FT                   VDKAWLVEMALAGGEQVHVIDPFTGVFRMPLAASDTVRALRYVDFLGLYHPAYAVDLDL
FT                   TASEEAFTAASLATLALQPPPATAQGNLQLQIFDGVDPESVRPLFEAAGATVLADLAHG
FT                   FLVQVPPERCAAIVGVPGLYMASAPSTMEVCSHNAGVILGANQVRDLGTVNFLVNLDGL
FT                   AEIGAVVDSGFDVGNLAGAVAPSTGAVTAFHPDLVANVRLLRNSNTPFNAALAVPDATP
FT                   HGTHVAGIVVGDGSSSAGRTRGIAPRAALIGLAPLPANLRVPFEFAASNGARVINNSWG
FT                   SSFALGANNNRYTPAESQAVDRWCFDHPDVLVLFAAGNAESDTQGGGNGVLDARSLRLQ
FT                   ATAKNAFTVGATENLRSDGGWRDSYRAFFGARYNHAAFNVAAGAAAGAFSFSDNADEIA
FT                   LFSDRGSVRTNALTNTNRVKPDVVAPGTNVLSCRSQWVAQPPALPGAPVPAPFWNANPD
FT                   SMLPAGFNRNLYQILTGTSMATPMVSGSALLVRQFYRSRFAQMRRPLLLEGVAVPAAPP
FT                   LPAFGPPPAIARHADGLLCVWLTPALAAAQKNIVALRLSRQLAPIDSLPVHLQDNVGEH
FT                   SAPKVVTLGERTYLLHRHGDGKIRLSCYDRALRPLAAFGTAGVVTLAPDTRADDAVPPD
FT                   LIVVGERLACVFPTTGGNGYFFQRFNADTGAPVDVASISFLFHDGSGPHRPLTWNGSRF
FT                   AVCGVAHAGNYRLQLRQMDGAANLQGSEPVTVVEQAAEVREPCLLWDPRSARYALVWCD
FT                   ARTLAGGEVWLQFLDANAAALGVAQRVVSVAAANHVRRPQLLCHPDSGYVLLWEDDLQN
FT                   GHFDLYCAFLDSNGQVDSHLAAAADDTLSRRLLRLSDTPGDMDGFAAVGDAEGFSLIYQ
FT                   SPDELNSDRLGVYALNLTRAGAFAAQENPGTPLLKSGRYVVASPLDHDSTALSALSAVW
FT                   TGASYYILRLAPGVGLADSLQWLRLHADGAVDAGYGVSGIREMPAPFLILSVEALWTGN
FT                   DRLISVANDALAAITLTLHDAQGAPVTEFGTAGAARLRDPLPIDDRIPAQIGFFTTPSL
FT                   HVIVAYGTIQAGVRQLRQQRVNRLGARVGTPTDLARVDGVARHGWFQFVNSEARSIAIY
FT                   QRVNGAVTRVHCRRFRPDGTADGAERDLSAAAGEASNGVLARRPTAANSTNREYGAAWQ
FT                   YRANNASRWEIRFSRLDRQGRPLANPPGTTPPMPVSDIVVIATGTPGWNASREAIEPQL
FT                   VCTCTHEPWANPPAVLPAGTSLPVWSPAYGLAWIGVETDGARLLYFTVLDENGQRLAVA
FT                   PPPPPAGPLNPRAPVGILQLSAAGSRVQDFQLVWNGRVFLVYWVEEESGHLHHRYTAIN
FT                   RHASQNANDIPSAALLRATLVNGATNITPGPLPDSAAGYGWGRVSLRQSLSPAPPVTLH
FT                   VRDDCAIGPGRTVSYRFTLPAGTALLRVTLNWTDPPGPRLVNHLHLTVRPPAPPGPGIR
FT                   PEYRGNLWSSVAGQTHLSRPVATPAVAADNHEDVQTFKQVVLANPAAGDYEVEVSATAF
FT                   PADPFNQQNLQAFALVFAGSGPEVRFSLPAAAVAGAAVY"
FT   gene            578723..579952
FT                   /locus_tag="CAP2UW1_0483"
FT   CDS_pept        578723..579952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0483"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: aba:Acid345_4373
FT                   PGAP1-like"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33834"
FT                   /db_xref="GOA:C7RL12"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL12"
FT                   /protein_id="ACV33834.1"
FT                   /translation="MPSGKKQPAPLAPSSGYSHAAKTAVQETTLRVKEMHRAIAGKSFD
FT                   ILRRIPLISGPTHLVRSAHDAILAGVYAGIHHTSGGVLEAAALIERHATRRRPDPPVPG
FT                   RLASGLRSAVNGAFGDHLATSNNRLAIDMAFHENGVAVPLDADSLRRAFPDTGRRLCIF
FT                   IHGLGCDEHSWDPGPEAAESTVHFGRRLRVEHGCSPLYLRYNSGLPIARNGAQLAVLLE
FT                   ELLAAWPQPASDLVIVGHSMGGLVALAACEQAAQAEMRWLRATRMLICLGSPHLGSPVE
FT                   RLGRLTTAALNVSTITAPLARIAGARSQGIKDLGNGPGAPADLLAHQHMAFRFLGASLA
FT                   KNVEHPFGEFFGDGLVTLGSATAHAIAGDVQSTRLGQLGHMGLLNDARVYRQIAEWIAA
FT                   LDARATSEAG"
FT   sig_peptide     578723..578785
FT                   /locus_tag="CAP2UW1_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.802 at
FT                   residue 21"
FT   gene            complement(579992..582457)
FT                   /locus_tag="CAP2UW1_0484"
FT   CDS_pept        complement(579992..582457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0484"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: dar:Daro_0058 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33835"
FT                   /db_xref="GOA:C7RL13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL13"
FT                   /protein_id="ACV33835.1"
FT                   /translation="MKGVPWSGWSLRSKLIVACVLVQLVAAALVLLGSTQLLQRALLDQ
FT                   ASSQAKQIVALLDYAIAAPLAQRDYATLQQSLDLIRSDESITYLVLSDHRGKLIATAGW
FT                   DAARPLPSRDEKGIDLERPDATMHLALPVSLAGQPLGHVDFGLSTAGLRQARADFLRHS
FT                   LGITGAALAISMALLTVIAFAITHRLTRLAHASQRVARGDLDATVPVTSNDEVGRLGIS
FT                   FNAMAETLKLRVAALEHSETQQRLLLKAAREEQARLTTLLGAMNSGIMFVGSNGRVIYA
FT                   NGAFARIWALADLTTGRSLAEVVPLLIRQTIPADAVHVEAILDTGVGKVARGVELQTVD
FT                   GRIITQRMQPVAEGSSGSGCIWFHEDITLERQTQQRAYQALHDPLTKLLNRRGLYEALQ
FT                   AAIAQAIADNAPLALLFIDLDDFKHANDVGGHRTGDEILVAVAQTLSDQMRKGELAARL
FT                   GGDEFAVLCPGNGAHAASAIAARLVEAVGGLRFAAADMQTLRIGCSIGIATCPNDAREE
FT                   DDLVACADTAMYLAKQSGKNGWAVYHNDPLRSRAESARVNWNARINRALQDQRFVLHFQ
FT                   AVHRAADLQVTYFEALVRMVDETDPSRLISPADFVPHAELSGKVRQIDRWVFLNCARKL
FT                   ASTDPSVCIAANLSARSLEDATFPAFLDDTLRQLEVDPRRLHIEVTETSAISDPAAARR
FT                   MIDALRGLGCAVYLDDFGSGFSSFAHLKLLDVEAIKIDGAFIRDLHGDSTNRLFVASMI
FT                   EIAHHLKKLAVAEHVEDASTLDILRSLGVDLVQGFHLGHPAAGISDSRPQDWLPIASAT
FT                   GDGELGGPA"
FT   sig_peptide     complement(582356..582457)
FT                   /locus_tag="CAP2UW1_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.454 at
FT                   residue 34"
FT   gene            complement(582454..583314)
FT                   /locus_tag="CAP2UW1_0485"
FT   CDS_pept        complement(582454..583314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0485"
FT                   /product="ABC-type phosphate/phosphonate transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: dar:Daro_4085 ABC-type phosphate/phosphonate
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33836"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL14"
FT                   /protein_id="ACV33836.1"
FT                   /translation="MISKPNQRRSVCLAMLAVGAVPSCLWAQPVRPLEIGVLPNVSARV
FT                   LLAHYLPMREYLARVLQRPVQVSTALSWTAFHQRTLDLDYDLVVTAANLARLAQIDRGY
FT                   RPLLSYAPNIKGMLVSASSRPVRGVADLIGQTLVLSNPQSLVTLRGMQWLAEHGLQRDR
FT                   DFKTIDTPTEDSVGSVVARGDALAAMVSGGEYRAIPEAIRAQLQPVTTFTEVPGFVVMA
FT                   SPRLPPAQTRAIKEHLLNFANSSEEGKAFFAGTGFTGIRDAAAGLMESMDPYVEATRKG
FT                   LLPPG"
FT   sig_peptide     complement(583231..583314)
FT                   /locus_tag="CAP2UW1_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(583531..584298)
FT                   /locus_tag="CAP2UW1_0486"
FT   CDS_pept        complement(583531..584298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0486"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: drm:Dred_2989
FT                   triose-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33837"
FT                   /db_xref="GOA:C7RL15"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL15"
FT                   /protein_id="ACV33837.1"
FT                   /translation="MRKIVIAGNWKMNKTVAESVKLAADVVAAARDIKNVVVAIAPTYL
FT                   ALAKVAEVVKGSNVKLAAQDVHWENQGAFTGKVSADMLKEIGVDFVIIGHSEQRSYFGE
FT                   TDETVNKKVKKALSLDMGPIICIGETLAERKGGQLESVLTTQVNGAYAGLSADDALRTV
FT                   VAYEPVWAIGTGVTATDDEAQQAHAFVRGLLAKLYGDGVAQSISIQYGGSMKPENAAGL
FT                   LAQKDIDGGLIGGAALKADSFLGIVTPGESISK"
FT   gene            complement(584372..585628)
FT                   /locus_tag="CAP2UW1_0487"
FT   CDS_pept        complement(584372..585628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0487"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: ote:Oter_3826
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33838"
FT                   /db_xref="GOA:C7RL16"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL16"
FT                   /protein_id="ACV33838.1"
FT                   /translation="MSKLFIEDLALEGKRALIRVDFNVPQDKVTGAITNTKRIEAALPT
FT                   IKSALEKGAAVILMSHLGRPDGKVMPQYSLAPVATALEGLLGRPVKFLADCVGPEVEAA
FT                   CAQIKPGEVILLENLRFHIEEEGKASVTNADGSVTKVKASPDDVKAFRASLTRLADVYI
FT                   NDAFGTAHRDHSSMTGVQLPERAAGYLMNKELAAFSAVLESPQRPLLAILGGAKVADKI
FT                   QLINNLLDKADQIIIGGGMAFTFKKVLSGMPIGNSLFDEEGAKLVPGLMEKAREKGKEI
FT                   LLPVDFIIADKFDAGANTGSANDVDGVPDGWLGLDCGPESTKIFTEAILKARTIIWNGP
FT                   AGVFEFEKFEAGTKAMADAVVQATAAGAITVIGGGDTATAAKKYGADKKVTHSSTGGGA
FT                   SLEYLEGKILPGVAALSEK"
FT   gene            complement(585976..587733)
FT                   /locus_tag="CAP2UW1_0488"
FT   CDS_pept        complement(585976..587733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0488"
FT                   /product="Carbamoyltransferase"
FT                   /note="PFAM: Carbamoyltransferase; KEGG: eba:ebA3984
FT                   carbamoyltransferase, NodU family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33839"
FT                   /db_xref="GOA:C7RL17"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL17"
FT                   /protein_id="ACV33839.1"
FT                   /translation="MALTLLGLSGALTHDPSAALYIDGKLIAAAEEERFVRDKHAKNRM
FT                   PYEAAKFCLEFAGIRPADVDAVAIPFAPISLAEPARWHYARRYWYAPDRALDALITGNR
FT                   RFHRYRKRIAWCLQQLGFDLKNTEIVPVEHHLAHAASAYHCAGFAEKTAILGIDGKGEY
FT                   ATTFFGYGENGRIHKIKEFYDPDSLGGLYGALTEYLGFEMLDGEYKVMGMAPYGDAARY
FT                   DFSRLARFANGELRVNTDYANVIGFRRYKEKGKGYYFSPKLVDWLGPRRSGDVADDPYI
FT                   HYAASMQKLFEDLSLQMLDHYLGDILRETGRLAFSGGGALNVKLNQKIIARPDVRELFV
FT                   QPASGDAGTAVGAAAYVSVQRGVPVEKMEHVYLGPAYSNEDVIAACARHPARPRWQVVD
FT                   DVPRHTAGLLAAGNPVAWFQGRMEFGPRALGGRSIVGCPSVAGVADRINAQIKFRERWR
FT                   PFCPSMLDTVGPQMLGSAHPAPFMTFTFEVASGWKERVPEVVHEDGTSRAQVLQRQFNP
FT                   RYYDLMVEMERLTGNGVVLNTSLNRRGEPMICSPTDALNMFFGSDLQYLVMEDILVVKA
FT                   ADEGPPQSR"
FT   gene            complement(587921..588796)
FT                   /locus_tag="CAP2UW1_0489"
FT   CDS_pept        complement(587921..588796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0489"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   eba:ebA3949 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33840"
FT                   /db_xref="GOA:C7RL18"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL18"
FT                   /protein_id="ACV33840.1"
FT                   /translation="MLSRLLAATLWLLHFLPLPILAGVGNALGLALFGLARRRRHIVLV
FT                   NLRLCFPELAELQRVRLARAHCQVLARSMLERGLLWWASPARLQRLTTVDGDDRLRALL
FT                   DAGRPVLMLTPHFVGLDAGGAAIAMRHDSASIYAVQSDPVFDRLLYRGRRRFGDQLLLS
FT                   RQDSVRASVKAMKSGRPLYYLPDMDFGRRDSIFVPFFGVPAATVPGLSRLARLAGATVV
FT                   PVVTRLLPGGKGYAVTVGEPWQDFPSNDIEADTRRMNAWIEAAVRTMPEQYYWVHRRFK
FT                   TRPAGEPRPY"
FT   sig_peptide     complement(588728..588796)
FT                   /locus_tag="CAP2UW1_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.967 at
FT                   residue 23"
FT   gene            589188..590498
FT                   /locus_tag="CAP2UW1_0490"
FT   CDS_pept        589188..590498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33841"
FT                   /db_xref="GOA:C7RL19"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL19"
FT                   /protein_id="ACV33841.1"
FT                   /translation="MIRKLVLPVRRMLHGTLRKLFNFLPQKRRFAVYRNFVDCDPAPDE
FT                   RLVLKIAETKEELAECFSLLHDAYVGSGFMKPDPSGMRVTIYHALPTTTTLCAKYDGEV
FT                   VGTLSLIRESVLGFPLQRIFDLTAIREKRGNVAEVSALAVHRKFRRTGGSILFPLMKFM
FT                   YEYCTTFFDTRHLVIAVNPKHIEMYESLLFFERLTQNVVENYDFVNGAPAVGATLDLAF
FT                   APEIFRRHYGSKPPKRNLYAFFTEVKLPNIKLPQRRFYTTNDPVLTPELLDYFFNVRTH
FT                   VFSQLSDRKKCLMHTIYDLPAYQAVLPAISEGSQDGSARRRHQRFSVRCPAQLSLVAPD
FT                   GAQSKIKLEVFQLSRYGFKAHALHPIPINVWGEAMIKLGPSEVSRIQVAASRDSGEGIY
FT                   GFRLGEPDLIWRKFVNALYSGSIHADLENATRFMTDR"
FT   gene            complement(590551..591669)
FT                   /locus_tag="CAP2UW1_0491"
FT   CDS_pept        complement(590551..591669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0491"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: eba:ebA3764 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33842"
FT                   /db_xref="GOA:C7RL20"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL20"
FT                   /protein_id="ACV33842.1"
FT                   /translation="MSDPEKTASQAAAPVSPAAAIPAPARATVAMAFVQGMLGGMQHAG
FT                   HDTRPLLERAHIPTHVLGDPAARIPVDRYAALYNLINHELDDEGFGLFSVPMRTGSFEF
FT                   LCRSTITAPTLSVAIERGIRFLRLVLPDLSVRLNTHRDQACLCIAETGAPLAIGRVFAF
FT                   EWLLRLLHGLFSWLVGRGIVLDAVAFPYPRPEHADDYALIYTARSTFGAETLAATFAAN
FT                   LLDLPIRRDEAALQTFLDGAPGKLTTLYRRDREMVLRVRKTLRDALPASMSLAEVARTL
FT                   HLSARTLHRRLEDEGSSFQAIKDGLRRDVAINSLAKSRQAVAEIAAELGFADPAAFYRA
FT                   FVRWTGVAPAHYRKRLQAAGSDEPRPTRAAAR"
FT   sig_peptide     complement(591586..591669)
FT                   /locus_tag="CAP2UW1_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.541 at
FT                   residue 28"
FT   gene            591838..595104
FT                   /locus_tag="CAP2UW1_0492"
FT   CDS_pept        591838..595104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0492"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: dar:Daro_0243 methylmalonyl-CoA mutase,
FT                   N-terminal:methylmalonyl-CoA mutase, C-terminal; TIGRFAM:
FT                   methylmalonyl-CoA mutase, large subunit; PFAM: ArgK
FT                   protein; methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33843"
FT                   /db_xref="GOA:C7RL21"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL21"
FT                   /protein_id="ACV33843.1"
FT                   /translation="MTDLSIAKKLLPYKPKHKVRFVTAASLFDGHDASINIMRRILQST
FT                   GAEVIHLGHNRSVQEIVNAALQEDVQGIAITSYQGGHVEFFKYMIDLLKAGGGEDIKVF
FT                   GGGGGVIVPSEIDELHAYGVARIYSPQDGQSLGLQGMINEVATKADFDLSTLAPQDPEA
FT                   VLAALKAGDHRKLAQIITALENGAYPEALRKKIVHAAAGLKVPTLGITGTGGAGKSSLT
FT                   DELVRRFRLDQGDTIKLAIISIDPSRKRTGGALLGDRIRMNAIEHPNIYMRSLATRETG
FT                   SEVSAALPEVIAACKLAGFDFVIVETSGIGQGNAAIVPLVDVSLYVMTPEFGAASQLEK
FT                   IDMLDFADFVAINKFDRKGAEDALRDVRKQYQRNHEAFGQSPDEMPVFGTMAARFNDDG
FT                   VTALYQAIAPKLHALGLKLKKGKLPLVTVKQSSNQRAIVPAQRVRYLAEIAEAVRSYHA
FT                   HTAEQAEVARQRQSLRTAKELFVGCGKPAGDFDDMIDWKEGQLDARARKLLDMWPKTVE
FT                   LYAQDEYVVKIRDKEIRTRLTNTSLSGSRIRKVSLPTYKDDGEVLRFLMKENVPGSFPF
FT                   TAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKKVSEGMPAKRLSTAFDSVTLYGCDPDA
FT                   RPDIYGKVGNSGVSIATLDDMKVLFDGFELCAPTTSVSLTINGPAPIILSMFFNTAMDQ
FT                   QVDKFRTDNGRDPTEDEIQKIRTWVLANVRGTVQADILKEDQGQNTCIFSTEFALKMMG
FT                   DIQEFFVHNHIGNFYSVSISGYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDF
FT                   APNLSFFFSNGMDPEYSVIGRVARRIWAVAMKNKYGGSERSQKLKYHIQTSGRSLHAQE
FT                   MAFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTEESVRRAMAIQLIINREWGLAMN
FT                   ENPNQGSFIIDELTDLVEEAVLKEFEAIASRGGVLGAMETGYQRGKIQEESLYYEHKKH
FT                   DGSFPIVGVNTFRNPQGDAQIEIELARSTEEEKQSQINRLRDFQGRNAAVSGAMIERLK
FT                   QTVIDNGNVFAVLVDAVRVCSLGQITGALYEVGGQYRRSM"
FT   gene            595272..596573
FT                   /locus_tag="CAP2UW1_0493"
FT   CDS_pept        595272..596573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0493"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   rfr:Rfer_0716 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33844"
FT                   /db_xref="GOA:C7RL22"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL22"
FT                   /protein_id="ACV33844.1"
FT                   /translation="MSDIYQRIYQRKRMSATDAMSLVENGDFICVPTGVGEPPALLTAL
FT                   SEQRQTFHGVTVGQILPLRKFGYIDPATVDHVHHLSFFYGGATRPGGQEGWIDYLPSYF
FT                   SEMPSMIMNRQIRVDVVFSMASPMDEHGYFALSLGTDYTMAAVSMARAVILEVNPNVPF
FT                   TNGNCHVHISHIAGLVESDEAVLEVGLPQIGPVQEAIGEYVTDIIDDGSTLQIGYGAIP
FT                   DAVVMQLSHKHDLGIHTEMIGDGILKLLECGAVTNRKKNYLPGKMVATFALGSQKLYRF
FT                   MHRNPMLEMHPVDYTNDPYLAARNDKLVSINATLQVDLLGQCCSESFGPQPYSGTGGQV
FT                   DFVRAANRSRDGKSFIVLPSTAKGDSISRIVPALSPGAHVTTGKNDVNYVVTEYGLAEL
FT                   RGKTARQRAQALIGIAHPDFRGELSEAARRLKLM"
FT   gene            complement(596682..597920)
FT                   /locus_tag="CAP2UW1_0494"
FT   CDS_pept        complement(596682..597920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0494"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.2"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: ter:Tery_3999 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33845"
FT                   /db_xref="GOA:C7RL23"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL23"
FT                   /protein_id="ACV33845.1"
FT                   /translation="MSGKDSTGDFVYTDVGFRHYRRRRAERLLRTGTVLLLAYAVVWSG
FT                   VALVRGDWLTLALQSISFCGAAWVWYCLARGQLGLASHSYFWVVIPVVVCLVALEGIAG
FT                   PFRSMNHYHLLPLTVGAYLLFFEHGERARRLYAGGCLAIFVSVELGLLTLPALGLPYPP
FT                   EAQRAGRWILFFASFASLMYVAELFLADLAEAEKQLAGANTRLEELLENMLPASISQRL
FT                   RREGRTFADAFGECSVLFADIVGYTTLSESVPNVVNLLDAIFSRFDDLTEHCGLEKIKT
FT                   IGDAYMVAAGIPEARPDHASALAELALRMQAAIKEFPGLAIRIGINSGAVVAGVIGKKR
FT                   FIYDLWGDTVNIAARMESQGISGEIQISEATRAMLPASFVCEERGEIHIKGKGPMRVFL
FT                   LKGRLQQDAATSG"
FT   gene            598145..599596
FT                   /locus_tag="CAP2UW1_0495"
FT   CDS_pept        598145..599596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0495"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: eba:ebA6855
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33846"
FT                   /db_xref="GOA:C7RL24"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL24"
FT                   /protein_id="ACV33846.1"
FT                   /translation="MAVFSRLPTAIMIRTRFAPSPTGFLHIGGARTALFSWAYARHHSG
FT                   AFILRVEDTDLARSTPDAVRAILDGMLWLGLTYDEGPFYQTQRMDRYRAVIQEMLAAGT
FT                   AYHCYMAPEELDRLREEQRSQGVKPRYNGLWRPEPGKILPTPPAAVLPVVRFKNPRDGM
FT                   VAWDDLVKGRIEIANGELDDLVIARADGTPTYNFCVVVDDRDMGITHVIRGDDHVNNTP
FT                   RQINILRALGAPVPLYAHLSMILGDDGQKLSKRHGAVSVMQYDDEGYLPEAVLNYLARL
FT                   GWSHGDDEIFSMQQFCEWFDLDHITPSAAQFNTEKLNWLNAHYLKRTDIARLTALVRPR
FT                   LEARGLSVAGTPSLEAIIGLYRDRAANLNELADAAGIFYAHPEVPTRLLEKHLTPEALP
FT                   LLADFIAGLAEVAWEAPAIGALIKESVARHGMKMPKLAMPIRVLLTGQEQTPSVDALVA
FT                   LFPREEVLERLGKADDPRPSGIDPS"
FT   gene            599878..600183
FT                   /locus_tag="CAP2UW1_0496"
FT   CDS_pept        599878..600183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33847"
FT                   /db_xref="GOA:C7RL25"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL25"
FT                   /protein_id="ACV33847.1"
FT                   /translation="MSTAKVVERVDPREIRRKLGLNQQQFWSKIGVTQSGGSRYESGRN
FT                   MPKPVRELLRLVHVEQIDIQRLKREDFEVVEYLKAEDPDLFKTLRKAARSKVKKPV"
FT   gene            complement(600267..601922)
FT                   /locus_tag="CAP2UW1_0497"
FT   CDS_pept        complement(600267..601922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0497"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: dar:Daro_0932 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33848"
FT                   /db_xref="GOA:C7RL26"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL26"
FT                   /protein_id="ACV33848.1"
FT                   /translation="MLCRLTIRDFVLVDRLELEFQAGFGTLTGETGAGKSILVDALAFA
FT                   LGERADSSLIRTGSERAEVTAEFALERSPEASEWLLAHDMDSEGGLLLRRLVDANGRSR
FT                   AYVNGSPVTVQQLREVAEALVDIHGQHAHQSLMRGEAQRALLDAHARLDPLLAEVGKAW
FT                   RVWRAARTTLDTASNDIEALAAEREQLAWQADELAALGFSVEEWATLNDEHKRLAHAAN
FT                   LVDGAEHSLQVLAEGESACEARLGAVANRIDGLAEYDSALCEIGVLLHSAQAELAEAIS
FT                   SLRRYASRAELDPRRLAEIEQRIDAVLGCARKFRCKPEELPALLARCQERLAILGAAAD
FT                   VGALAERVAAARGDYERLARRLSDSRREAAAALAGEVSQVMQQLALGGGRFEVGLVPVE
FT                   GGNAAGFEQIEFRLAGLAGNEARPLAKVASGGELSRISLAIQVVTSQAASVPTLIFDEV
FT                   DVGIGGGVAEIVGRLLRELGADRQVLCVTHLPQVAARANWQWQVSKSTEAGEVRSLVTA
FT                   LENQARVEEIARMLGGIEITEITRQHAKELLGRA"
FT   gene            complement(601946..602872)
FT                   /locus_tag="CAP2UW1_0498"
FT   CDS_pept        complement(601946..602872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0498"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: dar:Daro_0931
FT                   ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33849"
FT                   /db_xref="GOA:C7RL27"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL27"
FT                   /protein_id="ACV33849.1"
FT                   /translation="MNNAFPQASPECAHLPRTIALIGKYHSPEIAESIRLLAKYLHERG
FT                   MTVLIEEETARNVVSQLDLRSWASGSFPWLGAHADMAIVVGGDGTMLNAARQLARYRVP
FT                   LVGVNQGRLGFMTDIARSDMLTCMDDLLDGKFVPEVRMLLDAEILRDERSVFANLALND
FT                   VVVDKGATGRMIEFELFIDGEFIYHLRSDGLIVATSTGSTAYALSANGPILHPQVSAIA
FT                   LVPLCPHALSNRPILVGDRKEIEIRVVYATDSRAHFDGQVTVDLRNDDTVRIRRSEYSI
FT                   CLLHPPGHSYFAMLREKLHWSERPKEH"
FT   gene            602948..603976
FT                   /locus_tag="CAP2UW1_0499"
FT   CDS_pept        602948..603976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0499"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: dar:Daro_0930 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33850"
FT                   /db_xref="GOA:C7RL28"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL28"
FT                   /protein_id="ACV33850.1"
FT                   /translation="MLDERAKTLLKTLIQRYIAEGQPVGSRALSKHSGLDLSAATVRNV
FT                   MADLEDIGLISSPHTSAGRIPTSRGYRFFVDSLLTVRPLDKEKIDAIEGQLFASQPRQL
FT                   ISNASHLLSGLSHFAGVVLSPRRLVPTIRQIEFVSLSEKRILLILVTADGDVQNRLLFP
FT                   GRAYSPSELVTATNYLNQHFVGHDFEHIRGHVQQELQKLRGDLQALMAAALAAGDEAMR
FT                   QPDDRYVISGERNLLDVEEFSSNMQRVRELFNLFEQRTSLMQLLDLSHRADGVQIFIGG
FT                   ESGLAPLDECSVVTAPYEVDGQVVGSVGVIGPTRMAYERVIPIVDITAKLLSSALTFHA
FT                   HC"
FT   gene            603976..605079
FT                   /locus_tag="CAP2UW1_0500"
FT   CDS_pept        603976..605079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0500"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="PFAM: ferrochelatase; KEGG: dar:Daro_0929
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33851"
FT                   /db_xref="GOA:C7RL29"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL29"
FT                   /protein_id="ACV33851.1"
FT                   /translation="MPSYLTEPTYRHGSPALTGVLLINLGTPEAPSAPAVRRYLGEFLA
FT                   DPRVVEIPRLLWWAILHGIILNVRPRRSAAKYASVWTSEGSPLKVHVERQAKLLRGRLG
FT                   LAGQQVRVDYAMRYGEPSIPATLSRLKAAGCTRLLLLPLYPQYAASTTATAIDAACAWL
FT                   QTVRNQPEVRTVRSFADHPGYIEALAASVREHWASNGRPTSSYRLVMSFHGLPRYALDR
FT                   GDPYHCECQKTGRLLAEALGLAQEQYQICFQSRFGRAEWLQPYTAPTLRALARQGVQKV
FT                   DVICPGFPADCLETLEEIAIEGKATFIEAGGREYNYVACLNERDDWIRALADIAASHLQ
FT                   GWPTTTPPDLSSLELSALRARALGAPS"
FT   gene            complement(605117..606469)
FT                   /locus_tag="CAP2UW1_0501"
FT   CDS_pept        complement(605117..606469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0501"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; protein of unknown
FT                   function RIO1; Serine/threonine protein kinase-related;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; KEGG: dar:Daro_0925 cyclic
FT                   nucleotide-binding:protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33852"
FT                   /db_xref="GOA:C7RL30"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL30"
FT                   /protein_id="ACV33852.1"
FT                   /translation="MTEKIGKYEIIRPLGKGATAVVYLARDPALNRQVAIKLIRFGEDS
FT                   AAMSRRLRKIFQTEDSIGRRLEHPNIVKVYDAVVEKDQAYLVMEYVDGGALDRFCAINR
FT                   LLPMHRVIGIIFKCCLALDHAFRQGVVHRDIKPANIMIDANENPKITDFGLGLYLHKDM
FT                   GKDSTFVMGVGSPAYMSPEQVKNYPLNHKTDLYSLGVLLFQLLTGRLPYRANNAATLVY
FT                   KIVNMDAPSVCALNPNLPPGLDPIIRKALEKDLYNRYRSGAEFAKDLSAVRYQMLEEDE
FT                   TERDLARFETLRKLPFFAEFEDIELWEVLRISRWQRMAEKVVLIREGESHRKFGVIIDG
FT                   FVEVSSNGRMICRLGASEVVGEMAFLHPSDSRRHATVVTLEPTEFLEINSAALELGSDE
FT                   LQDRFKNVLLVQVLARLREANRALTSLSGQTAVQGSLSASGLGLNPPLELL"
FT   gene            606648..607214
FT                   /locus_tag="CAP2UW1_0502"
FT   CDS_pept        606648..607214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0502"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: dar:Daro_0924 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33853"
FT                   /db_xref="GOA:C7RL31"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL31"
FT                   /protein_id="ACV33853.1"
FT                   /translation="MQVNDNEPVDIPAPPEAPEAVAASADVDAAPAADQAPVLEESLRQ
FT                   AELKAAEYHDAWLRAKAEAENVRRRAQEDIVKASKYSIDRFARELLAVKDSLEAALSTE
FT                   TLTVDSVRSGTELTLKQLVAAFEKSALTEINPLGQKFDPHHHQAISVVESQQEPNTVVT
FT                   VLQKGYLLADRVLRPALVVVAKSTT"
FT   gene            607311..609239
FT                   /locus_tag="CAP2UW1_0503"
FT   CDS_pept        607311..609239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0503"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: eba:ebA4794 chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33854"
FT                   /db_xref="GOA:C7RL32"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL32"
FT                   /protein_id="ACV33854.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMENGKPKVIENSEGARTTPSIVAYAED
FT                   GEILCGAPAKRQAVTNPRNTLYAVKRLIGRRFEEKEVQKDISLMPFKILKADNGDAWVE
FT                   VRGKKIAPPQVSAEVLRKMKRTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGMDKKQGDKKIAVYDLGGGTFDISIIEIAEVEGEHQFEVLSTN
FT                   GDTFLGGEDFDQRLIDYIIDEFKKESGVNLKADVLALQRLKDAAEKAKIELSSGQQTEI
FT                   NLPYITADASGPKHLTQKITRSKFESLVDELINRTIEPCRIALKDAGCKIGDIDDVILV
FT                   GGQSRMPKVQEAVKEFFGREPRRDVNPDEAVAVGASIQGGVLQGEVKDVLLLDVTPLSL
FT                   GIETLGGVMTKLIKKNTTIPTKANQVFSTADDNQSAVTIHVLQGEREMAAGNKSLGQFN
FT                   LSDIPPAPRGMPQIEVTFDIDANGILHVSAKDKATGKENKIKIQASSGLNEEEVQRMVR
FT                   DAELHAEEDRKAHELAEARNQCDGMIHTVKKSMAEYGKELSDSEKASIEEAMKEAEEAI
FT                   RGSDLDAIKAKSEALGTAAQKLGEKMYAKQQANAAGAEGGAGTAGEPKKDDSDVVDAEF
FT                   TEVKDKK"
FT   gene            609309..610430
FT                   /locus_tag="CAP2UW1_0504"
FT   CDS_pept        609309..610430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0504"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: dar:Daro_0922 heat
FT                   shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33855"
FT                   /db_xref="GOA:C7RL33"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL33"
FT                   /protein_id="ACV33855.1"
FT                   /translation="MAKRDFYDILGVNRDAADDEIKKAYRKLAMKYHPDRNPDNPKAED
FT                   HFKEVKEAYEVLTDPQKRAAYDQYGHAGIDPQAGMGGAAGAGGFSDAFGGIFDEIFGGG
FT                   RAGRSNIYRGADLRYNLEVTLEQAAFGTETKIRIPTMEVCDSCRGSGAKAGTQPKTCPT
FT                   CQGSGQVRLQQGFFSIQQTCPKCHGTGRFIAEPCAACHGAGRVKQHKTLAVKIPAGVDE
FT                   GDRIRLSGEGEHGINGGPSGDLYVQIHLKAHPVFQREQNDLHCEMPISFTTAALGGEID
FT                   IPTLDGAAKIRVPAETQSGKTFRLRGKGIKGVRSHTHGDLLCHVVVETPVHLTERQKEL
FT                   LRELEESSRENSDQHNPRAKSWMDRVRDFFAAT"
FT   gene            610612..611754
FT                   /locus_tag="CAP2UW1_0505"
FT   CDS_pept        610612..611754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0505"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dar:Daro_0920 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33856"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL34"
FT                   /protein_id="ACV33856.1"
FT                   /translation="MRYARALLFGVLSWIGCALGGEIGVTDNSILIGMTAPLSGTSGAY
FT                   GLDMKMVINAYFRQINEGGGIHGRRLELRALDDGYETERAVSNTRALISNERVFVLLGS
FT                   YGSSPTTAAMNEVFGVARVPLIGAISGADSLRQAPRDNSNNRYMFNVRASYANETEAIV
FT                   NQLVSLGIKNIAVFYQNDGFGRSGLDGVVSALRTHNLAPAAVATVERNSIEVSPAVQAI
FT                   AKANPQAVVMVTLYKATAAFVREMRQARQTPQFMTLSPVGADLLVQELGDEARGVGISQ
FT                   VMPYPWNDTIPLVREYQKLLGKQGKPSYFGVEAYAMARVLVDAIRKTGKDLTREKLIST
FT                   LESMQNHDLGGYRVSYSANDRLGSRFVDLTVIGSGGRVLR"
FT   sig_peptide     610612..610674
FT                   /locus_tag="CAP2UW1_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.935 at
FT                   residue 21"
FT   gene            complement(611819..613192)
FT                   /locus_tag="CAP2UW1_0506"
FT   CDS_pept        complement(611819..613192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0506"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: dar:Daro_0919 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33857"
FT                   /db_xref="GOA:C7RL35"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL35"
FT                   /protein_id="ACV33857.1"
FT                   /translation="MLKIYNSLTRAKQDFVPITPGSVRMYVCGMTVYDHCHLGHARVLV
FT                   VFDLVQRWLRASGLRVTYVRNITDIDDKIIKRALENKESIGDLTNRFIAFMNDDAAALG
FT                   VEKPDHEPRATEYVPQMLELIGRLEKNGLAYQVPDGDVNFSVRKFPGYGKLSGKALDDL
FT                   RAGERVDVDGTKEDPLDFVLWKHAREGEPSWPSPWGDGRPGWHIECSAMSSVLLGEHFD
FT                   IHGGGQDLQFPHHENEIAQSEGAHQCRFVNYWMHNGFVRVDDEKMSKSLGNFCTIKEIL
FT                   RKYDPEVLRFFILRAHYRSPLNYSDTHLDDARQALSRLYTALRTANTDPPSIDWDEPHA
FT                   LRFRDAMDDDFNTPEACAVLFDLAAELNRSKSATLAGQLRGLAGLLGLLGRDPQVFLQA
FT                   APSEGGELTAEQIESLISERAAAKAQKDYTAADRIRADLLSAGVVLEDGASGTRWRRA"
FT   gene            613301..614293
FT                   /locus_tag="CAP2UW1_0507"
FT   CDS_pept        613301..614293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0507"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dar:Daro_0918 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33858"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL36"
FT                   /protein_id="ACV33858.1"
FT                   /translation="MTKYTTSMLPSSPKPLKAPLLALFLGLLLSCAVSVFAADDLPEVQ
FT                   RLMKQGQLPQALEKVDAYVAGKPKDPQGRFLKGLILTEMGRSAEAMAVFGKLTEDFPEL
FT                   PEPYNNLAVLHAQQKQYEKARTALEMAIRTHPGYATAYENLGDVYAKLAGQAYEKALQL
FT                   EASNKGARSKLSMIRELTGNPASAAIKPGGASRPAGEPVKTVTAEARKGGAPSPAGDEA
FT                   EVRRALEDWAGAWSRKEVKAYLDFYAPDFQTPDGLSRQAWEADRAQRIGKPDKLLIELD
FT                   DVNVIVEGDRATVRFRQRYSSPTAKGSVGKTLIFMKSRGKWLIQQENTA"
FT   sig_peptide     613301..613414
FT                   /locus_tag="CAP2UW1_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            614354..614944
FT                   /locus_tag="CAP2UW1_0508"
FT   CDS_pept        614354..614944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0508"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ajs:Ajs_1621 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33859"
FT                   /db_xref="GOA:C7RL37"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL37"
FT                   /protein_id="ACV33859.1"
FT                   /translation="MQKSRLMPRILVLVAGAALSLAALAAPTIEMQTSMGKIVIDLDSE
FT                   KAPRSVQNFLQYVNEGFYNGTVFHRVIPDFMIQGGGFTVDMEQKPTPRKVENEARNGLK
FT                   NDRGTLAMARTADPNSASSQFFINHRDNASLNYPSPDGAGYAVFGKVTQGMDVVDRIAR
FT                   VATGNRSMHQNVPLEPVIIQSVKIIPDEKQGKP"
FT   sig_peptide     614354..614431
FT                   /locus_tag="CAP2UW1_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            614941..615432
FT                   /locus_tag="CAP2UW1_0509"
FT   CDS_pept        614941..615432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0509"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: dar:Daro_0915 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33860"
FT                   /db_xref="GOA:C7RL38"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL38"
FT                   /protein_id="ACV33860.1"
FT                   /translation="MIKLHTSFGVIGIEVDAEKAPLSAANFLSYAASGHYDNTIFHRVI
FT                   PGFMVQGGGFAPGMKQKPCGAPIRNEADNGLKNDAYTVAMARTADPHSATAQFFINAVD
FT                   NDFLNFRAPNAQGWGYCVFGKVVEGTDVVDKIRLVRTGTSGFHSDVPVEDVLIERAEVC
FT                   "
FT   gene            615494..617308
FT                   /locus_tag="CAP2UW1_0510"
FT   CDS_pept        615494..617308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0510"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: dar:Daro_0913 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33861"
FT                   /db_xref="GOA:C7RL39"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL39"
FT                   /protein_id="ACV33861.1"
FT                   /translation="MISPAAEILRRVFGYPAFRGEQAAIVDQIVGGGDALVLMPTGGGK
FT                   SLCYQIPALLRPGVGVVVSPLIALMQDQVDALRQVGVQAAYLNSSLDFRAVVDTERRLQ
FT                   AGELDLIYVAPERLLTDRFIGLLEQLIARDQVSLFAIDEAHCVSQWGHDFRPEYIQLSQ
FT                   LHERFPGIPRIALTATADQLTRQEIVSRLSLEDARLFVASFDRPNIRYTIVERDNPRRQ
FT                   LLAFLGVHGGAAGIVYCLSRRKVDETAAWLNAQGVTALPYHAGLAAADRQRHQQRFLRE
FT                   DGVVMVATIAFGMGIDKPDVRFVAHLDLPRSLEAYYQETGRAGRDGEASEAWMTYGLND
FT                   VVIHRQMIEDSAAPVEQKRVERQKLDSMLAYCESARCRRVVLLNYFGEATTPCGNCDVC
FT                   LDPPVVWDGTVVAQKALSAALRTGQRFGAGHLIDILRGKTTDKVLQFGHDRLPTFGVGA
FT                   DMDDTGWRSVFRQLLAGGLLEADAAAWGALKLTDAARPVLKGESRLQLRRQPARPQGRL
FT                   ARTKTATTRSSLPTNDPPLVATLRQWRSEKAREQGVPAYVILHDRTLYEIAELLPNSRQ
FT                   ALLSVPGIGLAKAERYGEELLAIVAGSA"
FT   gene            complement(617320..618852)
FT                   /locus_tag="CAP2UW1_0511"
FT   CDS_pept        complement(617320..618852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0511"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   neu:NE2123 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33862"
FT                   /db_xref="GOA:C7RL40"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL40"
FT                   /protein_id="ACV33862.1"
FT                   /translation="MFDLLLASLGALLALFVIGTMVYLYVQDVTQEKHAVLRNFPLVGH
FT                   LRYFFERLGEYFRQYFFLGDREEMPFDRATRSWVYRMAKNEGGIIGFGSTYRIHESGAL
FT                   IFVNAPFPVLDEEQQPSPALMIGEGYCATPFAGRSLVNISAMSFGAISRPAVRALSRGA
FT                   ASAGCWLDTGEGGLSPGHLDGGCDIIFQIGTAKYGVRDENGHLSDPRLCELAAQATVRA
FT                   FEIKLSQGAKPGKGGVLLGNKVTPEIAAIRGIPEGRDSLSPNRHRDIADIDQLLDLVEH
FT                   VRALTGKPVGVKTAIGGDQFLKDLAAAVARRGLQAAPDFLTIDGGEGGSGAAPQALADH
FT                   MALSIDEALPLVVDALIASGLRDRIRVIAAGQLVTPARVAWALAAGADFVNTARGFMFA
FT                   LGCIQALRCHTNTCPTGVTTHDPRLQRGLVVEDKAARVASYCRNMNKEVEMIAHSCGLP
FT                   HARGLRREHVRIVQPSGQSVALDVLRPYPTRRESGPGNCHAARPPLVPASQV"
FT   sig_peptide     complement(618772..618852)
FT                   /locus_tag="CAP2UW1_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.822 at
FT                   residue 27"
FT   gene            618912..619769
FT                   /locus_tag="CAP2UW1_0512"
FT   CDS_pept        618912..619769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0512"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: dar:Daro_2380 nicotinate-nucleotide
FT                   pyrophosphorylase [carboxylating]; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33863"
FT                   /db_xref="GOA:C7RL41"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL41"
FT                   /protein_id="ACV33863.1"
FT                   /translation="MTFAALLDAEIERNVIAALTEDVGSGDLTAQLVPADLVSRAQVIA
FT                   RENAVLCGSAWFARCFTRLDPTIRIVWQAADGQGVVADQLLCEIEGPARALLTGERSAL
FT                   NFLQLLSGVASKARQFADLVAGTRAQVVDTRKTIPGLRLAQKYAVSCGGGGNHRLGLYD
FT                   GILIKENHILAAGSISAALASAAQLAEKAAGVCQFIQIEVETLGELRQALDAGAAMILL
FT                   DNMDLDQMREAVAIAAGRAILEASGNVSLDTVRGIAETGVDRISIGGLTKDVRALDLSM
FT                   RFLA"
FT   gene            619805..619942
FT                   /locus_tag="CAP2UW1_0513"
FT   CDS_pept        619805..619942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33864"
FT                   /db_xref="GOA:C7RL42"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL42"
FT                   /protein_id="ACV33864.1"
FT                   /translation="MLFALFYVLAITILILHFTGFLARHNLEWLVLVLAAAVFPAVIYL
FT                   "
FT   gene            complement(620017..621504)
FT                   /locus_tag="CAP2UW1_0514"
FT   CDS_pept        complement(620017..621504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0514"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: dar:Daro_2382 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33865"
FT                   /db_xref="GOA:C7RL43"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL43"
FT                   /protein_id="ACV33865.1"
FT                   /translation="MRYISTRGNPPSTADSSGPTFCQILLGGLAPDGGLYLPDHYPQVS
FT                   RTELDQWRGMAYADLAHAVLTKFIDDIPLDDLARLVARTYTAEAYGNGRVSAQASDITP
FT                   LRWLEPPDPAQREAGLAILELSNGPTLAFKDMAMQLLGNLFEYVLARQGEEINILGATS
FT                   GDTGSSAEYALRGKKGVRVFMLSPHERMSAFQRAQMYSLHDENIHNIAVRGMFDDAQDI
FT                   VKAVSNDHAFKARYRIGAVNSINWARVAAQVVYYFKGYFAATGGIAGSNDQQVAFAVPS
FT                   GNFGNICAGHVARMMGLPIGRLVLATNENDVLDEFFRTGVYRPRAAAETSATSSPSMDI
FT                   SKASNFERFVFDLVGRDPAVIRRLWAEVDAGGSFDLSGTPFFARLPEFGFVSGRSTHAD
FT                   RLATIRQTFGQYGLMIDTHTADGLKVASEWRTPEMPMVVLETALPAKFEETIVEALGCK
FT                   PERPPGLQGIESLPQRFAVIDVSVDAVKELIAQGVHA"
FT   gene            complement(621609..622340)
FT                   /locus_tag="CAP2UW1_0515"
FT   CDS_pept        complement(621609..622340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0515"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: har:HEAR1864 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33866"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL44"
FT                   /protein_id="ACV33866.1"
FT                   /translation="MFKHDQSPLVHSSRRASRRLHRRPASIQLAAQEAIGRSAVIGRSR
FT                   HSHIRQIDATRPAAPILELLAAEVRIGELEAALNEARAAAFTDALTGALNRRGFDDAYQ
FT                   REVARARRNGSRLALALIDLDDFKRLNDTLGHQAGDEALVHLAKGLRAALRPSDILCRF
FT                   GGEEFVLLLPETGLSEAATAIARFQRHLAANALPDRDVVVTFSAGVVVQGPGESLEDSL
FT                   QRADAATYAAKRAGKNCVVTA"
FT   gene            complement(622461..623594)
FT                   /locus_tag="CAP2UW1_0516"
FT   CDS_pept        complement(622461..623594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33867"
FT                   /db_xref="GOA:C7RL45"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL45"
FT                   /protein_id="ACV33867.1"
FT                   /translation="MLIYLGLSAVAVFIAALVLLQSASLSPPAVAHLVLAVGIAPLILG
FT                   AITHFMPVLTRSGSPRRGLSWAPLLLQCAGGTAFFGFTGTAPPLAMVVAAVVMLLVALL
FT                   FAGWLMSRARRTLGSPHPGWRWYLAAIVCLSLAMALVPAINGWPEMRRELRLLHLHLNT
FT                   LGFIGLSALGTLQVLLPTVLSGPDADAAARLRRDLPMAGGAVLGIALGAAFAPALAIAG
FT                   ALMLLSVVLRTGVSWSRRYGWRTLLGDGGAAALLAALVGFSLLLVFGIAHAFGVVEGQN
FT                   AVPAFVVAFLMPLVTGALSQLLPVWRHPGRRTCARERMLAELRRGGAARSLLFVVSGTL
FT                   LALGAHAGIWLAAAAMLFFVTALLGSLAVARNAPGTS"
FT   sig_peptide     complement(623499..623594)
FT                   /locus_tag="CAP2UW1_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 32"
FT   gene            complement(623695..623952)
FT                   /locus_tag="CAP2UW1_0517"
FT   CDS_pept        complement(623695..623952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33868"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL46"
FT                   /protein_id="ACV33868.1"
FT                   /translation="MHACGQPTQEAIYPFDARGVAKRFRHAAIFGALDALIVGETMRFC
FT                   NDHDPLPLLAQLRDHYGDTLVIRYVQREAGAIVIDFTRTT"
FT   gene            624413..626026
FT                   /locus_tag="CAP2UW1_0518"
FT   CDS_pept        624413..626026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0518"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: MORN repeat-containing protein; peptidase C14
FT                   caspase catalytic subunit p20; SMART: Peptidase C14,
FT                   caspase precursor p45, core; KEGG: glo:Glov_1080 peptidase
FT                   C14 caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33869"
FT                   /db_xref="GOA:C7RL47"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL47"
FT                   /protein_id="ACV33869.1"
FT                   /translation="MMLWRIVFSLVVLAGLALGALSSASAAERRVALVIGNAKYKEAPL
FT                   TNPVNDARDMAAALQRTGFEVIMAIDATQKEMNRAIAKFGDRLTTDSVALFYYAGHGMQ
FT                   VRGKNYLIPIDAEIKSESSVRVESVDVDGVLDQLSTSDLNVVILDACRNNPFERRANRS
FT                   VGAAGLAQMEAPKGSLIAYATAPGRTAADGDGRNGLYTQALLKYVQEPGLTIEQVFKNV
FT                   RREVAKATRDGQIPWESSSMTGDFFFIPGSRPSPAFSQPVASIPSGKAPAAPEARPAQV
FT                   QEVTSPAGLARQNGSGQGSAASSVSQPPPPPAPAVPSQSPVTPEPATSPARPETLAALS
FT                   APTAQPAAEPAAAINKPEPPAEVRERVIKTEAFTATGKLSIERLTGAMTGEGTIQWANG
FT                   DRYEGTMIAGRKHGKGIFTWSNGQRYDGEWADDVINGKGVLHYTNGDRYEGTFTDGEPH
FT                   GTGTYTMRNGDFYTGAWVSGNRHGQGRLTWTTGDYWEGEFRDGKQTDNGRMHSSQAMVA
FT                   KIAEQAAAGADKGAAKKKGK"
FT   sig_peptide     624413..624493
FT                   /locus_tag="CAP2UW1_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 27"
FT   gene            626072..627865
FT                   /locus_tag="CAP2UW1_0519"
FT   CDS_pept        626072..627865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0519"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   azc:AZC_3466 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33870"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL48"
FT                   /protein_id="ACV33870.1"
FT                   /translation="MNERPGPFSDVLACHRAGRYREAEALLLESLARQPRQPDTWNLMG
FT                   ATLAGLRRYPDAENAYRRALALQPDHLGALNNLAVLLRQTGRAEEARRTYLETLRHEPR
FT                   HVDAWNNLAALHAARQEYDQALTCYRKVLELQPDYGHALGAAANAMAMLWEWSGRASIC
FT                   QRLADGIRAGASVTVPFVVLSHLDEPELQLAGARAWARRFDAVAMGPLPVWQHDRLRVA
FT                   YLSADLREHPVGLQIAELIERHDRRQFEWFGVYFGPRVPGDATHRRLRLAFDSFLDIAR
FT                   LSDEEAARRLRALEIDILVDLGGHTLDGRPGLVARRPAPIQVNWLGYPGTSGASWIDYI
FT                   VADRFLVPPESRSGYSERIVYLPDCFWVSDSQRPAAGRVPERVELALPAEGFVFCCFSH
FT                   SYKLNPAMFAVWMRLLRQVAGSVLWLLAAKPEAEERLRREADRCGVDPTRLVFAPRIDL
FT                   AAHLARHAQADLFLDTLPFNAITTTSVALHAGLPVLSCSGRSFAARGAGSLLQAVGMSA
FT                   LVTGNLSDYEARALELATHPERLASLRRALAERLQTGPLFDAERFRRHLEAAYRAMWTR
FT                   WQGGEAPADIVVRAAGTATAA"
FT   gene            628027..628560
FT                   /locus_tag="CAP2UW1_0520"
FT   CDS_pept        628027..628560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33871"
FT                   /db_xref="GOA:C7RL49"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL49"
FT                   /protein_id="ACV33871.1"
FT                   /translation="MRRYLKKFLPDHEAIRANPWLRPFQSSLLHPRLWHLNRHSAAGAV
FT                   AVGLFCGLIPGPLQMIGAAIGALVFRVNLPLGLLVTLYTNPFTIVPLYLLAYQLGRLLI
FT                   GDNTGFVAPPEFGATSFGNWTDAMRIWMLGVSMPLGVGLVTLACALSLVGYLATRVAWR
FT                   IYLVHAWRRRQRRC"
FT   gene            628730..630898
FT                   /locus_tag="CAP2UW1_0521"
FT   CDS_pept        628730..630898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0521"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: chemotaxis sensory transducer; Hemerythrin HHE cation
FT                   binding domain protein; Cache type 2 domain protein; KEGG:
FT                   glo:Glov_0461 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33872"
FT                   /db_xref="GOA:C7RL50"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL50"
FT                   /protein_id="ACV33872.1"
FT                   /translation="MISALRRLSLMNRLSLTAVLALLAMLLIVWESLWSLHGLLYSDRQ
FT                   VKTRHLVETAISVLDHYHGLQKAGTLSEDEAKQRAVAVVKGLRYEKTEYFWIQDLGKPV
FT                   PRMVMHATVPALDGKVLDEARFNKAISLQAGLNGSKVSVDGKNLFVSFNEVVEQAGDGY
FT                   VEYLWPKPVAGGGVTSELFTKLSYVRKFEPWGWVVGSGIYIDDVNRIFREEAIHSVLFA
FT                   IGATLVLLLAGWLVRKSIVSEFGGEPRVALAATSRIADGDLTHAIPLQSRDKDSVLFVL
FT                   AHMQNSLKDMLRAIFSNASRLQASIERLSAESNQINLATQVQAGAVNHTRSAISDVSAS
FT                   VEVVNGLVHATEDGAHEVARRAHDGADVAAKVAAEMQAIANTVAVSSDQVSRLVASTGE
FT                   IGQMARVIKEIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERTSKATSEIGA
FT                   ILDGIRTDTESAVEGMKAAAPVIASGVTQANSAADTLHAIEEQAQDTLQKMQALSQATR
FT                   DQTRRIEDIVSNVDEVMNASGQTEAVIKQSLQSAADLEQASSEMFSMVQRFRIGEVAAG
FT                   GLPPTGDGRAAAKPLLEWSTALAVGHAEIDRQHQVLIEIANRLNNAMGSGAGRTSCGTI
FT                   LDELLNYTVNHFSFEEKLMEKHHYADREAHLAKHRDLIERVKTFKRQYESGGTISVELM
FT                   GFIRDWLVNHFLKVDRALARDLASRGVS"
FT   sig_peptide     628730..628825
FT                   /locus_tag="CAP2UW1_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.500 at
FT                   residue 32"
FT   gene            630980..632275
FT                   /locus_tag="CAP2UW1_0522"
FT   CDS_pept        630980..632275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0522"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dar:Daro_3345 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33873"
FT                   /db_xref="GOA:C7RL51"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL51"
FT                   /protein_id="ACV33873.1"
FT                   /translation="MTDPGRQLRRRRAQGLAIVVAAYVLSFFQRFAPAGIAQDLIAAFN
FT                   TTASSLGVLAATYFYVYTLMQVPTGILVDTLGPRLILLLGGGIGGAGSLLFGLAPTLDL
FT                   ALLGRTLIGLGVSVTFIAMLKIIAVSFDERRFASLVGVSMLIGNLGSVLAGAPLSWLAQ
FT                   ITGWRGIFVGLALLSVLLGIGCWWLLREHSDAAESLSVTDGKPRFDRTVVISGLLTVLR
FT                   NRDTWPVVCVNFGICGSFFAFAGLWATPFLTTAHGMTRAVAANHVSLYFAGFALGCVFV
FT                   GTLSDRLGRRKPVLVASTHLYALIWLVWLSGAALPLAASYLLFALMGVVTASFTLTWAC
FT                   AKELNPPLLSGMSTSVTNMGGFLAAAILQPLVGWVMDQTWQGGVTAGGARLYTPADFHA
FT                   GLLLLAAMAGLGALASWRIRETGCRNIWRPVG"
FT   gene            complement(632323..632853)
FT                   /locus_tag="CAP2UW1_0523"
FT   CDS_pept        complement(632323..632853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0523"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: dar:Daro_2109
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33874"
FT                   /db_xref="GOA:C7RL52"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL52"
FT                   /protein_id="ACV33874.1"
FT                   /translation="MLFPRLPPPLCLACVLVLSACATTDKAPPGDSGQAAAAREQPSRV
FT                   PATPVRVGSAKAPTPFADDETRRVVYFAFGETMIDSESADILRQNAQKLKEDPQLVVTL
FT                   VGHTDNLGSAAYNLAVADKRIEAVSDRLRSLGVPRSQIRRLPVGSEQSSKQACDSEACR
FT                   RTMRRVELVYERR"
FT   sig_peptide     complement(632785..632853)
FT                   /locus_tag="CAP2UW1_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.570 at
FT                   residue 23"
FT   gene            633110..633997
FT                   /locus_tag="CAP2UW1_0524"
FT   CDS_pept        633110..633997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0524"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   dar:Daro_2968 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33875"
FT                   /db_xref="GOA:C7RL53"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:C7RL53"
FT                   /protein_id="ACV33875.1"
FT                   /translation="MNATRQLAGIGFGLTAYAMWGFFPLFFRQLAHVSPMDVLSNRAVW
FT                   ACLLVGLLLTLRRQWGKVAAVFGQSRQLLMLTIAAFLIGSNWLVFLWAVANQQVVASSL
FT                   GYFLTPLVNVLLGLVVLKERLNRLEWVSVALALAAMTNEIVSLGSLPWVSLVLAVTFGT
FT                   YGLVRKQLPVDAVSGLWLETLAMLPVCGLYAFWQAQAGHPVFTGHDLRTTGLLISAGAL
FT                   TALPLMAFAAATQRLDLASVGMLMYINPTLQFVTAVWLFGEPMQSARLLSFGLIWLGLL
FT                   VFSWSAWGKYRQPR"
FT   sig_peptide     633110..633205
FT                   /locus_tag="CAP2UW1_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.315 at
FT                   residue 32"
FT   gene            634039..638751
FT                   /locus_tag="CAP2UW1_0525"
FT   CDS_pept        634039..638751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33876"
FT                   /db_xref="GOA:C7RLI2"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI2"
FT                   /protein_id="ACV33876.1"
FT                   /translation="MPNAEFDLFISYRRSDSAGHARALYRDLCRRFDKQRIFFDRESIE
FT                   AGSVFPDRLREGIDACRVLLALIAPGWLDAKNAAGQRRLDSEDDFVRQEIAGALRLGRH
FT                   VIPVLFDDTPMPDAGQLPEVLWPLAACDALLLRGKNFEYDVQLEELIRLLAAVPGMPVP
FT                   LPAGAGVVIGAGLDFDVYRRTPYVLIRLRAPLRAAFQPLIDDRTRFFAGRRQVVERIMQ
FT                   FTSRDEGGYLVITAPPGFGKTALMANLVAATPEAFAYHFFAPVYGEETLDEKFFLQNVL
FT                   QQMAAWHGHNAELPEAINELRALYQTFVDTPLEHDQVLVLDGLDEVAHWQLAPYLGRRL
FT                   PAHLHLVVTLRDVGQDWLRDYAFPADQVTPLALGGLDRDDIRQLFAGLGAAGARIAGNP
FT                   VLLEQIVDRAAYADAPGLGADPFYVRFLAEDVAAAEVTPEQIADQPRGLDAYLDRWWKQ
FT                   IVQLAGDAPLRDLFGTLAAALGPIARGDLEAINASLRDDWAGDFFEQVLSRVRRLVRRD
FT                   GAGRYGLAHPRLRQYVADPRRIGKINDYRGRVLEYCRRWPEHRSPYALTCLGTHLAEAG
FT                   HLDELARLFSSEWLAAQWSILHTWAALIADIERVAKALLALPAPDYPRILGLVVARQTA
FT                   RELMLGFPDEVYVAWTAQGESERALACLGALGKTGARAINPLLAVAGKLLEVHREGADD
FT                   HAEQAAELLQQVIDQLPLVRRTNEQHQIVSALAALLPRERGLPELRRLQLLRQAVEFAE
FT                   RADDLVLRAAALGSLASALAASSTDREQARPLLDRARTALAGIDFPADRAFVFASQLPA
FT                   LQILAPATVLPELTALVNQGKALLQHGSLAKSPLIRLLERWRPGDGEQRQETIALLCRL
FT                   AALYLDTTVADYAGVALSVIVPDLCWLGRVDLASDLVERCWAADAVEGARIVAYAIDTL
FT                   EELLPEKVSAWLVAAAPLTDPAHHDMPINRELFTAAVANARAATGDWHGALELAATLRG
FT                   SERADALVGLLRRLGAASQVEATQRESLVDEILALAGDADEAARNDGMARVVAVAAQVL
FT                   GGAAGSRGEALLAQATALCLARLPEGDLDELRRLLAVALHADGASAEALRVVSGMTWVD
FT                   GVAATLTFLAQAMAADPGRRDAYVEVLIEQLAERAGAALYGDALRAAAPLVVGLARQQA
FT                   PLAGVLAEAISQGLGALRLDDQIEVVATLAAGLCLVDADRGASQYGRLLDWIDSLRAQG
FT                   YAMAAAAIARFIVQLASVAEPLGDRLAPLVDRVRAVAADFTDDADAISVRGALCLFDVR
FT                   QGCAAVRDGLQALLPAVATLAAAGPRALYLTRMFADLVGRRSGRHEAQARAVAALAEAV
FT                   VRCAHPCPAEASRVIADCLEQALTIHTEDDRAQALIDIFGKLPAGPAGWSRRIEGPVAS
FT                   VLARTQIADGERFVDVCAAAVAAMCACDDVDAAERLARQASDPDLRDRLLSDIERERER
FT                   LTLGELSDFERAFVAIGNGQLAHAVLHSVKVENDSANILGYLVEALVVEEWGTERERLL
FT                   AEFLPQVAAPLRALHGTAAIARLLAELEAVDGAFLAAASIVGKGGGQRIG"
FT   gene            639018..639266
FT                   /locus_tag="CAP2UW1_0526"
FT   CDS_pept        639018..639266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mar:MAE_11940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33877"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI3"
FT                   /protein_id="ACV33877.1"
FT                   /translation="MPQRIPKAMAEKFAAITTLTDAFCDEKLNDEYREMIHQVVGALAR
FT                   KRPSPLLRGTEKVWAAGAVHAVGRINFLDDPSHVNTD"
FT   gene            complement(639402..640187)
FT                   /locus_tag="CAP2UW1_0527"
FT   CDS_pept        complement(639402..640187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0527"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p2A369 transposase/IS protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33878"
FT                   /db_xref="GOA:C7RIW9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW9"
FT                   /protein_id="ACV33878.1"
FT                   /translation="MNLQYERMLALCDSLNLPFVAQNYVGAAQEAAAQESAYSDFLEAL
FT                   LKAEVAGRQVRKQSMLTRLAGFPAIKTLEEFDYAFAAGVKRSQIDELAGLAFVERNENV
FT                   VLVGPSGVGKTHLAIALGYRAAQAGIKTRFTTAADLLLTLSAAHAQNQLKAVMHRAIAA
FT                   YRLLIIDEIGYLPMSREQANLFFQVIAARYEKGSLIVTSNLSFGQWDATFAQDATLTAA
FT                   LLDRLLHHAQIVPIAGESYRLKRQRQTGMVQARKAIAGG"
FT   gene            complement(640184..641272)
FT                   /locus_tag="CAP2UW1_0528"
FT   CDS_pept        complement(640184..641272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0528"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:p2A281
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33879"
FT                   /db_xref="GOA:C7RIW8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIW8"
FT                   /protein_id="ACV33879.1"
FT                   /translation="MITKEVYVEIEVLRKHGFSLRKIAAEVGCAVNTVRSHLAQGKQPR
FT                   YQRQKKRATKLSTHETYLCERQAAAQPQWIPATVLFREIRALGYAGGVSQLRAFMRTIR
FT                   PQGAADPVVRFETAPGEQLQIDWVEFRKGADPLYAFCATLGYSRASYVEFVTDMKVSTL
FT                   IDCHQHAFEALGGVARRLLYDNMKTVVLERDVDGPGEHRYHAGFLDYAKHCGFVINLCR
FT                   PYRARTKGKVERFNGYLRRSFYVPLISRLKQAGLPLDAVTANAEVRRWLKEVANVRIHA
FT                   STQVQPAQRLQEEQAHLQGIPPPWRGDIAAARPLDAPPPVEGATVRPTVAERIALPTPE
FT                   QHPLAVYAQLLTQLQAAAEMQP"
FT   gene            641360..641617
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0529"
FT   gene            complement(642270..643985)
FT                   /locus_tag="CAP2UW1_0530"
FT   CDS_pept        complement(642270..643985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0530"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: shw:Sputw3181_2399 RNA-directed DNA
FT                   polymerase (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33880"
FT                   /db_xref="GOA:C7RLI6"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI6"
FT                   /protein_id="ACV33880.1"
FT                   /translation="MFFLTNLKSAKSLHDVACLLGYKPKSLSYVIYKMPLNYTTFTVPK
FT                   KSGGVRSISAPRPELKLLQRRLSDGLQSCWDEINDQKKITKPISHGFRRDASIVTNASV
FT                   HRGRRFVFNVDIKDFFDSINFGRVYGFFVKNKDFALTESAAKVLAAIACHDGKLPQGSP
FT                   CSPVISNLIGQILDVRLAQLAHRHGCSYSRYADDLTFSTNERIFPSMIALSNADHSWVA
FT                   GAVLSKIIEKSGFQLNPKKTRMQYRNSRQEVTGLVVNRRINTRPEYRRLTRAMTHQLVT
FT                   TGKFQLTKTKADVLGKLVPTKIDGSITHLQGMFGFIDWIDLCHRKNQEVPNVQQSAIGK
FT                   VYKRFLMHRDFWANSLPIILCEGKTDSVYLRGAIRRLATAHPNLVSTNAAGKSEFKVRF
FT                   FNYSYTSQRILDLSGGAPVVRRFITEYIKSVKKTQAPVNPKPLILLLDNDSGGQVFYSL
FT                   IKQYNGKKTTVNGMDDFYHLAENVYVVFTPIDKPGDNSSIEDFFEPSLLAKKIDGKTFN
FT                   ADDTTFDKNKEYGKADFAAKIVRPNIAKINFEKFDPILARIEGVIEAHSKKHFP"
FT   gene            complement(644255..645550)
FT                   /locus_tag="CAP2UW1_0531"
FT   CDS_pept        complement(644255..645550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0531"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: maq:Maqu_4119 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33881"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI7"
FT                   /protein_id="ACV33881.1"
FT                   /translation="MEDNSGLSSRDRFLMIETLFTQALGLVAPWQVEQVTFQPEAGRID
FT                   FQVRFGATIHACPACGASAQPLHDRLARSWRHLDFFQYEAHLHTEVPRVACAGCGKVTQ
FT                   IPVPWAREGSHFTLLFEALTLMLAPTMSVLAAGRLLRVGSRRLWRVIDHHVGQARAQQS
FT                   HAGVLAIGVDETASRRGQTYIAVFYDLDAQRLLFATPGRDKATLGKFASDLIEHGGQPT
FT                   AITHVSTDMSASFQTGAAEHFPLAEVCFDRFHVVALSSTALDEVRRAEVKSEPELKGTR
FT                   WSLHKKPADWTVKQTQTMHWLQRTNLKTARAWRIKQALRAIDIAAKTPDQARPLLKRWL
FT                   SWASRCQLEPFKRLARTITKHLPGVLNGFQVGKHNGRVEAMNRALQEARARARGYRRVE
FT                   NFIAMAYLIAGKLTHLPAPPFACFLRVPQETD"
FT   gene            645740..646480
FT                   /locus_tag="CAP2UW1_0532"
FT   CDS_pept        645740..646480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0532"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: eba:ebA1360
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33882"
FT                   /db_xref="GOA:C7RLI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI8"
FT                   /protein_id="ACV33882.1"
FT                   /translation="MRALVSTIYGRAIEWGHATTNPVTGIRTRAKVKRDRFLQADELPR
FT                   FFQSVAEEPNETLRDYIPLALLTGARRSNLLAMRWAEINLADSVWRIPDPKNGTPQNVT
FT                   LSPEAVTILQARKEAAKLGAVFVFPGTGASGHIEEPKKAVIRIMARAGIPYGRNDPDGV
FT                   TLHDLRRTLGSWQAKTGASLAIIGNSLNHKSQQAMAIYARPDLDPVRASVNTATAAMME
FT                   AGGMKQKLAVVPLLRRAGATRKSP"
FT   gene            646477..646707
FT                   /locus_tag="CAP2UW1_0533"
FT   CDS_pept        646477..646707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mar:MAE_35950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33883"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLI9"
FT                   /protein_id="ACV33883.1"
FT                   /translation="MKCLICRNGETRSGAVTVPLERGGMTIVFREVPAQVCENCGEAFH
FT                   DEAVTASLLQQAEQAALAGVEIDVRRFAVAA"
FT   gene            646704..646964
FT                   /locus_tag="CAP2UW1_0534"
FT   CDS_pept        646704..646964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mar:MAE_20750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33884"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ0"
FT                   /protein_id="ACV33884.1"
FT                   /translation="MILHATEVTSLSGYRLFLRFNNGTAGEESLANELDGEVFEPLRAP
FT                   ALFATASQHPVMRTVAWANGADVAPKLLLEPMKTQQGNRAA"
FT   gene            646988..647428
FT                   /locus_tag="CAP2UW1_0535"
FT   CDS_pept        646988..647428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0535"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   mca:MCA0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33885"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ1"
FT                   /protein_id="ACV33885.1"
FT                   /translation="METTLYQSDYYTWARQQADMLREGRFDDLDAAHLIEELEAMGASE
FT                   RRELTNRLTVLLMHLLKWQFQPARRGAAWSLTIRVQRMDISDLLNDEPGLTPEVPQALE
FT                   KAYRKARLLAANETGMDETTFPKQSPYSIEQTMADDFLPEGN"
FT   gene            complement(647628..647750)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0536"
FT   gene            complement(648278..648354)
FT                   /locus_tag="CAP2UW1_R0007"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(648278..648354)
FT                   /locus_tag="CAP2UW1_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(648496..649950)
FT                   /locus_tag="CAP2UW1_0537"
FT   CDS_pept        complement(648496..649950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0537"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: dar:Daro_0180 ribonuclease
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33886"
FT                   /db_xref="GOA:C7RLJ2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ2"
FT                   /protein_id="ACV33886.1"
FT                   /translation="MSEEILINFTPQETRVAVTHQGVVQELHIERSASRGFVGNVYVGR
FT                   IVRILPGMQSAFIDIGLDRTAFLHVADIREPRSNDEPLRPIERLLFEGQSILVQVIKDP
FT                   MGSKGARLSTQVSIAGRMLVYLPQDNHIGISQRIERESEREALREKLHRLVPSDEKGGF
FT                   IVRTMAENATEAELAKDIEFLRKIWRDIQAQSTTAAPPSLLYQELSLAQRVLRDFVNPE
FT                   TARIVIDSRENFQKLTAFAGEYTPTVAPLLEHYIGERPLFDLHGVEDEIQKALARRVDL
FT                   KSGGYLIIDQTEAMTTIDVNTGGFVGVRNFDDTIFKTNLEAAQTIARQLRLRNLGGIII
FT                   IDFIDMENEEHRMAVLSEFNKALARDHTRLTVNGFTALGLVEMTRKRTRESLAHVLCEE
FT                   CPTCGGRGEVRTARTVCYEILRELLREARQFDAREYRVLGSQAVIDRFLDEESQGLAML
FT                   SDFIGKPISLQAEPSYSQEQYDIVLM"
FT   gene            650047..651360
FT                   /locus_tag="CAP2UW1_0538"
FT   CDS_pept        650047..651360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0538"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: eba:ebA2789 peptidase
FT                   family U32 protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33887"
FT                   /db_xref="GOA:C7RLJ3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ3"
FT                   /protein_id="ACV33887.1"
FT                   /translation="MPQTVALVPPELLAPAGSLAMLRTALAFGADAVYAGQPRYSLRVR
FT                   NNDFGNLQALASAINEAHGAGRKLYVVSNVLPHNSKVRSYLDDMAPVVALAPDALIMAD
FT                   PGLIDLVRETWPELPVHLSVQANTVNFAGVRFWRKLGIRRIILSRELSLDEVAEIRQEC
FT                   PDIELEVFVHGALCIAYSGRCLLSGYFNHRDPNQGTCTNSCRWDYKLTAGVADATGDVG
FT                   ACRSPAAGAADGTWLLEEKERPGELMPIDEDEHGTYIMNSKDLRAVEHVRRLTEIGVDS
FT                   LKIEGRTKSPYYVARTVQVYRRAIDDAAAGRPFDPSLLGELEGLANRGYTDGFYQRHHE
FT                   HERQNYLRGHSQSGRSLYVGDVLDWDAERLLALIDVKNRFSVGDRLEIIHPTGNRELSV
FT                   ERIQSLLGADIRVAPGNGHRVWIPLPAGLPGAMLARFL"
FT   gene            651376..652467
FT                   /locus_tag="CAP2UW1_0539"
FT   CDS_pept        651376..652467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33888"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ4"
FT                   /protein_id="ACV33888.1"
FT                   /translation="MSRPHLFVDISAHGFGHLAQVAPVLNALTERLPALRLTIRSGLPT
FT                   AKLQTRIAAAFTHLIGSSDFGYVMHDAVSLDLPATALAYRRQHADWPAQVERDARVIAG
FT                   LRPDLVFSDVAYLPLAAAALVGIPSVAMCSLNWADLFAHFFAGESWAAEIHGQMLAAYH
FT                   SVESFLRLTPGMGMPELRRLRSIAPVAALGNDCREALRRQVGCATGERLVLIAFGGVSK
FT                   ALPIADWPPLAGVRWLIPQDWQLEHPSVVSFEGLGRPFTDLLASVDAVITKPGYGTFAE
FT                   AACNGTPVLYLRRSDWPEQDALLDWLNGHARCREVSEADLLDGCLHAALEALWRQPARP
FT                   VPRPSGAEEAAAALLPWLAGRGA"
FT   gene            complement(652464..653096)
FT                   /locus_tag="CAP2UW1_0540"
FT   CDS_pept        complement(652464..653096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0540"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: dar:Daro_4095 riboflavin
FT                   synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33889"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ5"
FT                   /protein_id="ACV33889.1"
FT                   /translation="MFSGIIAALGQITCITARDDGAGTVRLTIDAGRLALDDVNLGDSI
FT                   ACNGVCLTVVDRRDNSFCVDVSPESLACTVGLATPGPVNLEKALRLADRLGGHLVSGHV
FT                   DGVGEVLRFDPVGDNRLLEIRAPAALARYIARKGSITVDGVSLTTNSVDGAAFSINLIP
FT                   HTLDATTLGRLQPGSRVNLEIDLIARYVERMLGAPSGEPVGSTAASS"
FT   gene            complement(653156..654274)
FT                   /locus_tag="CAP2UW1_0541"
FT   CDS_pept        complement(653156..654274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0541"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   ppd:Ppro_0405 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33890"
FT                   /db_xref="GOA:C7RLJ6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ6"
FT                   /protein_id="ACV33890.1"
FT                   /translation="MNPVEKPFEMARPTLAVLFLCVLIAASLWILRPFLPALIWATMVV
FT                   VATWPLMLRAQRRFGNRRWPAVILMTFLVLLILVVPLSVAIATIVGNADEITEWAKSLS
FT                   SLHVQSPPAWVADVPFVGWRLEQIWQQTATTGGTELAAKVAPYAANLTRWFVSEIGSFG
FT                   LVFVQFLLTVALCAVLYASGEKAAAGVRRFGYRLSGERGEGAVILAGQAARAVALGVGV
FT                   TALVQSILGGIGLAIAGVPFAPVLTAVMFMFCIAQLGPGLVLVPAVVWLYWGDHTGWGT
FT                   FLLIWAIFVGTMDNFLRPVLIKQGADLPLLLILAGVIGGMLAFGLVGLFVGPVILAVGY
FT                   TLLEAWINEVPHEIDSVAPKVGDGAADRQTPA"
FT   gene            654626..656125
FT                   /locus_tag="CAP2UW1_0542"
FT   CDS_pept        654626..656125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0542"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: dar:Daro_3735
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33891"
FT                   /db_xref="GOA:C7RLJ7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ7"
FT                   /protein_id="ACV33891.1"
FT                   /translation="MNHALLFSVFIVASCGLAYELIAGALASYLLGDSVTQFSTVIGTY
FT                   LFAMGIGSWLSRYVERHLVARFIQVELMVGVLGGFSAAALFFIFVWSPAPFKLALYLAV
FT                   AGVGVLVGLEIPLIMRIMKRDLAFKDLVSQVLTFDYLGALAVSILFPLLLVPHLGLVRS
FT                   GLLFGLLNVIVALWAWWLFRAQLQPFGRLRAQGAAALLSLLVAFAAAGELTSLAEAQLY
FT                   ADEIVHAESTPYQRIVVTRWKNDLRLHLNNNLQFSSRDEYRYHEALVHPGLATLPNARR
FT                   VLVLGGGDGLAVREILKYPQIESVTLVDLDPAMTRLFASAPPLRKLNQDALLSPKVRVV
FT                   NADALQWLEENDETFDFVVVDFPDPSNFSLGKLYSAAFYRLLDKHLNGEALAVIQSTSP
FT                   LYARQSFWCVVTTLESVGLVATPYHALVPSFGEWGFVLAGRRAYRPPTSYAVDTRFLTP
FT                   EATPGLFVFPGDMARVDAEVNQLNNQVLVRYFEHEWRQVIR"
FT   sig_peptide     654626..654682
FT                   /locus_tag="CAP2UW1_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.814 at
FT                   residue 19"
FT   gene            656130..657785
FT                   /locus_tag="CAP2UW1_0543"
FT   CDS_pept        656130..657785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0543"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: dar:Daro_3715 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33892"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ8"
FT                   /protein_id="ACV33892.1"
FT                   /translation="MDRRDFLVSLAAAAGAASLAGCRGGPPPLPPGELLGTSLALGHRL
FT                   QSAGFAPPSESRKVPVVIVGAGVAGLAAGWKLARAGFSDFLLVELENEAGGNSRAGRNA
FT                   VSAYPWGAHYLPLPNREALAVRELLAELGVLLGDPRAPRPVYDERYLCATPQERLYRNG
FT                   RWQEGLLPQTGVSTAERGQYQRFADLIEGFKRRRDDAGRAAFALPMALSSRALDLLALD
FT                   RISMRDWLLAQGLDSPQLHWYVNYACRDDYGTASAAVSAWAGIHYFACRTGEAQNAGNE
FT                   TVLTAPEGNAWLVSGMLRSISAHAGERLLSGALAFRVAGGERGAGTGPLAVDLWLASEQ
FT                   RTLRLLADQVIWAAPLFLVPHVFAGHAALKAAAASYSYAPWLVANLTLSRFPDERAGAP
FT                   PAWDNVLYDSAGLGYVVATHQQMRLWRQATVLTFYRTFDALSPQDGRAALRDTPRAVWA
FT                   EQILAELERPHANIRQVTTHLDVFRNGHAMARPLPGLIWGEPRQRFAVDGERLRFAHAD
FT                   VSGFSLFEEAQYRGVLAAERTLRRLGVRFSSSLG"
FT   sig_peptide     656130..656204
FT                   /locus_tag="CAP2UW1_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.697 at
FT                   residue 25"
FT   gene            658133..658384
FT                   /locus_tag="CAP2UW1_0544"
FT   CDS_pept        658133..658384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0544"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: rso:RSc0872
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33893"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLJ9"
FT                   /protein_id="ACV33893.1"
FT                   /translation="MNTWQMQEAKARLSEVVKLAESEGPQDITVHGRSVAVVVSRATFE
FT                   RLSGSGRSLVEFMRQSPLHGLEELDFERDRSVTRDLTL"
FT   gene            658381..658794
FT                   /locus_tag="CAP2UW1_0545"
FT   CDS_pept        658381..658794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0545"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: rso:RSc0871
FT                   putative plasmid stability-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33894"
FT                   /db_xref="GOA:C7RLK0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK0"
FT                   /protein_id="ACV33894.1"
FT                   /translation="MSYLLDTNILSELRRKAPNAGVVEWCSRRPASTLFLSVLTLGELR
FT                   KGVESLTASDRRAALLDWLEVELPTFFSGRILPIDSQVADCWGRLMVAAGRPIPAIDSL
FT                   IGATAVRHSLRLVTRNVRDFADLGLEVINPWSE"
FT   gene            complement(658896..659786)
FT                   /locus_tag="CAP2UW1_0546"
FT   CDS_pept        complement(658896..659786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0546"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: eba:ebA3472
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33895"
FT                   /db_xref="GOA:C7RLK1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK1"
FT                   /protein_id="ACV33895.1"
FT                   /translation="MQTLLTPSHCEQVPINGLVYNVRHWGPADAPRLLMLHGWMDSSAS
FT                   FQFTVDALRHTWHVLAPDWRGYGRSQWLNRRYWFADYYADLDALLDRYSAGVPARIVGH
FT                   SMGGAVASIYGGARPERIAGLLMVDFLGLLPNEAHEAPARIRDWLDHTRATPQLRAYAS
FT                   REQLAARLRQFNARLLPERATFLATHCASQLPDGRFAVACDPWHKVPSPHLYRIEEVMA
FT                   CWRALTAPVLLVTADEGYVMQRFAKDPGELQRRMDCFANASIAHISDCGHNVQHDRPEK
FT                   LAELIESFFSYPDPP"
FT   gene            complement(659821..660447)
FT                   /locus_tag="CAP2UW1_0547"
FT   CDS_pept        complement(659821..660447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0547"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: tbd:Tbd_1055 S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33896"
FT                   /db_xref="GOA:C7RLK2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK2"
FT                   /protein_id="ACV33896.1"
FT                   /translation="MNPHSGNQFDDRAATWDADPVKVARALAVAAAIQERVPLSLQMRG
FT                   LEYGCGTGLLGFALQPYLGQITLADSSAGMLATLDEKIAASGASNLRATKLDLVSDPLP
FT                   VERYDVVCSLMTFHHIEDTAQLLRDLFALMAAPGYLCVADLDAEDGCFHGPEFTGHQGF
FT                   DRQTLAHMAERAGFRDVAFSTVFHMSKPASPGQTEFPVFLMVARK"
FT   gene            complement(660686..662338)
FT                   /locus_tag="CAP2UW1_0548"
FT   CDS_pept        complement(660686..662338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0548"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mar:MAE_34290 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33897"
FT                   /db_xref="GOA:C7RLK3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK3"
FT                   /protein_id="ACV33897.1"
FT                   /translation="MTNNALFGFIVGMYIARVPNRKSRPAILLRESYREGGKVCTRTIA
FT                   NLTNWAPERIVAMERLVKGEFDDWSGEMTSGEIFGVLFALKQLADQVGITRVLGSAAES
FT                   RLNLFLILARIAHGGSRLSAVRWAKQHTVADVLALEEFDEDDLYAALDWLASQQERIER
FT                   ELYRAYVKAQGQPPVLVLYDVTSSYFEGECNELGQYGYNRDGKRGKQQIVIGLLTAEDG
FT                   EPLAVRVFEGNTADPTTVASQITILKEQFGIAEVVMVGDRGMIKAKGKAALSAQGFRYI
FT                   TALTDAQVRTFLKEGVLQTDLFDVPLCEVEHDDKRLIVRRNEIVRVREERRREDKLAQL
FT                   QAKIADRNAFVKNSRRASAATGLAALQRWAKRHKLAAFVTLALNERVIVCTIDQEAKAQ
FT                   DALLDGCYLLETDVPQGLMDAKAVDARYRDLQKVERNFRTVKTTFLEIRPIFLRKAERT
FT                   KAHVFVAMLALKITRRFEAALHRTFGSTVDDPAAITPDDALVALGRLTYLYSTDRNGQR
FT                   HTHLPRPDDQQAKILDAIGLSFPLKAKAEKRAV"
FT   gene            662541..663245
FT                   /locus_tag="CAP2UW1_0549"
FT   CDS_pept        662541..663245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0549"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dar:Daro_3923
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33898"
FT                   /db_xref="GOA:C7RLK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK4"
FT                   /protein_id="ACV33898.1"
FT                   /translation="MNSFVPQTASGVPAEAPVPRRRRKDARPSELTAAALALFVDKGFA
FT                   ATRLDDVAARAGVSKGTLYLYFSSKEALFKAVIEDGMVAALAAAEERLAGFHGSAAELL
FT                   HELLLGWWRQIGRTAMAGVTKLIISESRNFPEVAQYYHERVITRGRALLRHALERGIGS
FT                   GEFRPLNVEAAIDVIIAPLLMLAISRFSLRLCGPQVAPETYLETHFELLLQGLRGADPI
FT                   DDRQSTATTACR"
FT   gene            663242..664345
FT                   /locus_tag="CAP2UW1_0550"
FT   CDS_pept        663242..664345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0550"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   azo:azo0846 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33899"
FT                   /db_xref="GOA:C7RLK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK5"
FT                   /protein_id="ACV33899.1"
FT                   /translation="MNATRAAFFRRWLPALSVLALLAACGKEPAPPEPPRGVLTRVLGD
FT                   TAGDETLTYSGEVRSRYEMPLAFRIPGKVTARLVDAGAVVKAGQVLARIDPADTALSAA
FT                   SAVAQLELADADLQRFRSLRARNFVSQAALDSRETSFKAAKAQAELARNQSSYTVLKAD
FT                   QPGVIGLISAEVGQVVAAGQTVMRLARPDTLEVAIAIPEGRMSDVRALGTAEVTLWADG
FT                   EARYAGALREVSPVADPLTRTYAARVSIDRPDARILLGMTAKVRFLRPAGGTRLTVPLT
FT                   AVFQHQGRPALWVVGGDETVSLRPVDLASYREDTAIVAGGAKAGERIVVAGVHKLTGGE
FT                   RVRVIDAARAAEPPSSPVSGSLGKSAP"
FT   sig_peptide     663242..663322
FT                   /locus_tag="CAP2UW1_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.882 at
FT                   residue 27"
FT   gene            664342..667425
FT                   /locus_tag="CAP2UW1_0551"
FT   CDS_pept        664342..667425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0551"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   cvi:CV_3924 probable transmembrane drug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33900"
FT                   /db_xref="GOA:C7RLK6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK6"
FT                   /protein_id="ACV33900.1"
FT                   /translation="MTPPNLSDWALRHRSLIGYLIVVLMLAGVLAYFKLGRAEDPDFTF
FT                   KAMVVRTLWSGATAPEVQLQVTERIERRLQEVPWVDVLRSQTRPGESLITVLLKDYTPK
FT                   KEVPETWYQVRKKIGDMRHTLPQGVLGPFINDEFGDTFITIYALTGDGFDLARLRHEAD
FT                   RIGRELRQLPDVKKIELFGVQDEKIYIEVSHAKLATLGLNPLAIVDALQKQNAMSPSGF
FT                   YETPSDRVRIRVSGDFESLAHIREIGIQAGGRLFRLGDIAKVERGFADPPTPRMRVQGQ
FT                   DAIGIGIAMNKGGDVIRLGDRLQAETKRLQQQLPLGIDLHVVADQPQIVRQSMNLFMSS
FT                   LAEAVVIVLAVSFISLGLRTGAVVALSIPLVLAITFLVMYAFAIDLQRISLGALVISLG
FT                   LLVDDAIIAVEMMVVKMEQGWDRFRAATFAYTSTAFPMLTGTLITAVGFMPVGLAKSGA
FT                   GEYTFSIFAVVSIALLVSWVVAVLFTPYLGYLVLDAEKLQQKAQQHGEDPYNTPFYRRV
FT                   RASVEWCLRHRWLVIAATLVAFALSLAGLTLGVQKQFFPAASRPELLVDLWLANGSSLK
FT                   ATEAQARKVEALLGEPEMARSIRYYASYLGNGSPRFYLPLDQQLFNDGFAQFVITTHDI
FT                   DAREDLKRRLEQRFADAGGEWSGLRTRVLRLENGPPVGFPVLFRVSGDDLGELRRVAAE
FT                   VAAVMRGHPYLKEVNFDWNEMGKTIRIDIDQDRARALGISSQELSAFLNSMLNGVAITQ
FT                   MREGDQLIDVVARAAGDERAQISALADLNIHTGSGRYVPLAQLAKISYELEEPVIASRN
FT                   RLPTVTVRADIRDGIQAPAATAQIEPLFEPLRARLPPGFRIEAGGATEESAKGENSIKA
FT                   VMPLMLVSVITLLMIQLQNVGRTLLVLLTAPLGLIGVSLALLIFRVPFGFVANLGVIAL
FT                   SGMIMRNAVILVDQIEQDEKAGKAAWEAVVGSTVRRFRPIMLTAAAAILAMIPLTRSVF
FT                   WGPMAVAIMGGLIVATLLTLLFLPALYAAWYRVQPARI"
FT   gene            complement(667552..667977)
FT                   /locus_tag="CAP2UW1_0552"
FT   CDS_pept        complement(667552..667977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0552"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: eba:ebA3574
FT                   universal stress protein (Usp)"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33901"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK7"
FT                   /protein_id="ACV33901.1"
FT                   /translation="MLKALIPFDGSDNALRAVDHLISLVQAREPMEVHLLHVREPIDSW
FT                   EIRRVLTADEIAALQLSEGEDALQAARQRLDAAGISYTATILVGDVAQTIARHATEIGC
FT                   DKIIMGSSGASAIAGLLLGSVTMKVIHLAQVPVTVVK"
FT   gene            complement(668008..669423)
FT                   /locus_tag="CAP2UW1_0553"
FT   CDS_pept        complement(668008..669423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33902"
FT                   /db_xref="GOA:C7RLK8"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK8"
FT                   /protein_id="ACV33902.1"
FT                   /translation="MRHKFAGCLRPGATLLLLLALGPAWAAETVPEGPVLFGIPVDFIL
FT                   FALTLLGVALLHHYTLQVALTGLATITVYKLLFTGFKFGAGLGGLAIHLQHEWVMLSNL
FT                   LGLLLGFALLARHFEESRVPDALPRYLPGGWQGGFVLLVMIFFLSSFLDNIAAALIGGT
FT                   VARIVFRHRLHIGYLAAIVAASNAGGSGSVVGDTTTTMMWIDGVSPLDVTHAYVAAGVA
FT                   LVFCGIPAALQQHRYAPIVAHSGEATRVDWARVAIVGFILLSAIVTNVTVNVLFPEVSD
FT                   RFPFLGAAVWLALLLATPLRRPEWSLLPDALKGSIFLLSLVLCASMMPVEKLPAASWQT
FT                   AMGLGFVSAVFDNIPLTALALVQGGYDWGVLAYAVGYGGSMIWFGSSAGVALANMFPEA
FT                   KSAGRWLLHGWHVTLGYVVGFLTLLFVLGWQPHPRHKAEGIDAVRPTVLAASPAWAGDQ
FT                   PVANLVRHPAPAA"
FT   sig_peptide     complement(669343..669423)
FT                   /locus_tag="CAP2UW1_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            669836..670423
FT                   /locus_tag="CAP2UW1_0554"
FT   CDS_pept        669836..670423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0554"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bpt:Bpet2844 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33903"
FT                   /db_xref="GOA:C7RLK9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLK9"
FT                   /protein_id="ACV33903.1"
FT                   /translation="MQALLKLSSLIDALTERVGKAIIWLVLVVTLIAAGNAVMRYTLNY
FT                   SSNAFLEIQWYLFSAIFLLGAGYTLMRNEHVRIDLIAGRMSRRGQAWIDIFGIIFFLLP
FT                   MAVAVMYLSWPIFLLALNNNEQSSNAGGLAVWPVRLLVPIGFFLLVIQGVSELIKRFGF
FT                   LQGLCPDPTAKGHKPTPEEELALAIKAQKGEL"
FT   gene            670423..671922
FT                   /locus_tag="CAP2UW1_0555"
FT   CDS_pept        670423..671922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0555"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: dar:Daro_0600 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33904"
FT                   /db_xref="GOA:C7RLL0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL0"
FT                   /protein_id="ACV33904.1"
FT                   /translation="MTEFVIANMAPIIFASMVLFLLVGFPVAFALAANGIFFGLIGIEL
FT                   GLLGPQLFQALPDRIFGIMNNDTLLAIPFFTFMGLILERSGMAEDLLDTIGQLFGPLRG
FT                   GLAFAVIFVGALLAATTGVVAASVISMGLISLPIMLRYGYDTKLATGVIAASGTLAQII
FT                   PPSLVLIIMADQLGKSVGDMYAGAFLPGMVLTSFYVGYVVLVAIFKPRWAPALPLEART
FT                   LRGGKLLLRVLTTLVPPLMLIFLVLGTIFLGIATPTEGGAMGATGALIMALARQRLSWS
FT                   LLRQAMETTAKLTTFVVFILVGARVFSLTFYGVDGHRWVEHLLTGLPGGEVGFLIVVNA
FT                   LVFLLAFFLDFFELSFIVVPLLGPVAQALGIDLIWFGVLLAVNMQTSFMHPPFGFALFY
FT                   LRSVAPASVKTTDIYWGAIPFVCIQIIMVVILIFFPQLVTFGLAKDAKVDLDSVQIEMP
FT                   TSDYGAPGSSPGLESPKDSPADSEDSASKAIRDAMKQEQAK"
FT   sig_peptide     670423..670521
FT                   /locus_tag="CAP2UW1_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.806 at
FT                   residue 33"
FT   gene            complement(672071..673150)
FT                   /locus_tag="CAP2UW1_0556"
FT   CDS_pept        complement(672071..673150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0556"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: mag:amb2584 TRAP-type mannitol/chloroaromatic
FT                   compound transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33905"
FT                   /db_xref="GOA:C7RLL1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="InterPro:IPR041722"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL1"
FT                   /protein_id="ACV33905.1"
FT                   /translation="MERRSFLKNAGVGLAAGSVAMPAIAQNAPTIKWRLASSFPKSLDT
FT                   IYGGAEYMAKRVAEATGGKFQIQVFAGGEIVPGPAVFDAVKDGTVEMGHTVSYYFFGKD
FT                   PTYALETAVPFGMTNRQMDAWMRHGNGTKLLGEFFAKSNIMTIPCGNTTTQMGGWYRKE
FT                   IKTAADLKGLKIRIGGFAGAVLSKLGAVPQQIPGGDIYPALEKGTIDAAEWIGPYDDQK
FT                   LGFNKVAKFYYYPGWWEGGPQVSAYVSLKKYAELPKEYQTILQLACADAHVDMVAKYDA
FT                   KNPTALKQLVGSGTQLKQFPKEVMDACYKAAMELYAETSAKNAEFKKVYDDYKKFMDDQ
FT                   NLWMRIAEGAYTNYMYSKR"
FT   sig_peptide     complement(673073..673150)
FT                   /locus_tag="CAP2UW1_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 26"
FT   gene            complement(673255..674634)
FT                   /locus_tag="CAP2UW1_0557"
FT   CDS_pept        complement(673255..674634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0557"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   azo:azo2794 probable PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33906"
FT                   /db_xref="GOA:C7RLL2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL2"
FT                   /protein_id="ACV33906.1"
FT                   /translation="MPRPATTAIPAPASRFSHRFETLQELARDVLVYAAKQGASACEVD
FT                   VSDGFGQSVTVRCGEVETIEYNRDKSIAVSVYLDQRKGQASTSDFSPTALRETVDAALN
FT                   IARFTAADPCAGLPDASLLATDTGSLPGLDLYHPWLLSVEAAVDLARRCEQAAFALSPQ
FT                   ISNSEGATVSIQEGQFVSANSLGFMGGYPTSRHYLSCSVIAGENDAMQRDDWYSIARDQ
FT                   AAIASPESIGERAAQRALSRLGARKVKTCRVPVLFEAPLAPSLIGSFVHAASGGSLYRK
FT                   TSFLVDSLGKRVFSKKVQISERPHLPRALASTYFDSDGVATHDREVVRNGRLQGYFLST
FT                   YTGRKLGMPTTGNAGGSHNLIIHPGKRDFRGLLKKMGRGLLVTELLGHGVNYVTGDYSR
FT                   GAAGFWIEDGEIAHPVEEITIAGNLRDMFRNVAAVGNDVLVRGSKHVGSLLIEQMKVAG
FT                   N"
FT   gene            674752..675291
FT                   /locus_tag="CAP2UW1_0558"
FT   CDS_pept        674752..675291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0558"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   eba:ebA1030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33907"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL3"
FT                   /protein_id="ACV33907.1"
FT                   /translation="MNIPEEEPAPPSKTQRKRAMEELQALGEELVGLAPDRVRKIDLPD
FT                   DLRAAVREAQRMLRRDDARRRQMQYIGRLMRDVDAEPIRAALAVIRGESVDETARLHRI
FT                   ERMRSELLADERVLYEIAQRCQSVDLQQLRALRRSALLELEKGKPPRSYRAIFQILKEL
FT                   EPPDDAAPTDDEHDDQ"
FT   gene            675278..675877
FT                   /locus_tag="CAP2UW1_0559"
FT   CDS_pept        675278..675877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0559"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   azo:azo2792 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33908"
FT                   /db_xref="GOA:C7RLL4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL4"
FT                   /protein_id="ACV33908.1"
FT                   /translation="MTTNEELLIGLLSISDRAAQGVYEDQGIPALQQWFGAALSSPWCS
FT                   ATRLIADDQASIERTLIELVDELGCHLVLTTGGTGPAPRDVTPEATLAVADKVLPGFGE
FT                   EMRRISLNFVPTAILSRQLAVVRGKALILNLPGQPKSIRETLEGVRAADGSLLVSGIFA
FT                   AVPYCLDLIGGPYVETVDTIVSAFRPKSAQRPKPAA"
FT   gene            complement(675890..677422)
FT                   /locus_tag="CAP2UW1_0560"
FT   CDS_pept        complement(675890..677422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33909"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL5"
FT                   /protein_id="ACV33909.1"
FT                   /translation="MILQLFPKRPDHLLADSKEMKRVLADLLVAKAANAIDEMMNWFES
FT                   LKDAKDFRLGHYFDIIRQLDEAGQPHLIRLARDYLPSTNLPLAEEQRLWTKISRYWSEI
FT                   AGLYAACLERAQLDPKGKGVDAFKPSMPLAAARAQAARRIQVKWLAFHYGPIDDGLWRT
FT                   MGQAYLAAEAAGYAQKLLQIYPAQRGLTSVAQQYLHAIVLFTSSMDSLLPGQIEIVDRL
FT                   ITHFLPRFVLAADCRPDSVYWVDAAAGSVPARLALSPGLARPGLRFFSPGTALAKLEEL
FT                   IQLVEHGEVPADINLGGDFPPNVLLPVLRHLRLYWTVQAPQRRHQRHPVKTKMAVLHGF
FT                   DASYRVFSGALPGLDANREDEVWLVENVSLGGFRACLRHSPGDPLKLGTLLCLQPEGGD
FT                   NWLLGVVRRFNRLSGEHASLGIQLLSRQAQSIELRPRRSGFAAVIGLPGIWLRDGSGSG
FT                   LVRLLLPQGGFNLRESLEFNSAGQRHMLVPAELEESGGDYEIGRFHNPTATA"
FT   gene            677593..678414
FT                   /locus_tag="CAP2UW1_0561"
FT   CDS_pept        677593..678414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0561"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: dar:Daro_0593
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33910"
FT                   /db_xref="GOA:C7RLL6"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL6"
FT                   /protein_id="ACV33910.1"
FT                   /translation="MQQYLDLMHHVLEHGVSKADRTGTGTRSVFGWQMRFDLAAGFPLL
FT                   TTKKLHLRSIIHELLWFLRGDTNVRYLQENGVRIWDEWADENGDLGPVYGRQWRHWQAA
FT                   DGREIDQIAQLVDNLKKNPDSRRHLLTAWNPGDVERMALPPCHALCQFYVAPASASATD
FT                   RRPQLSCQLYQRSADIFLGVPFNIASYALLTMMVAQVCNYRPGDFVHTFGDAHLYGNHF
FT                   DQARLQLTRATRALPTMRLNPEVDDLFAFRFEDFTLEGYDPHPHIAAAVAV"
FT   gene            678463..678972
FT                   /locus_tag="CAP2UW1_0562"
FT   CDS_pept        678463..678972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0562"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   dar:Daro_0579 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33911"
FT                   /db_xref="GOA:C7RLL7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL7"
FT                   /protein_id="ACV33911.1"
FT                   /translation="MISLIAAVARNGAIGRNQQLLWRLPEDMRYFRETTSGKTVIMGRK
FT                   TWESLPPAYRPLPNRRNIVLSRNPAYLPRGGDLACSIEDALRLAGGAAEVFIIGGEELY
FT                   RQTMPLATRLYITEVAEESPGDAFFPDVASGEWREISRRVGRSRAAGSALRDQAPAFDF
FT                   VVYERR"
FT   gene            679068..679502
FT                   /locus_tag="CAP2UW1_0563"
FT   CDS_pept        679068..679502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33912"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL8"
FT                   /protein_id="ACV33912.1"
FT                   /translation="MADLLENYLQDSEGAGKVLVHARLLIRLAGLYAEIAPTHLARASR
FT                   VANFKSGVVVIHADSGAIAAKLRQMAPTLVDQLSQRGIECSGVQVKVQARDQREPARAP
FT                   AHKPLSVRTSAELTALSSSLPTSPLRRALEGLLARSAREE"
FT   gene            complement(679489..679677)
FT                   /locus_tag="CAP2UW1_0564"
FT   CDS_pept        complement(679489..679677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33913"
FT                   /db_xref="GOA:C7RLL9"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLL9"
FT                   /protein_id="ACV33913.1"
FT                   /translation="MWLLRLLAVLTVIAVGCGIAAFLLTRDSRYLQFSWRLFRYSLVIA
FT                   LLVFALMIIERVAIIPL"
FT   sig_peptide     complement(679600..679677)
FT                   /locus_tag="CAP2UW1_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.357 at
FT                   residue 26"
FT   gene            complement(679682..680611)
FT                   /locus_tag="CAP2UW1_0565"
FT   CDS_pept        complement(679682..680611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0565"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: dar:Daro_3492 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33914"
FT                   /db_xref="GOA:C7RLM0"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM0"
FT                   /protein_id="ACV33914.1"
FT                   /translation="MLKQRTLKAVVRAAGVGLHSGVKVTISLRPAAPDTGIVFRRVDLE
FT                   AVVDVPARAQLVGDTRMCSCLEYGGARVGTVEHLMSAFAGLGIDNAFVDLDAAELPILD
FT                   GSASPFVFLIQSAGIEEQPVAKKFIRVKRPIEVAETDASGDKWARLDPYNGFRLAFSIG
FT                   FNHPAIDRTGQSVTIDFAEQSYVREVARARTFGFMQEVEWLRENGLAQGGGLENAVVLD
FT                   EYRVLNADGLRYNDEFVKHKVLDAIGDLYLLGHPLLASFVAHKSGHALNNLLARELLAS
FT                   PDAWEYVTFEDHEQAPKSVLSWLALPVF"
FT   gene            complement(680707..681882)
FT                   /locus_tag="CAP2UW1_0566"
FT   CDS_pept        complement(680707..681882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0566"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   dar:Daro_3493 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33915"
FT                   /db_xref="GOA:C7RLM1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM1"
FT                   /protein_id="ACV33915.1"
FT                   /translation="MFEIIDTEQGSGDMDTVIKVIGIGGAGGNAVDHMIREGVNGVDFI
FT                   AANTDSQALGRSIAVQKLQLGKTGLGAGAKPEAGRSAAMEEREAIAESLRGAHMVFITA
FT                   GMGGGTGTGAAPIVAEVARELGVLTVAVVTKPFGFEGKRLKVAEVGIGELQKHVDSLIV
FT                   ILNDRLMDVLGDDVSMDEAFKAADNVLRNAVGGIAEIINFPGLVNVDFEDVRTVMGEMG
FT                   MAMMGSANAAGVDRARIAAERAVASPLLEGVNLSGAKGVLVNITATRSLKMKEVNEVMN
FT                   TVRAFAAEDAHIIFGAVYDEGMAEDIRVTVVATGLGQAQAKRQTFEVINSSLTQATGTD
FT                   SRFGHSQNIDYSSLDQVPAIVRKGRSATVEALANSGVDRYDIPAFLRKQAD"
FT   gene            complement(681951..683180)
FT                   /locus_tag="CAP2UW1_0567"
FT   CDS_pept        complement(681951..683180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0567"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   dar:Daro_3494 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33916"
FT                   /db_xref="GOA:C7RLM2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM2"
FT                   /protein_id="ACV33916.1"
FT                   /translation="MSRDSKDLIVGLDIGTSKIVALVAELTPEGRVNVIGMGSQESKGL
FT                   KKGVVVNIEETVATISRVLQEVELMADCKVRDVYTGIAGSHIRSFNSNGMVAIKDKEVT
FT                   TMDVERVIETARAMPIPADQEILHILTQEFIIDDQDGIREPIGMSGFRLEVKVHIVTGA
FT                   VSAAQNIVKCVRRCGLEVNDLVLQPLASSRAVLSEDEKDLGICLIDIGGGTTDLAVWTQ
FT                   GAIRYTSVIPIAGDQITNDIAMALRTPTREAEDIKRTYGCAVAHLADPEEVLDVAGVDD
FT                   RPSRKLSRRALADVIQPRVEELFELIQAELRRSGFEDVLSSGIVLTGGASVMPGMIELG
FT                   EEIFHMPVRLGVPKYQGALADVVQSPRFATACGLLLEAQTQRKRGLKVRETRDVKQVFG
FT                   RMKSWFEKNF"
FT   gene            complement(683177..683929)
FT                   /locus_tag="CAP2UW1_0568"
FT   CDS_pept        complement(683177..683929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0568"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: dar:Daro_3495 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33917"
FT                   /db_xref="GOA:C7RLM3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM3"
FT                   /protein_id="ACV33917.1"
FT                   /translation="MWHKPRLMTAVSDLLLLAGGVALLVAAVIWGAPRLRLFPLNEVLV
FT                   THELREVRHSDVQQVLSALLHGNFFTVSPEAIRLSLEQLPWVRRAEVWRKWPARIEVRI
FT                   EEQQAAAHWGDGQGELVNTFGEVFSAPLTREQPLPRLSGPTGSAGEVLRRYAEFAQLLK
FT                   PVGVLPAHVALSPRLAWLLKMENGMLVELGREQAKAPIRVRLQRFVEYYPSLSETRHGR
FT                   PIAVDMRYPNGFALRFPASAVQEVKGKK"
FT   sig_peptide     complement(683834..683929)
FT                   /locus_tag="CAP2UW1_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.616 at
FT                   residue 32"
FT   gene            complement(683933..684859)
FT                   /locus_tag="CAP2UW1_0569"
FT   CDS_pept        complement(683933..684859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0569"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: dar:Daro_3496 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33918"
FT                   /db_xref="GOA:C7RLM4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM4"
FT                   /protein_id="ACV33918.1"
FT                   /translation="MNVRDFGKVAVLFGGRSAEREVSLNSGSRVLAALRRQGVDAHAFD
FT                   PAERQLDDLAGFARAFIALHGRYGEDGTIQGALELMGIPYTGSGVMASALGMDKWRTKL
FT                   LWQAAGLPVPPYLMLDDATDLAAVEAALGLPLFVKPACEGSSIGITKVKRPGELAAARA
FT                   EAARHDSLVIAERAILGGEYTVAILGNAALPIIKIEPSNEFYDYEAKYLRDDTAYRCPC
FT                   GLTETRESELRQQALDAFRVLGGRGWGRVDFLLDQAAAAGGGAAYFLEVNTSPGMTDHS
FT                   LVPMAARAAGMSYDDLVVRILALATLG"
FT   gene            complement(684869..686257)
FT                   /locus_tag="CAP2UW1_0570"
FT   CDS_pept        complement(684869..686257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0570"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: dar:Daro_3497
FT                   UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33919"
FT                   /db_xref="GOA:C7RLM5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM5"
FT                   /protein_id="ACV33919.1"
FT                   /translation="MKHKVKNIHFVGIGGAGMSGIAEVLANLGFVVSGSDLADNSATRR
FT                   LAALGVRTVIGHAAANVNGADAVVVSSAVRADNPEVIAARSRQVPVVPRAQMLAELMRL
FT                   KQGIAVAGTHGKTTTTSLVASILAAGGMDPTFVIGGRLNAAGANACLGSGDFLVAEADE
FT                   SDASFLFLSPVISVVTNIDADHMETYGHDFNRLKQAFVEFLQRLPFYGVAVLCADDANV
FT                   REIMPQVSKQIVTYGLDPAANFYAENVTAEGGQMRFDCVRVNGSVSRLPVTLNLPGRHN
FT                   VLNALAAIAVASEVGVADDAILKALTDFRGVGRRFQRYGEIALADGGCFTLVDDYGHHP
FT                   VEMSATLTAARGAFPGRRLLLAFQPHRYTRTRDRFEDFVKVLSGVDALVLTEVYAASEQ
FT                   PIVAADGRALARALRVAGKVEPVFVESIGDVPQAILDIVRDGDVVITMGAGSIGGIPGK
FT                   LLAC"
FT   gene            complement(686254..687312)
FT                   /locus_tag="CAP2UW1_0571"
FT   CDS_pept        complement(686254..687312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0571"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: dar:Daro_3498 N-acetylglucosaminyl
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33920"
FT                   /db_xref="GOA:C7RLM6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM6"
FT                   /protein_id="ACV33920.1"
FT                   /translation="MSKTLLVMAGGTGGHVFPGLAVADLLRSRDWKVVWMGAPDGMEAR
FT                   LVPARGYEMAWVRFAALRGKGLLRKLLLPFHLFSACWQARREIRRVSPDVVLGMGGYVS
FT                   FPGGMMAALLGCPLLIHEQNSIAGLANRVLARVADRVACGFPDVLPKGIWVGNPLRPEM
FT                   TRLPPPTTRLADRQGPVRLLVLGGSQGASALNDVVPRGLALIDADARPQVVHQAGEKHL
FT                   EALQHNYAAAGVQAHCAAFIEDMAGAYEWADLVICRAGALTVAELAATGVASVLVPFPY
FT                   AVDDHQTANARFLSLAGGAVLLPQAELTPETISRLCHTPVGQLRAMAEKAREMARPEAT
FT                   EEVARMCEELAK"
FT   sig_peptide     complement(687241..687312)
FT                   /locus_tag="CAP2UW1_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.855 at
FT                   residue 24"
FT   gene            complement(687365..688525)
FT                   /locus_tag="CAP2UW1_0572"
FT   CDS_pept        complement(687365..688525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0572"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: dar:Daro_3499 cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33921"
FT                   /db_xref="GOA:C7RLM7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM7"
FT                   /protein_id="ACV33921.1"
FT                   /translation="MLRALDAPRRLPAEIDLALLWSTLALLVIGMVMVYSASMATAEAG
FT                   RLTGNQPAYFLVRHAVFLAIGLVAAAVAFQVPLSTWQQWSPWLFVGGSLLLALVLIPGI
FT                   GREVNGARRWLPLGIVNLQPSELMKLFAVLYAADYTSRKMPHMHDLKRAFLPLASAMVA
FT                   VGILLLKEPDFGAFVVIIAIAMGILFLGGMRARLFVVLIFVLVAAFAALIIISPYRRDR
FT                   IFGFMDPWADAFGRGYQLSHALIAFGRGELLGVGLGASVEKLFYLPEAHTDFLLAVIAE
FT                   ELGFVGVLTVIVLFGLLIQRAFAIGRQAVALDRLYSALVAQGIGVWMGVQGFINMGVNT
FT                   GLLPTKGLTLPLMSFGGSGILANCVAVAVLLRIDWENRQLMRGAKV"
FT   sig_peptide     complement(688397..688525)
FT                   /locus_tag="CAP2UW1_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.590 at
FT                   residue 43"
FT   gene            complement(688525..689892)
FT                   /locus_tag="CAP2UW1_0573"
FT   CDS_pept        complement(688525..689892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0573"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   dar:Daro_3500 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33922"
FT                   /db_xref="GOA:C7RLM8"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM8"
FT                   /protein_id="ACV33922.1"
FT                   /translation="MELAGKLILVIGLGESGLAMARWLARQDAHVRVADSRPAPPQADA
FT                   LRAAVPAADLCVGPFTAEAFAGVDLIAISPGVPVQEALVQAAVARGVPLVSEIELFAWG
FT                   IGGLTPRARVIAITGSNGKTTTTALVGALCRAAGRRTAVAGNIGPAALDALMSAIDGRS
FT                   LPELWVLELSSFQLETTHSLAADAAALLNLCEDHLDRYLDMDDYTASKARIFQGNGVMV
FT                   LNRDDARSLAAGRPGRRMVTFGLNPPPRPCDYGVVDGWIVRGDDRLVACSELQLVGSHN
FT                   AANAMAALALCEAAGIDLASVLPALVAFKGLAHRVEWVAEIDGVAYFDDSKGTNVGATL
FT                   AALQGLGRPVAIILGGDGKGQDFAPLRPALDAHARAAALIGRDALAMAAILEGCQVPLQ
FT                   HCVDMAEAVRWCAAQARAGDAVLLSPACASMDMYRNYEHRAEAFVDAVRRIEREAA"
FT   gene            complement(689894..690982)
FT                   /locus_tag="CAP2UW1_0574"
FT   CDS_pept        complement(689894..690982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0574"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: dar:Daro_3501
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33923"
FT                   /db_xref="GOA:C7RLM9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLM9"
FT                   /protein_id="ACV33923.1"
FT                   /translation="MLLLLAQWLAQEVRAFNVFNYITLRTVLAAMTALIISFIAGPGVI
FT                   RWLAAKKIGQAVRNDGPQTHLVKSGTPTMGGALILIAIATTTLLWGDLTNRYVWIVLIV
FT                   TLGFGGIGWYDDWQKVVHRNPRGLPARWKYIWQSVIGLTVALYLGLTATGPAQLELIVP
FT                   FFKTVSYPLGIFGFIVLSYLVVVGTSNAVNLTDGLDGLAIMPTVMIAAALAIFAYVAGN
FT                   SVYAKYLLLPYIPGAGELAIFLGAIAGAGLGFLWFNAYPAEVFMGDVGALALGAALGTV
FT                   AIIVRQEIVLAIMGGIFVAETLSVAAQVLYYKFTGGRRIFRMAPLHHHFELGGWKETQV
FT                   VVRFWIITIMLVLVGLSTLKLR"
FT   gene            complement(690982..692352)
FT                   /locus_tag="CAP2UW1_0575"
FT   CDS_pept        complement(690982..692352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0575"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: dar:Daro_3502
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33924"
FT                   /db_xref="GOA:C7RLN0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN0"
FT                   /protein_id="ACV33924.1"
FT                   /translation="MDLLAAARATAGKVLGANATFSGVSTDSRSIAAGELFVALRGENF
FT                   DGHDYVAAAKARGAAAAIVATDAAEGLQALSLPLVQVAETRLSLGALAADWRGRFALPL
FT                   LAVTGSNGKTTTKEMIASILKAAYGEAVLATQGNFNNDIGLPLTLLRLNATHRAAIIEL
FT                   GMNHPGEIAYLAGIARPTVALVTNAQRAHLAGMGSLEAIAAEKGSIYTGLDETGVAVFN
FT                   ADDPWAKLWRSQCRGLRMMTFGFEQAADVTGKFHLHGLESRLSLFAPDGQADVVLALPG
FT                   QHNARNALAAATAALAAGISLTAVQAGLSAFRGLKGRLQRRTALHGAVLLDDTYNANPD
FT                   SVRAGIDVLAATIGKKILVLGDMGEIGEMSAQFHDEIGGYAKSQGIDLLLALGEASALA
FT                   AHNFGSGGEHHHSIDRLVASLTAELTPETTVLVKGSRFMRMERVADALAVPSAAEGE"
FT   gene            complement(692361..693869)
FT                   /locus_tag="CAP2UW1_0576"
FT   CDS_pept        complement(692361..693869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0576"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: dar:Daro_3503
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33925"
FT                   /db_xref="GOA:C7RLN1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN1"
FT                   /protein_id="ACV33925.1"
FT                   /translation="MRAVASPARSEADTAALQRLATLGVVPGGVTDDSRQVRPGDLFLA
FT                   YPGDVADGRRYIAEAIANGAVAVFWEPAPAGTPDFAWNRTWQVANLAVAGLRELCGPLA
FT                   NAIYGRPSERLSLIAVTGTNGKTSVSQWIAATHPRRCAVIGTLGAGMPGQLVETGFTTP
FT                   AATTLMRYLASFAHDDAQACALEASSIGIAEGRLDGARVDVAVFTNLTRDHLDYHATMA
FT                   AYAQAKARLFAWPRLRLAVSNLDDPFGRELAALSTATKVIGYTQQAGADDRQGTIRAEN
FT                   IEETIDGLRFRLCAPNGRALVESGLLGRYNVSNLLAVAAVLIDAGLTPKAVAERFAQLS
FT                   SPPGRLEKIGGHNEPLVIVDYAHTPDALESALMALRPVANARGAGLVVIFGCGGDRDRG
FT                   KRPLMAAVAARHADRVVLTSDNPRSENEHAILADILAGAPTALVIADRGEAIRRTLLAA
FT                   HPADVVLIAGKGHEPYQEIAGVRRPFSDGAQARAALADRQEPAQ"
FT   gene            complement(693866..695617)
FT                   /locus_tag="CAP2UW1_0577"
FT   CDS_pept        complement(693866..695617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0577"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   dar:Daro_3504 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33926"
FT                   /db_xref="GOA:C7RLN2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN2"
FT                   /protein_id="ACV33926.1"
FT                   /translation="MMRFKGKVAHKFAESPLLQLSLPPWRSRLMALMILGSFAVLIGRA
FT                   FYLQILNNDFLQEKGESRYRRDIEISASRGRIADRHGDVLAISTPMKSIWAIPPATTLT
FT                   SEQSKQLAALLETDPKQLSRKLDTEKTFVFLRRQIPPPVAEQVAALKLPGIGQNKEYRR
FT                   FYPTGEMTAHMVGFTGVDDKGLEGVELAFHGQLLGEPGSRSVIKDRRGQIVEDVGSIKP
FT                   PQDGKDIRLALDSKIQYLAYSQLKQAIADNNAKAGGVVVLDVRTGEILALANWPTYNPN
FT                   NRENLSGSQLRNRAVTDTFEPGSTLKPFTIALGLENGKVRSDTIINCAPGRLTIGNATI
FT                   SDAHPHGALSVAEVIQKSSNVGAAKIAAMLPYQKMWEMFDDVGFGQLPRLGFPGEVSGR
FT                   LRPWKNWRPIEQATMAYGHGISVSLIQLARAYSVFARDGDLVPLSLTRADSSLPHGASV
FT                   FSPKTAREVRAMLEMAVLPGGTAPKAQIPGYRVAGKTGTAHKLAGGRYANKYVSSFVGF
FT                   APASDPRLIVAVMIDEPSAGKHYGGDVAAPVFASVMGSSLRTLGIAPDAPLVVAQSPKT
FT                   PTSKARL"
FT   gene            complement(695614..695892)
FT                   /locus_tag="CAP2UW1_0578"
FT   CDS_pept        complement(695614..695892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0578"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   dar:Daro_3505 cell division protein, FtsL -like"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33927"
FT                   /db_xref="GOA:C7RLN3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN3"
FT                   /protein_id="ACV33927.1"
FT                   /translation="MVRLNVFLLIAAVVCGLGVVTSQHKARKLFQALEVEQERARQLEV
FT                   EFGQLQLELSTWGTAPRIEKIAREKLKMRTPETEKVTTLTPAGGLPR"
FT   sig_peptide     complement(695824..695892)
FT                   /locus_tag="CAP2UW1_0578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.411 at
FT                   residue 23"
FT   gene            complement(695894..696844)
FT                   /locus_tag="CAP2UW1_0579"
FT   CDS_pept        complement(695894..696844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0579"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: dar:Daro_3506 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33928"
FT                   /db_xref="GOA:C7RLN4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN4"
FT                   /protein_id="ACV33928.1"
FT                   /translation="MSQESPHQTVLLQEAVEALAIKPAGTYVDGTFGRGGHSRAILQRL
FT                   GTGGRLLAFDRDPQAVAMASGETDARLLVMHERFGDLADALRRAGCAVEQGIDGVLLDI
FT                   GVSSPQLDEHARGFSFRGDAPLDMRMDTTQGETAAQWLGRASEQEITEVIRNYGEERFA
FT                   FQIAKKIVAARGERSVATTGELAALVRQTVRTREPGQDAATRTFQALRIHINQELEQLA
FT                   LVLPQAMTVLKAGGRLVVISFHSLEDRIVKRFLRDEAAPDRLPRKLPLRAADLPPPRLR
FT                   LIGKPVRASAAEIAANPRARSAIMRVAEKLARKAA"
FT   gene            complement(696841..697287)
FT                   /locus_tag="CAP2UW1_0580"
FT   CDS_pept        complement(696841..697287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0580"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: dar:Daro_3507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33929"
FT                   /db_xref="GOA:C7RLN5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN5"
FT                   /protein_id="ACV33929.1"
FT                   /translation="MFQGAAALSLDAKGRIAVPARHREPLVSASEGRLVLTAHPHRCLL
FT                   LYPETAWEPIRDKVLAASSLNPRSALIKRLLVGHAREEEMDATGRLLIAPELRQFAQLD
FT                   KQVWLVGQGSHFEIWSDAGWQQQQEAVFALGDQLLPADLEDLAL"
FT   gene            complement(697656..697964)
FT                   /locus_tag="CAP2UW1_R0008"
FT   ncRNA           complement(697656..697964)
FT                   /locus_tag="CAP2UW1_R0008"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 244.92"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(698022..698816)
FT                   /locus_tag="CAP2UW1_0581"
FT   CDS_pept        complement(698022..698816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0508 probable putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33930"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN6"
FT                   /protein_id="ACV33930.1"
FT                   /translation="MSQRGFPSPGGLFAPLSPLLERIAFAPDLAALAVLSSTHRVQTRS
FT                   GRRVSFLPPATDGLDYETRIWTRGEVATRPDNWHDFFNALVWLTFPHAKAVLNARHVEA
FT                   LAADATPGRSGRGHDRDAMTHFDECGVIVVASDPSLLALLRGFQWQKLFWERRLDLGRS
FT                   LRCFVFGHATYEQLLQPFRGLTAKGVLYEATEDWFRRPLAAQLTDLDQRLSSELAAGDH
FT                   RDPRAFHPLPLLGLPGVTPDSENPAYYADRWQFRPGRSRRGV"
FT   gene            complement(698813..699271)
FT                   /locus_tag="CAP2UW1_0582"
FT   CDS_pept        complement(698813..699271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33931"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN7"
FT                   /protein_id="ACV33931.1"
FT                   /translation="MPRNTLLPLLLLLMLPILAACSDQRAALEFGSPQHSLTLIRVQNF
FT                   FWDKTARYSIVAARMPECQRRHELGSAGSESKVEVYAPGNDAWILKQGKRLFVVETRTC
FT                   EGFAKLEGDPEGGMGPLQGSFQMRNGTLTFVAAAQGETANQAAAPAAQ"
FT   sig_peptide     complement(699203..699271)
FT                   /locus_tag="CAP2UW1_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.423 at
FT                   residue 23"
FT   gene            complement(699307..700341)
FT                   /locus_tag="CAP2UW1_0583"
FT   CDS_pept        complement(699307..700341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0583"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: dar:Daro_0506 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, homodimeric type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33932"
FT                   /db_xref="GOA:C7RLN8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN8"
FT                   /protein_id="ACV33932.1"
FT                   /translation="MQITITRPDDWHLHLRDGEALAAVLPHTARQFARAIVMPNLRPPV
FT                   TTVAAAGDYRARILAALPPGMAFEPLMTLYLTDRTPVDEIRCAAECDFVHAIKLYPAGA
FT                   TTNSDSGVTDLDHCSAVLAEMEKLGLPLLVHGEATDPASDVFDREKIFIERVLQPLLAR
FT                   HPALKVVFEHITTSDAADFVAACGPTVAATITAHHLLYNRNAIFAGGIQPHYYCLPVLK
FT                   REQHRLALLRAATSGSEKYFLGTDSAPHARTAKETACGCAGCYTAHAALELYAEAFASN
FT                   GALDRFEAFASFNGADFYGLPRNTGKVTLERCDWLTPEAFPYLGDDTLVPLRAGELLHW
FT                   KMLG"
FT   gene            complement(700504..701346)
FT                   /locus_tag="CAP2UW1_0584"
FT   CDS_pept        complement(700504..701346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0584"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: dar:Daro_0504
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33933"
FT                   /db_xref="GOA:C7RLN9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLN9"
FT                   /protein_id="ACV33933.1"
FT                   /translation="MVATPLGHLGDMTARAIEVLRRVPWVAAEDTRHSAPLLKHYGSRA
FT                   RLLAAHQHNEESAAEQVMARLSAGESVALVVDAGTPAISDPGARLVARVRAAGHRVVPL
FT                   PGACAAIVALSAAGLSETHFLFYGFLPTKAGQRAQVLRELAPLPWALVFYEAPHRILDS
FT                   VAALAAAFGPARTVVLARELTKLFESIHSCRLGEAHDWLLADADRQRGEFVVLVSGAPA
FT                   ATDNAEGERVLALLLDEGLPVSQAARLAQAITGAGKKTLYQMALRARPVPGDDEESAT"
FT   gene            701372..701773
FT                   /locus_tag="CAP2UW1_0585"
FT   CDS_pept        701372..701773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0585"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   dar:Daro_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33934"
FT                   /db_xref="GOA:C7RLP0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP0"
FT                   /protein_id="ACV33934.1"
FT                   /translation="MAISWQMSGNDSTTGQARHRVSDGMIAEDLAARFLERQGLRVLAR
FT                   NYRCRGGEVDLICRERRVLVFVEVRLRRNASYGGAAASITARKQGRIVLAAQHYLTMHA
FT                   LGEADCRFDCILLDGLSEAAVEWLRDAFC"
FT   gene            701760..702137
FT                   /locus_tag="CAP2UW1_0586"
FT   CDS_pept        701760..702137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0586"
FT                   /product="HIRAN"
FT                   /note="PFAM: HIRAN; KEGG: dar:Daro_0502 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33935"
FT                   /db_xref="GOA:C7RLP1"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP1"
FT                   /protein_id="ACV33935.1"
FT                   /translation="MRFARLALALGLLLGISASAAAETVKILVQSSPLAGSQFYAVAEV
FT                   WPQIRLGDRLTLIREPENRHDRKAVRVEWQGRQLGYVPRAENRAVARALDDGEKLEARV
FT                   SRLREDPDPWRRVEFEVFLIL"
FT   sig_peptide     701760..701828
FT                   /locus_tag="CAP2UW1_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.649 at
FT                   residue 23"
FT   gene            702178..702771
FT                   /locus_tag="CAP2UW1_0587"
FT   CDS_pept        702178..702771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0587"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; PFAM: sugar
FT                   isomerase (SIS); KEGG: azo:azo0870 putative phosphoheptose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33936"
FT                   /db_xref="GOA:C7RLP2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP2"
FT                   /protein_id="ACV33936.1"
FT                   /translation="MDLIKRVSEHFRDSAQTKLDAIELLALPIAQAIEAMVGSLLNNGK
FT                   ILACGNGGSAADAQHLAAELVGRFEVERHELAAIALTTDTSIISAIANDYGYRMVFAKQ
FT                   VRALGQPGDVLLAISTSGNSPNVIEAIAAAHANDLRVVALTGKGGGAIADILQETDVHI
FT                   CVPAERTSRIQETHLLTIHCLCDGIDCLLMGVEE"
FT   gene            702768..703421
FT                   /locus_tag="CAP2UW1_0588"
FT   CDS_pept        702768..703421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0588"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   eba:ebA1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33937"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP3"
FT                   /protein_id="ACV33937.1"
FT                   /translation="MRKALAASLLLGATALPMLQGCLPVVAASAVSGGALATLDRRSLG
FT                   TQTDDETVEWKASSRVGEKFSDNVHLNFTSYNRRVLVTGEVPSEEVKGEIERIVAGIPQ
FT                   VQGVYNELAVAPVTSFSTRSNDSYITTRVKSRFVDSGKFSAVHVKVVTEASVVYLLGLV
FT                   TQREADSAIQVARTTSDVKKVVNLLEIISDAKARELDVRMPEQRPPAPPASGGG"
FT   sig_peptide     702768..702851
FT                   /locus_tag="CAP2UW1_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 28"
FT   gene            complement(703563..703919)
FT                   /locus_tag="CAP2UW1_0589"
FT   CDS_pept        complement(703563..703919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0589"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: dar:Daro_0534
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33938"
FT                   /db_xref="GOA:C7RLP4"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP4"
FT                   /protein_id="ACV33938.1"
FT                   /translation="MDIIFIDDLRASTLIGIYPREKAMPQTIEISLRIGTSTASAGASD
FT                   DIRDTIDYAVVVDRLRAELAARHFNLLERLAEYVATLLLEEFGATWVRVSIAKLGMMRG
FT                   VQRVGVVIERGAAA"
FT   gene            704029..704646
FT                   /locus_tag="CAP2UW1_0590"
FT   CDS_pept        704029..704646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0590"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   dar:Daro_0533 acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33939"
FT                   /db_xref="GOA:C7RLP5"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP5"
FT                   /protein_id="ACV33939.1"
FT                   /translation="MPPLLITLAAILAAYLLGSIPFALVASRVFGLADPRSYGSKNPGA
FT                   TNVLRSGHKGAAIFTLIGDVAKGWLAVFLASRYGPEYGLASATVGLVALAVFFGHLYPV
FT                   FLAFKGGKGVATAAGVLLAIDPWLGLATLATWLFIALVLRYSSLAALVAATAAPVYAFM
FT                   LWGNNGMVVTVGIIAMALVGKHWPNLQRLMAGSEPKIGSRKG"
FT   sig_peptide     704029..704106
FT                   /locus_tag="CAP2UW1_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.445 at
FT                   residue 26"
FT   gene            complement(704660..705166)
FT                   /locus_tag="CAP2UW1_0591"
FT   CDS_pept        complement(704660..705166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0591"
FT                   /product="glycoside hydrolase family 24"
FT                   /note="PFAM: glycoside hydrolase family 24; KEGG:
FT                   stm:STM1028 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33940"
FT                   /db_xref="GOA:C7RLP6"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP6"
FT                   /protein_id="ACV33940.1"
FT                   /translation="MSIRAINQQGIDLIKRFEGIVDGNKTTPNYDPYIDPVGIWTIGYG
FT                   HAIRFQNAFLRGEAARARAAALYPSGLTTQEVEDLLRADLLNTCRDVASLVKVTMSDNQ
FT                   FAALVSFAFNVGSTALKNSSLLKKLNAKDYAGAANEFAKWNKGGGKVLAGLTRRREAER
FT                   QLFLS"
FT   gene            complement(705451..706470)
FT                   /locus_tag="CAP2UW1_0592"
FT   CDS_pept        complement(705451..706470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0592"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: dar:Daro_0530 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33941"
FT                   /db_xref="GOA:C7RLP7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP7"
FT                   /protein_id="ACV33941.1"
FT                   /translation="MLILGIESSCDETGVALFSTDAGGTLLAHALHSQVAMHQNYGGVV
FT                   PELASRDHIRRIIPLLRTVLASSGRALAEIDAVAYTQGPGLAGALLVGAAFAEALATAL
FT                   GVPTVPVHHLEGHLLSPLLSGNPPRFPFVALLVSGGHSQLMRVTGVGNYALLGETLDDA
FT                   AGEAFDKTAKLLGLGYPGGPALAELAERGRRDEVKLPRPMLKSGDLDFSFSGLKTAVLT
FT                   KVRELAAITDQQRADIARGFQDAIVEVLVSKAIRAVALSGLQQLVVAGGVGANRELRRQ
FT                   LDAAASRARIAVFYPELEFCTDNGAMIALAGALRLQAGLAGKVAGAFAVRPRWPLTDS"
FT   gene            complement(706506..707153)
FT                   /locus_tag="CAP2UW1_0593"
FT   CDS_pept        complement(706506..707153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0593"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: dar:Daro_4089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33942"
FT                   /db_xref="GOA:C7RLP8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP8"
FT                   /protein_id="ACV33942.1"
FT                   /translation="MPKVETSTRAARRPASITKRQPVHVVRGQRIYAADTTGTAWRVLA
FT                   GSVRLDRQEPNGEQSFANLAIIGDILGAETLLFGRYTFTATALSACVLAPWPEGQAAPA
FT                   GDSLLRTLAKAERRAAEVIALRCGQAAERVRRLVMLLSHVPIEDPAANAAAPLQVVLPS
FT                   RQDMADITALKLETVSRMVSQLRQTGILDPLCRDGHPSLRNFVVRGAAADPY"
FT   gene            complement(707227..709518)
FT                   /locus_tag="CAP2UW1_0594"
FT   CDS_pept        complement(707227..709518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0594"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rfr:Rfer_0619 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33943"
FT                   /db_xref="GOA:C7RLP9"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLP9"
FT                   /protein_id="ACV33943.1"
FT                   /translation="MKFARKPIAVAVALSLPSLWQGAVAQESSATPVMSEVVVKASKIQ
FT                   DKEPFGASRLDAASTAPYRAATSDTASLLDRLPGVSLYGAGGVSSLPVIRGLADDRIRI
FT                   KVDGMDLISSCANHMNPPLSYIDPTNVGSVMLFAGITPVSVGGDSIAGTILVNSAAPEF
FT                   AKAGEGTLLRGQAGAFYRSNGNGRGANLSATLANEMLSVNYSGSTAQADNYTAGGSFKP
FT                   AGPSLGTSEWLAGDEVGSSQYKSENQSLGFALRYAEHLLELKFGYQHIPYQGFPNERMD
FT                   MTLNDSHQVNLRYLGQYNWGSLEARAYHNNTRHKMNFLEDKLTLANPAGMPMDTEGKTT
FT                   GAVLKADILASDRDLFRVGGEYQKYRLDDWWPAIGPYVPPMGGMGGMGGMAGMSMNMMN
FT                   GSTFWNINDGKRDRFDVFGEWEARWSGQWLSQLGVRSSTVWMDTGDVQGYNPVDYGNPA
FT                   NPNSIPGAFNAADRSRTDHNLDLTALLRFTPDAQQTYEAGFARKTRSPNLYERYAWSTN
FT                   NTMTMTMINWFGDGNGYVGNLDLKPEVANTVSATARWHDAAREQWSFNITPYYTYVQDY
FT                   VDARRCSGGAMMSPCDRNNVTATTGFVNLQFVNQSARLYGADVSGYFPVLQGGALGNVK
FT                   MTGVVSYVRGRNPDTDDNLYHIMPLNAKLALVQQSGPWTNTLEGVFVDAKTKVSSVRNE
FT                   LETSGYGLMNLRSSYQWKQVRLDVGVENVFNRLYDSPLGGAYLGQRPMVYGTAVPGMGR
FT                   SLYAGANLQF"
FT   sig_peptide     complement(709441..709518)
FT                   /locus_tag="CAP2UW1_0594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.973 at
FT                   residue 26"
FT   gene            710209..710514
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0595"
FT   gene            710690..712768
FT                   /locus_tag="CAP2UW1_0596"
FT   CDS_pept        710690..712768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0596"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: reu:Reut_A3000 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33944"
FT                   /db_xref="GOA:C7RLQ0"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLQ0"
FT                   /protein_id="ACV33944.1"
FT                   /translation="MANTSPMPGASGTVRGACPHDCPDTCALDVTVSDGRVIKVAGAAD
FT                   HAPTAGVLCTKVAFYPERIHHPDRLLHPLRRVGAKGPGASFERITWEVALATIAERFRR
FT                   IAAESGAEAIVPYSYAGNSGLLGYGSMDRRFFHRLGAAQLDRTICASAGAMGYRATIGA
FT                   SVGFDAESVVDARLIILWGTNSVVSNLHFWRLAQEARRRGARLIAIDPCRTATAEKCDQ
FT                   HVALLPGTDSALALGLMHVLIRDELLDADYIARYTLGFDALRERALQFAPARVAAICGI
FT                   SEGEIEKLAHDYASTSPAAIRTNYGINRTAGGGMALRAISCLPAFTGAWRYPAGGVLLS
FT                   TSGNYPVDTAALERPDLMPNSAPRTINMSTIGRDLLHAQPAIKALFVYNSNPVAIAPQS
FT                   AEVVRGFARQDLFTVVHDLFQTDTADYADILLPATSHMEQLDIHKSYGHLHIQVNQPAI
FT                   APLGEALPNTELFRRLARQMGFSDACFADDDEALCRQAFDWSDPRLAGLSWEKLKADGH
FT                   ARLNLPRGAAPFADGGFPTPSGKCEFYSQSMLSQGLDPLPDFIAPREWRQSTLAAEFPL
FT                   ALITPPARNFLNTSFANSARFLAQEKSPAVHLHPADASARGIANDSPVRIFNRRGEFRA
FT                   RAIVSERIRPGVAMATSIWWRKLSPDGRNCNEVTSQALTDMGGGATFYDCLVEVAAV"
FT   gene            complement(712833..713690)
FT                   /locus_tag="CAP2UW1_0597"
FT   CDS_pept        complement(712833..713690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33945"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:C7RIX7"
FT                   /protein_id="ACV33945.1"
FT                   /translation="MKPYCGRQFTLDELQTLRHLIEANPSASRAQLSRQVCALLDWFKP
FT                   NGELKDMTCRVAMLRMQADGLLTLPAAQRCAPRQPEYLATAATDPQSLLVRPVHELPPL
FT                   HLRQVSGSAHSRLWNEYIARYHYLGYTPMAGSQSRYFVFAGEHRVALLSFGASAWKLAA
FT                   RERFIGWQEDERQRNLPLVVNNARFLILPWIQSKGLASKILAIIHRQLPNDWLARYGYR
FT                   PVLLETFVETPRHRGTCYQAANWIKVGQTTGRGKKCPTSKPILPIKDIWLHPLHRNFRS
FT                   ILCR"
FT   gene            complement(713687..715115)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_0598"
FT   gene            complement(715593..716294)
FT                   /locus_tag="CAP2UW1_0599"
FT   CDS_pept        complement(715593..716294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0599"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   KEGG: asa:ASA_2981 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33946"
FT                   /db_xref="GOA:C7RLQ2"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLQ2"
FT                   /protein_id="ACV33946.1"
FT                   /translation="MLLARMRIPVTATFPKVSWVGGKVRKWRIPAGLYNALPYFYASAG
FT                   LLAMIALRDGVAVVLGLILLSAGGLVGLLRAQHRRGLYQLEKPSDLPNAGKEEAPAGVL
FT                   VQFLWRNSFECGHPLIDEQRRRLCRLGSELINSVLIRQPPSQVELLLDDLIEHIIDHFS
FT                   TEESVLAETQPPILRKHQASHRALLAKAATVRDQFLSGQLAASDLVGFISCDVISDHVI
FT                   RDSRELAVEAG"
FT   gene            complement(716502..717227)
FT                   /locus_tag="CAP2UW1_0600"
FT   CDS_pept        complement(716502..717227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_0600"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: azo:azo1154
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV33947"
FT                   /db_xref="GOA:C7RLQ3"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C7RLQ3"
FT                   /protein_id="ACV33947.1"
FT                   /translation="MTPRISEIWVYLAASPLLGLTLTLLAYQGATWVHKRCHGHPLANP
FT                   VLLAVAALVALLSLTDTPYSTYFDGAQFVHFLLGPATVALAIPLYAQIERLVRLALPLL
FT                   VALVVGSLTAALSAVAIGSLFGASRATLLSLAPKSATTPIAMGIAERLGGLPSLTAVLV
FT                   IITGIVGAIGGRYVYRALHIEDDAQRGFAMGIAAHGIGTARAFQENEQMGAFAALAMGL
FT                   NGLMTALLLPVVIPWFLGR"
FT   sig_peptide     complement(717147..717227)
FT                   /locus_tag="CAP2UW1_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.681 at
FT                   residue 27"
FT   gene            complement