(data stored in ACNUC7421 zone)

EMBL: CP001717

ID   CP001717; SV 1; circular; genomic DNA; STD; PRO; 42325 BP.
XX
AC   CP001717;
XX
PR   Project:PRJNA29435;
XX
DT   03-SEP-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph02,
DE   complete sequence.
XX
KW   .
XX
OS   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Candidatus Accumulibacter.
OG   Plasmid pAph02
XX
RN   [1]
RP   1-42325
RG   US DOE Joint Genome Institute
RA   Martin H.G., Ivanova N., Kunin V., Warnecke F., Barry K., He S.,
RA   Salamov A., Szeto E., Dalin E., Pangilinan J.L., Lapidus A., Lowry S.,
RA   Kyrpides N.C., McMahon K.D., Hugenholtz P.;
RT   "Complete sequence of plasmid2 of Candidatus Accumulibacter phosphatis
RT   clade IIA str. UW-1";
RL   Unpublished.
XX
RN   [2]
RP   1-42325
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Barry K., Pitluck S., Lowry S., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., McMahon K.D., Hugenholtz P.;
RT   ;
RL   Submitted (27-AUG-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c51e42a770d5d3ad0ba4cf8617e702a4.
DR   BioSample; SAMN02598465.
DR   RFAM; RF01760; traJ-II.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635729
CC   Source DNA available from Katherine D. McMahon
CC   (tmcmahon@cae.wisc.edu)
CC   Contacts: Katherine D. McMahon (tmcmahon@cae.wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Candidatus Accumulibactor phosphatis Type
CC                            IIA UW-1
CC   GOLD Stamp ID         :: Gi03328
CC   Isolation Site        :: enhanced biological phosphorus removal
CC                            (EBPR) wastewater treatment bioreactor
CC   Collection Date       :: 6/30/2004
CC   Isolation Country     :: USA
CC   Latitude              :: 43.078418
CC   Longitude             :: -89.386482
CC   Altitude              :: elevation: 263m
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sediment, Sludge
CC   Phenotypes            :: EBPR, Polyphosphate-accumulating
CC   Energy Source         :: Chemoheterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..42325
FT                   /organism="Candidatus Accumulibacter phosphatis clade IIA
FT                   str. UW-1"
FT                   /plasmid="pAph02"
FT                   /strain="UW-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:522306"
FT   gene            8..568
FT                   /locus_tag="CAP2UW1_4524"
FT   CDS_pept        8..568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4524"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: rme:Rmet_6187 resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37858"
FT                   /db_xref="GOA:C7RW29"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW29"
FT                   /protein_id="ACV37858.1"
FT                   /translation="MKGQRIGYVRVSSFDQNPDRQLEQVQVDKVFTDKASGKDTLRPQL
FT                   DTLLTFVREGDTVVVHSMDRLARNLDDLRRLVQKLTKRGVRIEFVKECLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELRQRADAGEQ
FT                   KSKLAREFGVSRETLYQYLRTDQ"
FT   gene            571..3537
FT                   /locus_tag="CAP2UW1_4525"
FT   CDS_pept        571..3537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4525"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   asa:ASA_P4G106 TnpA transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37859"
FT                   /db_xref="GOA:C7RW28"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW28"
FT                   /protein_id="ACV37859.1"
FT                   /translation="MPRRSILSAAERESLLALPDTKDDLIRHYSLSDSDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGILLGVDQPLFLPLLKLVADQLKVGVESWNDYGQREQTRREHL
FT                   VELQTVFGFQPFTMSHYRQAVHTLTELAMQTDKGIVLASALIEQLRRQSIILPALNAIE
FT                   RASAEAITRANRRIYEALSEPLSNGHRHRLDDLLKRRDNGKMTWLAWLRQSPVKPNSRH
FT                   MLEHIERLKAWQALDLPSGIERLVHQNRLLKIAREGGQMTPADLAKFEPRRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDPFAAIEAVMSWDAFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKGVLDAIEVLRGMNTDNARKVPTDAPTDFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPDKFTSLKQSSTLPLAVVTDCDQYLH
FT                   DRLTLLETQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMILPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAEHWGDGTTSSSDGQNFRTGSKAESTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGVRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYISKGETAYDALKPMIGGTLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALARAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAVVLWNTVYL
FT                   ERAAQALRGNGHTVDNALLQYLSPLGWEHINLTGDYLWRSSAKIGAGKFRPLRPLQPA"
FT   gene            3604..4740
FT                   /locus_tag="CAP2UW1_4526"
FT   CDS_pept        3604..4740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4526"
FT                   /product="transposase"
FT                   /note="KEGG: eba:p1B6 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37860"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW50"
FT                   /protein_id="ACV37860.1"
FT                   /translation="MQVDWGHFGHLEIGRARRPLMGFVAVLSWSRQIFLRFYLGAYMEN
FT                   FLRGHVGALTAWGGCPRVALYDNLKSAVLERQGSVIRFHPTLLALSGHYRFEPRPVAVA
FT                   RGNEKGRVERAVRFIRDAFFAGRRFTDVDDLNAQADAWVIGPAGERRCPEDEALTVHEA
FT                   FEQERTRLLTLPGNAFPTDEVKAVCAGKTPYVRFDLNDYSIPHTCVARTLSVVASLDQV
FT                   RILDGQTVVATHRRSYDRRQQIEIPEHIATLVAHKHQAAAHRGTDHLVQAVPTSRELLT
FT                   QAVERGEPLGRTVRALTELLEAYGVAELTAAIADALGRGVPHPNAVRLALEKRRQAKAA
FT                   PPPLAVPLPEHVKRRDVRVRPHRLDDYDQLMGGSPDDE"
FT   gene            4730..5482
FT                   /locus_tag="CAP2UW1_4527"
FT   CDS_pept        4730..5482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4527"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p1B4 IstB transposition helper
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37861"
FT                   /db_xref="GOA:C7RW51"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW51"
FT                   /protein_id="ACV37861.1"
FT                   /translation="MTNDARRQRAAALQLHGILAHWAECAEQPWLDPLLSWEESERARR
FT                   SLERRLRCAHIGRFKPLADFDWTWPQQCDQRAIAELMTLDFVPAATNVLLVGSSGLGKT
FT                   MIAQNIAHQAILEGHTVLFATAGQLLGDLAGLDSDSALRYRLRRYAAPDLLVIDEVGYL
FT                   SYSNRHADLLFELINRRHEKKSTLITTNKSFSEWPEVFPNAGCVVAMIDRLVHHAEILA
FT                   IKGESYRRKEAQEQAAARSRKRTAKAAT"
FT   gene            5479..5691
FT                   /locus_tag="CAP2UW1_4528"
FT   CDS_pept        5479..5691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:p1D1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37862"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW52"
FT                   /protein_id="ACV37862.1"
FT                   /translation="MKLTHQPSGLHDGLDLLIDSRWSPDQALAVIELLDDLRDRIWAHY
FT                   EVALQTRFREQRVTCCDVETTDPPF"
FT   gene            6302..6565
FT                   /locus_tag="CAP2UW1_4529"
FT   CDS_pept        6302..6565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4529"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: psp:PSPPH_B0056
FT                   DNA-damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37863"
FT                   /db_xref="GOA:C7RW53"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW53"
FT                   /protein_id="ACV37863.1"
FT                   /translation="MSANAVVRARIDEHIKEEATAVLAAMGLTVSDAFRIMLTRVAREK
FT                   ALPFEPLVPNVETIEAMKEARNGGLKSFATVEDLMADLNAED"
FT   gene            6552..6833
FT                   /locus_tag="CAP2UW1_4530"
FT   CDS_pept        6552..6833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4530"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: psp:PSPPH_B0055
FT                   addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37864"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW54"
FT                   /protein_id="ACV37864.1"
FT                   /translation="MRKIEHTGQFKRDYKRETKGPHRQTLQSDFVAIVTALAHDQVLAD
FT                   KHHDHSLSGDWKDHRDCHVKPDLVLIYRKPDDNVLQLVRLGSHSELGL"
FT   gene            6972..7163
FT                   /locus_tag="CAP2UW1_4531"
FT   CDS_pept        6972..7163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_B0054 putative TnpA repressor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37865"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW55"
FT                   /protein_id="ACV37865.1"
FT                   /translation="MTEFSAVPAYNPSQVASLFELASDLDEQVSHMMTNLEEVQATLSQ
FT                   LTALYPDSLSCGGLDGDE"
FT   gene            7147..7296
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_4532"
FT   gene            complement(7412..7837)
FT                   /locus_tag="CAP2UW1_4533"
FT   CDS_pept        complement(7412..7837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37866"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW56"
FT                   /protein_id="ACV37866.1"
FT                   /translation="MKTVFAIAGLAVLALTGCVGHTHDLAPESGNPEATIGTFTHEGRE
FT                   GPAMVLEFKGQRFAAQGFAIRRDANIAALQQHDRRSMRPSWVSAGSNPEHYEYSATPEL
FT                   RATDGAVLRCTLTWPARQAPAGYCETREGTRIAVRFD"
FT   sig_peptide     complement(7769..7837)
FT                   /locus_tag="CAP2UW1_4533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.885 at
FT                   residue 23"
FT   gene            complement(8157..9395)
FT                   /locus_tag="CAP2UW1_4534"
FT   CDS_pept        complement(8157..9395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37867"
FT                   /db_xref="GOA:C7RW57"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW57"
FT                   /protein_id="ACV37867.1"
FT                   /translation="MMVRLLLIGIFAVVKAASAAQPMNPPGLMPTAIARPLFEQDPGVA
FT                   AARAGLDVALQEASILDQSPYEWTARVDGQQRRVENGPRYNEWFVGVEKTIRLPGKATA
FT                   DRSIGKATVDESRARYGEALLTSARELMELWVDWLAAERARELGGSSLQSMQASLAAVE
FT                   KRARAGDASKLDLGITRAELAEQRRMDNDAKTQAAAAWLRLSTRFPGVERQLLALPEPL
FT                   VLGSEAPSWQERILAETHALKLVQAQVRKAQAQAERARAEKIPDPTFGVYTASEIGGRE
FT                   RIPGVTISIPIPGGARDLRSAQAIAAVEVSRQEAELKQRQLQAGIASAVATARGGYESF
FT                   QIANEGAAAMQENARLMQRAYALGEAELQAFLLTRRQATAAVNNALQAQVIALKAYYGL
FT                   LIDAHLIWGLEHD"
FT   sig_peptide     complement(9336..9395)
FT                   /locus_tag="CAP2UW1_4534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.857 at
FT                   residue 20"
FT   gene            complement(9392..9694)
FT                   /locus_tag="CAP2UW1_4535"
FT   CDS_pept        complement(9392..9694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr4113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37868"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW58"
FT                   /protein_id="ACV37868.1"
FT                   /translation="MSELCLTLVCPPEVEEKLLDLLLLWPGATIFTSTATAAHGLAHES
FT                   LDQTEQVLGRARATEVQVICAAAGQAALLAALRQQFSGVGLRYWVTPVVEAGEIA"
FT   gene            complement(9687..12770)
FT                   /locus_tag="CAP2UW1_4536"
FT   CDS_pept        complement(9687..12770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4536"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: rpb:RPB_4294 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37869"
FT                   /db_xref="GOA:C7RW59"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW59"
FT                   /protein_id="ACV37869.1"
FT                   /translation="MLARLVQLSLSQRLFVLLATLIVAGAGWMAYLGLPIDAFPDVSST
FT                   QVKIIMKAPGMTPEEVESRIAVPIEVEMLGIPKTKILRSVTKYGLVDVTIDFEDGTDIY
FT                   WARQQVSERLGGLTDSLPAGITGGMAPITTPLGEMFMFTVDADGLSLAERRSLLDWVIR
FT                   PALRTVPGVADVNALGGVVRAFEVVPDQIKMAASGVTVAQLKEAIDANNRNDGAGRLGE
FT                   GDEVLLVRSEGSVTSLDDLRAIVVTIKDDSPVRLGNLAEVKIGTVTRYGVVTQDGKAEA
FT                   VQGLVLGLAGANAQKVVEGVRKKLDELQPTLPKDVQLGVFYDRASLVSKAVGAVSAALL
FT                   EASVLVIILLGLFLGNIRAAVTVALVLPLAALITFILMRGFGMSANLMSLGGLAIAIGM
FT                   LLDAAVVVVENIVQRLATDPTAGKLPRLHTIYRAVREVAVPVSSGILIIITVFLPLLTL
FT                   QDLEGKFFVPVALTIVFALAGSLLLSLTVIPVLASYLLREVKHEDPWLPRKLLALYEPA
FT                   LAWGLRRQGIVVGVAVLLLLGAGGVYTQVGKTFMPTMDEGDLIVGIEKLPSISLEQSAA
FT                   LDLKIHQALMKAIPEVTGIVARAGSDEIGLDPMGLNQTDTYLVLKPRDHWRMKSKEALM
FT                   DEIRKVLDPMPGISYSFTQPIEMRVSEMIIGVRGDLAVKIFGPDLDQLNTYASEVEALL
FT                   KTVPGNQDVYTVQNDGVQYLQVVVDRLQAGSLGLSVEEIQDALRTQIEGQRAGIVIEGN
FT                   RRTPIVLRGTEAVRMSPAEFGAMRITTQGGSTVPLTSVAKLQRAAGPVKIDREMGSRYS
FT                   VVIANVGGRDLVGFVEEARALVTEKLSLPTGYRITWGGQFENQQRAAARLAVVVPVALG
FT                   LVFVLLFSTFRSVRQALLILSNVPFALVGGIVALWVTGEYLSVPASVGFIALLGIAVLN
FT                   GVVLVSYFNQLHSEGMKLSDVVVQGAKRRLRPVLMTASITAFGLIPLLFASGPGSEIQR
FT                   PLAIVVIGGLTTATVLTLMLLPILYLRFAFPRREVPHV"
FT   sig_peptide     complement(12672..12770)
FT                   /locus_tag="CAP2UW1_4536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.239 at
FT                   residue 33"
FT   gene            complement(12770..13897)
FT                   /locus_tag="CAP2UW1_4537"
FT   CDS_pept        complement(12770..13897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4537"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rpt:Rpal_4973 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37870"
FT                   /db_xref="GOA:C7RW60"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW60"
FT                   /protein_id="ACV37870.1"
FT                   /translation="MKTSSSPFPAGSAWAMAVMCILTATTQAADRPAKFTVPNSQIQAL
FT                   GIQTTPLQNDTDLVKASYPAHVVVPPEAEQVISSPVAGLVAQLLVQQNQVVPSGAPLVR
FT                   IVSPELGQLQLQLLQATVRATLARQAAQREHALFDEGIIAKRRVQEARAALQEAEATLN
FT                   QAKAALRLSGMPSATIERIATSGKPQDSVTLLATQAGIVTVIAVKPGQRVEAATALLHV
FT                   AQTDSLWLDIQLPVSERVGWPAGTQVKVLGRSLTARILSVSPTVSHGSQTVVLRAAVEG
FT                   KTGEVRPGELVTVELPITATQGNWDVPLSAVVHDGEQAYLLVRTADGFEARPVKVVVSA
FT                   GQRVRVQGPLKEGEQIAISGVVALKGAWLDAKESK"
FT   sig_peptide     complement(13811..13897)
FT                   /locus_tag="CAP2UW1_4537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            complement(14734..15852)
FT                   /locus_tag="CAP2UW1_4538"
FT   CDS_pept        complement(14734..15852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4538"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   bvi:Bcep1808_7462 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37871"
FT                   /db_xref="GOA:C7RW61"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW61"
FT                   /protein_id="ACV37871.1"
FT                   /translation="MTSFSTLLAQGAGNAWLFIPSAILLGGLHGLEPGHSKTMMAAFIV
FT                   AIRGTVGQAVLLGVSATISHTAVVWVIALGGMYFGQKWDAETSEPYLQVASALVIIGVA
FT                   LWMIWRNWRQQQLAEQDHDHDHHHDDSKRIDTGHGVVRLDVFEDGVPPRFRLFAESGHG
FT                   HTWTADQVRIETERPDGSRQSFRFVQRDGFVESEQEIQEPHEFVARLRLGHEHHSHDYD
FT                   VEFVEHDHQHHAIKDYEGLDVSAPGYQDPHELAHANDIRHRFTNREVTTGQIVMFGLTG
FT                   GLIPCPASITVLLLCLQLKEIALGATLVLSFSIGLALTMVLSGALAALSVKHVSRRWSG
FT                   FGKFARRAPYFSAALILLVGLYVGYQGLQALA"
FT   gene            complement(15863..16132)
FT                   /locus_tag="CAP2UW1_4539"
FT   CDS_pept        complement(15863..16132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4539"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   vei:Veis_2756 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37872"
FT                   /db_xref="GOA:C7RW62"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW62"
FT                   /protein_id="ACV37872.1"
FT                   /translation="MSTHTSHPEIIKRLKRAEGHLRSTITMLEDSRDCLAIAQQLQAVE
FT                   SAVGNAKKTLVHDHIDHCLEQAVRDAPQSAEETIREFKAITKYL"
FT   gene            complement(16831..17493)
FT                   /locus_tag="CAP2UW1_4540"
FT   CDS_pept        complement(16831..17493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4540"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: amr:AM1_H0028
FT                   resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37873"
FT                   /db_xref="GOA:C7RW63"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW63"
FT                   /protein_id="ACV37873.1"
FT                   /translation="MLIGYARVSKSDGSQTVAPQRNALLVAGVDPERIYEDLASGRNDA
FT                   RPGLIACLKALQPGNTLVLWKLDRLGRDLRHLVNTAEDLRVRGIGLKVLTGAGAQIDTT
FT                   TANGRLAFGIFAAFAEFERELIAERTQAGLAAARARGRLGGRPRKMDRAMLTMAMAALS
FT                   DPKAVTADVAKRLGITTTTLYSYVNGDGSPKAAGTALLRTETGDESPDTVSTVQRSA"
FT   gene            complement(18020..18223)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_4541"
FT   gene            complement(18281..18712)
FT                   /locus_tag="CAP2UW1_4542"
FT   CDS_pept        complement(18281..18712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4542"
FT                   /product="Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: dar:Daro_2256
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37874"
FT                   /db_xref="GOA:C7RW64"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW64"
FT                   /protein_id="ACV37874.1"
FT                   /translation="MKIGELAQVAQCTVETVRYYEKEGLLSAPARTRANYRSYGEFHVE
FT                   RLRFIRNCRALDMTHAEIRTLLGLMDQPAGDCGGVNQLLDEHIAHVDVRMAELSQLKQQ
FT                   LSELRQRCQSEQAMDACGILQGLASMETEPRHKRHTHLG"
FT   gene            complement(18737..18910)
FT                   /locus_tag="CAP2UW1_4543"
FT   CDS_pept        complement(18737..18910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37875"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW65"
FT                   /protein_id="ACV37875.1"
FT                   /translation="MTMVVRMPMIVMSGQSAVSMRLIVAACVVNMRNFHGARGHGVVQL
FT                   LVYCPFHTLKLL"
FT   gene            19019..21082
FT                   /locus_tag="CAP2UW1_4544"
FT   CDS_pept        19019..21082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4544"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: dar:Daro_2257
FT                   ATPase, E1-E2 type:heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37876"
FT                   /db_xref="GOA:C7RW66"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW66"
FT                   /protein_id="ACV37876.1"
FT                   /translation="MDCPTEEALIRNKLGGLATVSGMEFNLMQRVLTVVHQNNTLAAVE
FT                   TAIRDLGMSTEPMEASSQGRAPTEAVSKPWWPLALAGLAALGAEIVHWLGLPEWLSGLL
FT                   ALVAITISGVGTFKKGWIALRHGNLNINALMSIAVTGAVLLRQWPEAAMVMVLFTVAEL
FT                   IEAKSLDRARNAIRSLVQLAPEMATVQQADGDWAELPAKAVAIGQIVRVKPGERVALDG
FT                   VVTAGRSSINQAPITGESLPVDKSAGDSVFAGTINQSGSVEFRVTAESTHSTLARIIHA
FT                   VEEAQGARAPTQRFVDQFAKIYTPAVFVFAIAVALVPPLLLGGSWQDWVYQALVLLVIA
FT                   CPCALVISTPITIVSGLAAAARHGILIKGGVYLEEGHKLAWLAFDKTGTITHGKPVLTD
FT                   TVLLDQTDGVDAVRVATSLAARSDHPVSHAIATSGQRNDTVLLDVADFAAIPGRGVLGT
FT                   VGGVQYQLGNHRLIHELGVCTPPLEARLGELEEQGKTVILLTDGERVLVLFAVADTVKD
FT                   SSRAAIRALHELGIKTVMLTGDNAHTARAIAAQVQIDEALGDQLPEDKLRAIERYAQTG
FT                   KVGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDDLNKIARFVRLSRTTR
FT                   TVLVQNITLALGIKVVFLALTLLGMGTMWMAVFADMGASLLVVANALRLVRR"
FT   gene            21079..21648
FT                   /locus_tag="CAP2UW1_4545"
FT   CDS_pept        21079..21648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37877"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW67"
FT                   /protein_id="ACV37877.1"
FT                   /translation="MSWKFVLYDWGGLNVALFRAINAGTPEAFAPLAWFFSLIGVGGSL
FT                   DPQKFGGDNADLHTGSHQERLLGYTSPVIKRLVLILLLVVAPLQAAWGVAGGYCPHDER
FT                   SADTQHFGHHVHQHQAADQNDVGDPTATGSDADCFSCHLGCVGVTMSPAPVLSSTPASS
FT                   AVAPPARFPLSVFLQGPERPNWAPAV"
FT   gene            21914..23203
FT                   /locus_tag="CAP2UW1_4546"
FT   CDS_pept        21914..23203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4546"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dar:Daro_2628 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37878"
FT                   /db_xref="GOA:C7RW68"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW68"
FT                   /protein_id="ACV37878.1"
FT                   /translation="MHSNIHRGRVARFITTLILAAATSAVLAAESPLTLAAALQIAEAA
FT                   NPQLRAAQADLAATEGQLADTRGLLWNNPQLTAEQARRKVPLPGQGDDTLREWGADLSQ
FT                   TLEIAGQHGYRRSAAEQDLAALKESIEETRRRVLAEVEQKFVQVLGLQTRATTEAELVS
FT                   LIRDAAGAARKRFAAGEDTKLDSNLAEVELGRADNQLQAAREQLIQARADLAATLQLPA
FT                   EALPEVRGTLAPEVATPYTLDELLAAAADRPRLRALEYQEQAARSRLGLERAAAYPDVT
FT                   VGVFTAREGSSDAREQITGVSVSLPLPLFRRNATGIGRAVTDVSKVQIEREVANRDARA
FT                   TVLALWQKRESLRGRVKQLDQVVLQRLNENKRLSVAGYRAGEISLTQLLLATRQVLDTR
FT                   REVLEAMTDLALVRIELEQAAGWHRQPKGS"
FT   sig_peptide     21914..22000
FT                   /locus_tag="CAP2UW1_4546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 29"
FT   gene            23268..24599
FT                   /locus_tag="CAP2UW1_4547"
FT   CDS_pept        23268..24599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4547"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dar:Daro_2627 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37879"
FT                   /db_xref="GOA:C7RW69"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW69"
FT                   /protein_id="ACV37879.1"
FT                   /translation="MNNLFHVLPAQRAALFALGFSALILGGCGKTESPATAAKAGTAMS
FT                   SAEEQHAAAEKPGEHAASEKAGAHAGEVSKDGDDHGDEHEAGGVEALKLSAEEIQSAGI
FT                   ESAEILVQEVSEPLTLTATIRPNQDRIAHVAPRVPGRIVNVKTNLGDQVKAGQTLAVLD
FT                   SLEVGDAYSAYLQAATQQSVAKADFERAEKLHGDQIIAQKDHLRAHAEYEKSKAALAAA
FT                   RDRLRMLGVDASPTGDGKARSTFPVSTPFAGTVIEKHAILGELSQPDSPLFVVADLSKL
FT                   WIAADLFEKDLGRIQVGASAIVTVAAYPDESFEGTLTYIAAVVDKETRTVQARVEVTNL
FT                   DGRLKPEMFATVAIRTIETTRQGATVKALLVPTEAVVLMNGQPTVFIEDSDGFEPRNVV
FT                   LGQKLRGRLVVKSGLAAGERVVTAGAYALKARIMKSELGAGHGH"
FT   gene            24610..27705
FT                   /locus_tag="CAP2UW1_4548"
FT   CDS_pept        24610..27705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4548"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: dar:Daro_2626 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37880"
FT                   /db_xref="GOA:C7RW70"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW70"
FT                   /protein_id="ACV37880.1"
FT                   /translation="MLNRIVDLSLRYKLLVLLAFVLMAFFGVRAFLNVPVDAFPDVTPN
FT                   QVNVYTESPGLAAEDVEQLLTTPIETAMAGLPGVEQIRSVSLFGLSYVGVYFKDDVDIY
FT                   FARRLVGEKLQEAKERLPAGYGEPSLGPNSSGLGQVFWYTVESADEKLSAMDLRTLHDW
FT                   TVRLMLRTAPGVDDVTTWGGQEKQYQVQINPEKLIKYGLSFKAVMEALAANNRQVGGQY
FT                   INLGQEQYLVRGLGLVANTTDIGNVVIAEREGVPIHVREVAEVKEGPALRFGAVTRDGK
FT                   EVALGIALARINENPKNVVDAVKQKLDLAGQALPPGVSIKPVYDRTELVDKALATAESA
FT                   LVEGSILVAIVLFLFLGEIRSAVVVIATLPLAMLFAFLMMQYFGLSANLMSLAGLAIGI
FT                   GMMVDGAVVMVENAFRLLSHKTGQVVNRTHVMLEAAREVINPIAFAILIIIVVFLPLFS
FT                   LTGLEGKLFKPMAFTITFAMVGSLILTLTLVPVLAALILKPKEEKDTFLVRWIKAGYLP
FT                   VLDWALENKKKVIVASLTLLVSALATFPFLGKEFMPTLQEGAIMFRATGIPSTSLEESI
FT                   RVSQQMNDVLKKEYPQTKMVLATIGRAEKGETADANYMEVLVEVKPQAEWPEKMSIPEL
FT                   SDRMKETLEVALPTVVVGNTQPIQMRVEELISGVRATLALKLYGPDLAELDRLGAESKG
FT                   ILSSVPGVADLSLEANKGKPQLIVKVNREAAARFGINADEILEMVQAGIGGMAVSTLID
FT                   GVRRFDIQVRLDAAFRDTPQAIGNIPVRTSSGAMVPLSRVATVEMDEGYTFVRREQLSR
FT                   YAVLQMDVRGRDVDGFVQEADEKIRSQLKLPEGYWIEWGGAFENQQRAMARLALIVPLT
FT                   IGLIFVLLYTAFNSLTLATLIIANVPFAAIGGVFGLAITGQYVSVPSAIGFIAVFGVAM
FT                   LNGIVLVSFLNNQRGQGLSIRDAVRQGTELRLRPVLMTASVAILGLIPMLLAQGVGAET
FT                   QRPLATVVVGGLLTSTALTLLLLPLMYEWVETRRERRTRTSQ"
FT   sig_peptide     24610..24702
FT                   /locus_tag="CAP2UW1_4548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.568 at
FT                   residue 31"
FT   gene            27717..28142
FT                   /locus_tag="CAP2UW1_4549"
FT   CDS_pept        27717..28142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37881"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW71"
FT                   /protein_id="ACV37881.1"
FT                   /translation="MNTVIAIVGLAALTLTGCAGHTHALAPASGNPSVTVGTFSHEGRE
FT                   APAVVLEVGGRRFTAQGFAIRRDANRSALQQHDSRGRRPSGISPGSDTEHYQYSANPEL
FT                   RAADGAVLRCTLTWPARQAPAGYCEMAEGTRIAVRFE"
FT   sig_peptide     27717..27791
FT                   /locus_tag="CAP2UW1_4549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.901 at
FT                   residue 25"
FT   gene            28182..28508
FT                   /locus_tag="CAP2UW1_4550"
FT   CDS_pept        28182..28508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4550"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   dar:Daro_2625 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37882"
FT                   /db_xref="GOA:C7RW72"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW72"
FT                   /protein_id="ACV37882.1"
FT                   /translation="MKEIKAFIRQHRIANVLQALRDLKAADISYHNITVSQVQRPLVSE
FT                   DPAQQHYAMDLAEAVVSEYKLDLVCTDEVADELIGAITTAAHTGLPDAGWIFVSEVTTA
FT                   IEIR"
FT   gene            28495..29046
FT                   /locus_tag="CAP2UW1_4551"
FT   CDS_pept        28495..29046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37883"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW73"
FT                   /protein_id="ACV37883.1"
FT                   /translation="MKFAESLHNLQLSEASPSSRPYDDQLGVSDHGLTPKAWRNGVITF
FT                   EVVFEVVSTLGVAAIACARPATRAIAGAYLAQKTIGEAIEAYSGFWALDEAYRPVRVEA
FT                   EMIDLQTGRTVWADSETGFSNRRLSRIYTTVTPGERKAQLSVALHEAIIKVVHDFEQSA
FT                   GRHAGPAAAPTSDNRQPSAE"
FT   gene            complement(29021..29155)
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_4552"
FT   gene            29644..30066
FT                   /locus_tag="CAP2UW1_4553"
FT   CDS_pept        29644..30066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4553"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: sus:Acid_1919 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37884"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW74"
FT                   /protein_id="ACV37884.1"
FT                   /translation="MRLVLDTNVIVAAMRSPTGASAALLMAARRGEVTLVANVALALEY
FT                   EATCCRPEHGIAAGLSPAQVSIFLDAVIAMVAPVETHFLWRPLLRDPGDELVLEAAANG
FT                   LASAIVTFNQRDFGTVPLQFGIEVLTPITALRRIRL"
FT   gene            30063..30314
FT                   /locus_tag="CAP2UW1_4554"
FT   CDS_pept        30063..30314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_1920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37885"
FT                   /db_xref="GOA:C7RW75"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW75"
FT                   /protein_id="ACV37885.1"
FT                   /translation="MRNSQSTYPLRLPNSIKAEVVRRAKADGTSLNQFVATAVAEKLAA
FT                   MNTATFFAERRERADFDAFDRIMQRQGGEPPQPDDLIP"
FT   gene            30328..31296
FT                   /locus_tag="CAP2UW1_4555"
FT   CDS_pept        30328..31296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4555"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: nmu:Nmul_B2807 phage
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37886"
FT                   /db_xref="GOA:C7RW76"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW76"
FT                   /protein_id="ACV37886.1"
FT                   /translation="MTTSGLPATLPSASRLLTAEQFQRLADVPPEIEWFANLGNKATRR
FT                   AYENALGDFMKFTGIVKPEEFRTVIRAHVIAWRDDLVQRALSGMTVRHRLAALSSLFES
FT                   LCEKNAVTHNPVKGVKRPPVESYEGKTPALGDHQARKLLDAPDGASLKGKRDRAILATL
FT                   LYHALRRDELCRLTVKDYKHERRGVPHLKVFGKGGKIRYVPLHPAAGGLIGDYLEIAGH
FT                   GADDAGALFRPLRNNCTTGGLERAITPDAVYKLVRQYSTALGFAIGAHALRATAATNAL
FT                   DHQADIAKVQEWLGHANIATTRIYDHRKTRPEDSPTFKVAY"
FT   sig_peptide     30328..30387
FT                   /locus_tag="CAP2UW1_4555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.752 at
FT                   residue 20"
FT   gene            complement(31414..31695)
FT                   /locus_tag="CAP2UW1_4556"
FT   CDS_pept        complement(31414..31695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37887"
FT                   /db_xref="GOA:C7RW77"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW77"
FT                   /protein_id="ACV37887.1"
FT                   /translation="MSNERFASVWDAIEDTPEAAENMKLRSVLLTALKNHLTRTEMSQT
FT                   QAAKLFGVTQPRVSDLMRGKINLFGLDALVNMATAAGLHIEMRVLEAA"
FT   gene            complement(31692..32030)
FT                   /locus_tag="CAP2UW1_4557"
FT   CDS_pept        complement(31692..32030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4557"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   eba:ebB4 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37888"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW78"
FT                   /protein_id="ACV37888.1"
FT                   /translation="MINLKPVEFRGCSLDDLRAFPLAAKREAGHQLDQIQNGQEPDDWK
FT                   PMSAVGQGVREIRIRDAAGAFRIIYVAKFADAVYVLHCFQKKTAKTSKADLGLAAKRYR
FT                   DLLKELNQ"
FT   gene            32297..32950
FT                   /locus_tag="CAP2UW1_4558"
FT   CDS_pept        32297..32950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4558"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   xcv:XCVb0021 plasmid partitioning-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37889"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW79"
FT                   /protein_id="ACV37889.1"
FT                   /translation="MKTIVITSQKGGSGKTTLAAHLAVEAERIGDVPVWLIDTDEQGTL
FT                   SQWHARREQDTPNRAEMPFARIAEGLANMAQRGAAYCFIDTAPTISGQSSAVINMADLV
FT                   LIPVRPSPADLWAVSETVALVKQAGKPFLFVITQAKPQATITAQTIAALSEHGRVAQAF
FT                   IADRVPYAGAMTGGRTAPELAPKSPAADEIARLWLSVKSCFHENIKSVRKVKHG"
FT   gene            32943..33173
FT                   /locus_tag="CAP2UW1_4559"
FT   CDS_pept        32943..33173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37890"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW80"
FT                   /protein_id="ACV37890.1"
FT                   /translation="MAKTVAITAADLSPTKPRQQSITRQRGVTSSAELVPLQFRMPPDF
FT                   VRSFKQAALDRGLKLNELLNECFHEFIKKTG"
FT   gene            complement(33209..34279)
FT                   /locus_tag="CAP2UW1_4560"
FT   CDS_pept        complement(33209..34279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4560"
FT                   /product="plasmid replication initiator protein-like
FT                   protein"
FT                   /note="KEGG: rsq:Rsph17025_4401 plasmid replication
FT                   initiator protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37891"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW81"
FT                   /protein_id="ACV37891.1"
FT                   /translation="MVGDNTNSEVSVGDNTKERSPLLPIRHERDFFVCDVFDAALKGDS
FT                   ASMEHPIFSLSKKPDMKTRRYENGASWAEVRPGAKGLATVFDRDILIYCISQLMAAVND
FT                   SRPVSRTLRLRAHDLLIATNRDTSGRGYLQLREALERLQGTQIATNIITGGKETFDLFS
FT                   LIDRARIVRESREGRMQEIEIVLSDWVFQAVEAHEVLTLDRQYFQLAKPLERRLYELAR
FT                   KHVGQQLSFKIGLEKLRAKCGAQSTLKEFRRLLQTIIDADQLHDHMPGYGFRLDGDMVE
FT                   MRTKSKLPSSTERGVFIRLSEDAYALGRNYAPGWDIHRIEAEWRAWIDRKKISPLHAQA
FT                   HFLAFCKRRGKYPGFS"
FT   gene            34872..35759
FT                   /locus_tag="CAP2UW1_4561"
FT   CDS_pept        34872..35759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37892"
FT                   /db_xref="InterPro:IPR039459"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW82"
FT                   /protein_id="ACV37892.1"
FT                   /translation="MINGKGSADAGEPIAEALRLLDLFASVGAEAFDITHTNLQQEKRG
FT                   FRPGQSLAQARQSMPYLVPSAARRQNNLIIRPRAGADVTLVQLDDLAPDTLAHIAPAAF
FT                   LILRTSPGGQQAWVAVTNAPRGFAARLKEGTGADKEASGATRVAGTANFKPAYAPNFPR
FT                   VRIDAAQPGLNVTTQTLDAMGVVAPARPIPVSLPPVASSSDSRTSKWPSYARCLEGAPI
FT                   GAGGNPKRTSADFIWCKIALSWGHGIEATAERLLEESAKARENGEAYARQTAEHADYAA
FT                   RQRNALPRGRPARG"
FT   gene            36144..36791
FT                   /locus_tag="CAP2UW1_4562"
FT   CDS_pept        36144..36791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37893"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW83"
FT                   /protein_id="ACV37893.1"
FT                   /translation="MAKALVTQERVFEVAQALTDQGTAPTILNVQEGIGGGSYTTVKRY
FT                   LDQWREAAPKQRQPVELPEPAVARLMSLGREFWGLLDEQAGQQVEALRAATREEVAAIQ
FT                   TQLDQAEQAIGRLEAEREQAESHAAAQEQALREAVAARAAQTERMAAAEAKAGELAARV
FT                   EDLKGELERAHARQTAEREATTAARAEAQAAAVEAARLQGELAALKKPRSSA"
FT   gene            37457..37714
FT                   /pseudo
FT                   /locus_tag="CAP2UW1_4563"
FT   gene            37818..38189
FT                   /locus_tag="CAP2UW1_4564"
FT   CDS_pept        37818..38189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4564"
FT                   /product="transposase, IS21 family"
FT                   /note="KEGG: cti:RALTA_p0592 transposase, IS21 family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37894"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW84"
FT                   /protein_id="ACV37894.1"
FT                   /translation="MALSPEIEAQILRYYHAERWRIGTIATQLQVHRDSVARVLAQAGL
FT                   PALEAVRRPSAIDPYLPFILDTLTQFPRLRASRVYDMVKSRGYPGRPDHFRHLIARHRP
FT                   RPKAEAYLGSPQKTENKAR"
FT   gene            complement(38198..38638)
FT                   /locus_tag="CAP2UW1_4565"
FT   CDS_pept        complement(38198..38638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4565"
FT                   /product="Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: shn:Shewana3_4323
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37895"
FT                   /db_xref="GOA:C7RW32"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW32"
FT                   /protein_id="ACV37895.1"
FT                   /translation="MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYGEAH
FT                   IERLQFIRHCRSLDMTLSEIRALLGLRDNPMQDCGEVNTLLEAHIQQVEMRVSALLQLK
FT                   RHLVDLREKCSGSRSVEACGILQGLGNCNCHGESATKSQTSG"
FT   gene            38722..41127
FT                   /locus_tag="CAP2UW1_4566"
FT   CDS_pept        38722..41127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4566"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: sfr:Sfri_3462 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37896"
FT                   /db_xref="GOA:C7RW31"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW31"
FT                   /protein_id="ACV37896.1"
FT                   /translation="MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEE
FT                   ALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLFPVEQALTAIGMQAVRMDQASTGQT
FT                   TKLSITKMDCPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQALG
FT                   FEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVA
FT                   VFTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAK
FT                   SLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAIGSRVRVKPGERIALDGEVLE
FT                   GRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAA
FT                   QGSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCA
FT                   LVISTPVSIVSGLAAAARHGILIKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTW
FT                   GNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAEFSALPGRGVQGQINGE
FT                   TYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRS
FT                   AIAELHALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGM
FT                   VGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDNLGKIPTFVRLSRATAQVLM
FT                   QNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT   gene            41124..42203
FT                   /locus_tag="CAP2UW1_4567"
FT   CDS_pept        41124..42203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CAP2UW1_4567"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   phosphoesterase PA-phosphatase related; peptidase A8 signal
FT                   peptidase II; KEGG: shn:Shewana3_4320 Signal peptidase II.
FT                   Aspartic peptidase. MEROPS family A08"
FT                   /db_xref="EnsemblGenomes-Gn:CAP2UW1_4567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV37897"
FT                   /db_xref="GOA:C7RW30"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C7RW30"
FT                   /protein_id="ACV37897.1"
FT                   /translation="MSWKFFLYDWGGLNIALFQAINMSTPAALEPPVSFFNLVIGNYWT
FT                   APLMLLAMWGWSKSAPDPTRADAIRYRLRVFSVAFALAFLVATILKLWIDFPRPPAVFG
FT                   DMVRVIGGIERHYSLPSGHATYAALVVGALWPLIGRRGRIGLVLYAALVGWSRIAAGMH
FT                   FPADVLAGWVLGLSCTALAGWLMPLAAPVWQSARRTSTWVWFAVAASSVMTDQLAKFAI
FT                   TRTFAYGEQVEVSTFFNIVHVLNPGAAFSFLANAGGWQRYFLMALGLVVSAWLGRMLCQ
FT                   QRPRLEAVGYSLILGGALGNVVDRVLRGSVVDFLDFHWQLVHWPAFNLADVAITIGALC
FT                   LFLTVVPKSSRGTEADVSG"
XX
SQ   Sequence 42325 BP; 8413 A; 13079 C; 12612 G; 8221 T; 0 other;
     gacacccttg aaaggtcaac gcatcgggta cgtgcgggtc agcagcttcg atcagaaccc        60
     ggatcgccag cttgagcagg tccaggtgga caaggtattc accgacaagg cgtcgggcaa       120
     agatacgctg cgcccgcagc tcgacacgct gctgaccttc gtgcgcgaag gcgataccgt       180
     ggtggtgcac agcatggatc gcctggcgcg caacctcgat gacttgcgcc gcctcgtgca       240
     aaagctcacc aagcgcggcg tacgaattga gttcgtcaag gaatgcctga ccttcaccgg       300
     cgaggattcg ccgatggcca atctgatgct gtccgtgatg ggtgcattcg ccgaattcga       360
     gcgtgccctg atccgcgaga ggcagcgcga gggcattgcg ctggctaagc agcgcggtgc       420
     ctaccggggc cgcaagaaag ccctgtcgcc agagcgtgcg gccgagttac gtcaacgggc       480
     cgacgcaggc gaacaaaagt cgaaactggc gcgcgagttc ggcgtcagtc gggagaccct       540
     gtatcaatac ttgagaacgg atcagtaaat atgcctcgtc gttccatcct gtccgccgcc       600
     gagcgggaaa gcctgctggc gttgccggac accaaggacg atttgatccg gcattactcg       660
     ctcagtgata gtgacctttc gatcatccgg cagcggcgcg ggcctgcgaa ccggttgggc       720
     ttcgcggtgc agctttgcta cctgcgcttt cccggcattc tccttggcgt cgatcagccg       780
     ctgttcctgc ccttgctgaa actggtcgcc gaccagctca aggtcggtgt tgaaagctgg       840
     aacgactacg ggcagcggga acagacccgg cgcgagcacc tggtcgaact gcaaacggtg       900
     ttcggcttcc agccgttcac catgagccat taccgacagg ccgtccacac gctgaccgag       960
     ctggccatgc agaccgacaa aggcatcgtg ctggccagcg ccttgattga gcaactgcgg      1020
     cggcagtcga tcatcctgcc cgcgctcaac gccatcgagc gcgccagtgc tgaggccatc      1080
     actcgcgcca accgacgcat ctatgaagcc ctgtccgagc cgctgtcgaa cggacaccgg      1140
     catcgcctcg acgatctgct gaaacgccgc gacaacggca agatgacctg gctggcctgg      1200
     ctgcgtcagt cgcctgtcaa accgaactcc cgccacatgc tcgaacacat tgagcgcctc      1260
     aaagcctggc aggccctcga cctgccttct ggcatcgagc ggctggttca ccagaaccgg      1320
     ctgctcaaaa tcgcccgcga gggcggccag atgacgcccg ccgacctggc caagttcgag      1380
     ccgcggcggc gctacgccac cctcgtggcg ctggccatcg aaggcatggc caccgtcacc      1440
     gacgaaatca tcgacttgca cgaccgcatc ctggggaagc tgttcaacgc cgccaagaac      1500
     aagcatcagc agcagttcca ggcttctggt aaagccatca acgccaaggt gcgactgtac      1560
     gggcgcatcg gtcaggcgct gatcgacgcc aaacagtcag gccgcgaccc gttcgcggcc      1620
     attgaggccg tcatgtcctg ggacgctttc gccgagagcg tcaccgaggc gcaaaagctc      1680
     gcgcagcccg atgacttcga cttcctgcat cgcatcggcg agagttacgc caccttgcgc      1740
     cgctacgcgc cggaattcct tgccgtgctc aagctgcggg ccgcgcccgc cgccaagggt      1800
     gtgcttgatg ccatcgaggt gctgcgcggt atgaacaccg acaacgcccg caaggtgcca      1860
     accgatgccc cgaccgactt catcaagccg cgctggcaga aactggtgat gaccgacgct      1920
     ggtatcgaca gacgctacta cgaactgtgc gccctgtcgg aactcaagaa ctcccttcgc      1980
     tcgggcgaca tttgggtgca gggttcgcgc cagttcaagg acttcgagga ctacctggtg      2040
     ccgcccgata agttcaccag cctcaagcag tccagcacat tgccgctggc cgttgtcacc      2100
     gactgcgacc aatatctgca cgaccggctg accctactgg aaacgcagct tgccaccgtc      2160
     aaccgcatgg cggcggccaa cgatctgccc gatgccatca tcaccgagtc cggcttgaaa      2220
     atcacgccgc tggatgcggc ggtgcccgac accgcgcagg cgctgatcga ccagacggcc      2280
     atgatcctgc cacacgtcaa gatcaccgaa ttgctgctcg aagtcgatga gtggacgggc      2340
     ttcacccgcc acttcacgca cctgaaatcg ggcgatctgg ccaaggacaa aaacttgctg      2400
     ctaacgacga tcctggccga cgcaatcaac ctgggcctga cgaagatggc tgagtcctgt      2460
     cccggcacga cctacgccaa gctcgcctgg ttgcaagcct ggcatacccg cgacgaaacc      2520
     tattcgacgg cgctggctga attggtgaac gcccaattcc ggcatccctt cgccgagcat      2580
     tggggcgacg gcaccacgtc atcatcggac ggccagaact tccgcaccgg cagcaaggcc      2640
     gagagtaccg gccacatcaa cccgaaatat ggcagcagcc caggacggac gttctacacc      2700
     cacatctccg accagtacgc gccgttccac accaaggtgg taaatgtcgg cgtgcgcgac      2760
     tccacctatg tgctcgatgg cctgctgtac cacgagtccg acctgcgcat cgaagaacac      2820
     tacaccgaca cggcgggctt caccgatcat gtctttgctc tgatgcacct cttgggcttc      2880
     cgcttcgcgc cgcgcatccg cgatttggga gacaccaagc tctacatttc caagggcgaa      2940
     accgcctatg acgcgctcaa gccgatgatc ggcggcacgc tcaacatcaa gcatgtccgc      3000
     gcccattggg acgaaatttt gcggctggcc acctcgatca agcagggcac ggtgacggcc      3060
     tcgctgatgc tcaggaagct cggcagttac ccgcgccaga acggcctggc cgtcgccctg      3120
     cgcgagttgg gccgcatcga gcgcacgctg ttcatcctcg actggctgca aagcgtcgag      3180
     ctgcgccgcc gtgtgcatgc cgggttgaac aagggcgaag cccgcaacgc actggcccgg      3240
     gccgtgttct tcaaccgctt gggcgaaatc cgcgaccgca gtttcgagca gcagcgctat      3300
     cgggccagcg gcctcaacct ggtgacggcg gccgttgtgc tgtggaacac ggtctatctg      3360
     gagcgcgcag cgcaagcgtt acgtggcaat ggccatactg tcgataacgc gttgttgcag      3420
     tacctgtcgc cgctcggctg ggaacacatc aacctgaccg gcgactacct ctggcgcagc      3480
     agcgccaaga tcggcgcggg caagttcagg ccgctacgac cattgcaacc ggcttagcgt      3540
     gctttatttt ccgttttctg agacgacccc tacctgcgac tgcgcacctt gccgggcgaa      3600
     cagatgcagg tcgactgggg tcactttggc cacctggaaa tcggtcgagc acgccggccg      3660
     ctgatgggct tcgtggctgt cctctcctgg tcgcggcaga tcttcctgcg cttctacctc      3720
     ggcgcctaca tggagaactt cctgcgtggc catgtcggtg cgctgaccgc ctggggcggc      3780
     tgcccgcggg tcgccctgta cgacaatctc aagagcgcgg tccttgagcg ccagggctcg      3840
     gtcatccgtt ttcacccgac actgctggcc ctgtcgggtc actaccgctt cgagccgcgc      3900
     cccgtggcgg tggcgcgggg gaatgagaaa ggccgcgtcg agagggccgt tcgttttatc      3960
     cgcgatgcgt tcttcgccgg ccgccgcttc acggatgtgg acgatttgaa tgcgcaggcc      4020
     gacgcctggg tcatcgggcc tgccggggag cgacgctgcc cggaggacga ggcgctgacg      4080
     gtccatgagg ctttcgagca ggagcgaaca cgcctgctga cgctaccggg gaacgccttc      4140
     ccgaccgacg aggtcaaggc cgtctgcgcc ggcaagacgc cgtacgtgcg cttcgacctg      4200
     aatgactact cgatcccgca tacctgcgtg gcacgcacgc tcagcgtcgt tgccagtctg      4260
     gatcaggtac gcatccttga tggccagacc gtggtcgcaa cccatcggcg cagttatgac      4320
     cgccggcaac aaatcgaaat ccccgaacac atcgcgaccc tggtcgcgca taagcatcaa      4380
     gccgccgcgc atcgtggcac cgatcatctg gtgcaggcgg tgccgacgag ccgcgagctg      4440
     ctcacgcaag cggttgaacg cggcgaaccg ctgggacgca cggtgcgcgc gctgaccgaa      4500
     ctgctggaag cttacggcgt ggccgaactg acggcggcga ttgccgacgc gttggggcgc      4560
     ggcgtgccgc atccgaatgc ggttcgcctg gccctggaga agcgccggca ggcgaaggcg      4620
     gcaccgccgc cgttggcggt gcctttgccg gagcatgtga agcggcggga tgtccgggtt      4680
     cgcccgcaca ggctcgatga ctacgatcag ttgatgggag gttctccgga tgacgaatga      4740
     tgcccgccgc caacgcgcgg ccgctttgca gttgcacggg atcctcgcgc actgggccga      4800
     gtgtgcggag cagccctggc tggatccttt gctgtcctgg gaagaaagcg aacgtgcccg      4860
     ccgctcgctc gaacggcggc tgcgctgtgc ccatatcggg cgcttcaagc cgctggccga      4920
     tttcgactgg acctggccgc agcagtgtga tcagcgggcg atcgcggaac tgatgacgct      4980
     ggacttcgta ccggcggcca ccaatgtcct cctggtcggc agcagcggcc tgggcaagac      5040
     gatgatcgcc cagaacattg cgcatcaggc gatcctggag gggcacacgg tattgtttgc      5100
     gacggccggg cagctgctcg gtgatctggc tggcctggac agtgattcgg ccctacgcta      5160
     ccgcttgcgt cgttatgcgg cgccagattt gctggtcatc gatgaggtcg gctacctgtc      5220
     ttactcgaac cgtcatgcgg acttgctctt cgagttgatc aaccggcgtc acgagaagaa      5280
     gagcactttg atcacgacca ataaatcatt ctcagaatgg ccggaggtct ttcccaacgc      5340
     cggttgcgtg gtggcgatga tcgaccgcct ggtccatcac gccgagattc tcgccatcaa      5400
     gggagaatcc taccggcgca aagaggccca ggaacaggcc gctgccagat ccaggaagcg      5460
     cacggcgaag gcggcgacgt gaagctcact catcaacctt ccggtttgca cgatggtctc      5520
     gacctgctca tcgattcgcg ctggtcgccg gaccaggcgc tggcggtcat cgagctgctt      5580
     gatgatttac gcgatcgaat ctgggcgcac tacgaggtcg ctttgcagac ccggttccgc      5640
     gagcagcggg tgacctgctg cgacgtcgag actaccgatc cgccgttcta agccaacgtc      5700
     acacgatcaa gactcagggg gccgccgggc ccctgtttcg ttcacgtcac accgctcacg      5760
     tcgccgccaa attccgccgc catttaatgc cgccagattt ctgcggatgt acgcagccgc      5820
     taacaacggt gcagtaacgg tagaacaacg gtaaaaaaag gtagaacaac gataaaacaa      5880
     cgcacggtgt cgttctattt ctggtgtaac aacgctgtag ggccgggcag gatatgtgaa      5940
     gtaggcccac ccgcaggcgg gtcgtccttc ttcacgaagc ccttattcgc actgcgtgct      6000
     caacggacat cctgctctgc gaggcagccg gctatcgccg ccacaagggg tagaacaagc      6060
     aagccgtgtc accagccgcc atttcgtagt cggaaaacgc cggagacaaa gtttccggcc      6120
     atccgaccta tcagacacgg tttccccgtg cagctttcgc cctgtcgaga ccatcgtttg      6180
     cgccgctttg ccgtccgggg ggtgggaaac aggtgttttc cgacatccgg ccaaagcgca      6240
     agggatgcgt cctggcgtct cgtgggctac aatgtagctc aataacttgg aggatcagat      6300
     catgtccgca aatgccgttg tccgtgccag aatcgacgag cacattaagg aagaggcgac      6360
     cgccgtgctt gcggcgatgg ggctgaccgt gtcggacgcc ttccgcatca tgctgacccg      6420
     cgtcgcccgc gagaaggcac tgccgttcga gccactggtt ccgaacgtcg aaaccatcga      6480
     ggcgatgaag gaagcgcgca atggtggcct gaagtcgttc gccaccgtcg aggatctgat      6540
     ggcggacctg aatgcggaag attgaacaca ctggccagtt caagcgtgac tacaagcgcg      6600
     aaaccaaggg accgcaccgg caaacgctgc aaagtgactt cgtcgccatc gtcacggcct      6660
     tggcccatga tcaggttctg gccgacaagc accacgatca ttcgctcagt ggggattgga      6720
     aggaccaccg ggattgtcac gtcaagcccg acttggtctt gatttacaga aaaccggacg      6780
     acaacgtact ccagctcgtc cgtctcggtt cgcacagcga acttggcctg tgagcagccg      6840
     ggctccgtga caaggaaatg aaggatacgg cgagcggaat caccgatgtg gaacgggtac      6900
     tacacgttcc aaagcgacgg cacggtgatc gacctggacc tggatacgct cgtggcaggg      6960
     ccggcgtggg gatgacggaa ttttcggcgg ttccggctta caaccccagc caggtcgctt      7020
     ctctattcga gctggccagc gatctggatg aacaggtttc ccacatgatg accaatctgg      7080
     aagaggtgca ggcaacgcta tcgcaattga cggcgctgta cccggacagc ttgagctgtg      7140
     gaggcctgga cggcgacgaa tgatggctgg ccgctcctac tctggcccat taagcgtcag      7200
     gtcgccacgg cggatcgcat cgccaagcac aagggacgca atccgcagga atgcgcctcc      7260
     ctgaaaaagt gcctgccacg caagtggatg agcaaatgaa gcgctggctt actccaaggt      7320
     ggcggctggt gacacaactg ctcgttccac tccagattga cggaattttc tggggttccg      7380
     gcttacaacc ccttcgtgat tgacgaccag cttaatcgaa gcggacggca atgcgcgtcc      7440
     cctcgcgcgt ttcgcaatag cccgccggtg cctggcgggc gggccaggtc agggtgcatc      7500
     gcagcaccgc gccatccgtg gcacgcaatt ctggcgtggc cgagtactcg tagtgttcgg      7560
     ggttgcttcc agccgatacc cagctgggac gcatgctgcg cctatcgtgc tgttgcaagg      7620
     ccgcgatgtt tgcgtcgcgg cgtatcgcaa agccctgggc cgcaaaacgc tgtcccttga      7680
     attccaggac cattgcaggc ccctcacgcc cctcgtgagt gaaggtgccg attgtggcct      7740
     ctgggtttcc actttccggc gcgagatcat gcgtatgtcc cacgcaaccg gtgagcgcaa      7800
     gcacggccag acctgcgata gcgaacactg tcttcatcgt tgtctttctc aaggggaagt      7860
     tacggtgcgg cgctctcggc gcgcttcgac ccactcatac atgagcggca gtaggagcag      7920
     tgtcagggcc gtcgatgtca gcagaccacc gacaaccacg gtcgccagcg gccgttgcgt      7980
     ttccgctccg ataccctgcg agagcagcac tcatgacgca taactcgaag aggtgttcat      8040
     cgttcgtacg ccctaagcct atggttacgg tattttgcat gttgcatctt tcaatcatcg      8100
     acggagcttc aaaagtacgc aaaaaattct tctggcgaag tgaagacacg gactggctag      8160
     tcatgctcca agccccaaat caagtgcgcg tcgatgagca gcccgtaata ggccttcagg      8220
     gcgatgactt gcgcttgcaa ggcgttgttc accgcagccg tcgcttggcg acgcgtcagc      8280
     agaaaagctt gtagctccgc ttcgccgagc gcataagccc gctgcatcag acgggcgttc      8340
     tcttgcatag ccgccgcgcc ttcgttggcg atctgaaagc tctcgtagcc accgcgcgca      8400
     gtcgccacgg cgcttgcaat ccctgcctga agctggcgct gtttgagttc ggcttcctgg      8460
     cgcgaaacct caactgccgc aatcgcctgt gcactgcgca agtcacgcgc gcctcccgga      8520
     atcggaatgc tgattgtgac tccgggaatg cgctcgcggc cgccgatctc cgaagccgta      8580
     tagaccccga acgttggatc aggaatcttc tccgcacgtg ctcgttctgc ctgcgcttgc      8640
     gctttccgga cttgcgcttg cacaagcttc agtgcatgcg tttcagccag gatgcgctcc      8700
     tgccaagatg gcgcctcgct cccaagcacc aacggctcgg gcagagccaa gagctgacgc      8760
     tcgacgccag gaaagcgggt ggatagacgt aaccaggctg cggcagcctg cgtctttgcg      8820
     tcattgtcca tgcgtcgttg ctcggccagt tcggcgcggg taatgcccag gtccaatttc      8880
     gaggcatcgc cggcgcgagc gcgtttctcc acggccgcga gactggcttg catcgactga      8940
     aggctgctcc cacccagctc gcgagcgcgt tccgccgcca gccagtccac ccacaattcc      9000
     atcagttcac gagccgatgt gagcaaagcc tcgccatagc gcgcccgaga ctcgtcgacg      9060
     gttgccttgc cgatactgcg atcggctgtg gctttgccgg gaagccgaat ggtcttctcg      9120
     acacctacga accattcgtt gtagcgggga ccgttttcca ctctgcgctg ctgcccatca      9180
     acgcgagcgg tccactcata cggagattga tcgagaatgc tcgcctcttg cagagccacg      9240
     tccaagcctg cccgcgccgc ggcgacgccc gggtcctgct cgaataaagg gcgcgcaatt      9300
     gcggttggca tgagccccgg cggattcatt ggctgcgccg cagatgcggc cttgactacg      9360
     gcgaagatgc cgatcaagag caatctaacc atcatgcgat ttctcccgct tcgacgactg      9420
     gggtcaccca gtagcgcagc cccacgccgg agaattgctg acgcagcgct gcaagcagcg      9480
     ccgcttgacc agccgccgca cagatcacct gcacctccgt ggctcgcgcc cgacccagca      9540
     cctgttctgt ctgatccaga gactcgtggg ccagaccgtg cgcggctgtc gctgtactgg      9600
     tgaagatcgt cgcaccgggc cacaggagca gcagatcgag tagtttttct tcgacctctg      9660
     gcggacacac cagcgtcaag caaagttcag acatggggaa cctctcgtct tgggaaagca      9720
     aagcgcaaat acaggatggg caacagcatc agcgtcagca ccgtggcggt ggtcaggcca      9780
     ccgatcacga caatggcaag cggccgctgg atttccgagc ccggcccgct ggcaaagagc      9840
     agcgggatca atccgaacgc cgtaattgag gcggtcatca gtaccgggcg caaacgccgc      9900
     ttcgcgccct gaacaacgac atcgctcaat ttcatccctt cgctgtgcaa ttgattgaaa      9960
     tagctaacca gcacgactcc gttcaagacc gcgataccga gcagcgcgat gaagcccacc     10020
     gacgctggca ccgacaggta ttctcccgtc acccacaagg cgacgatacc gccgaccagg     10080
     gcaaatggga cgttgctcag gatgagcaaa gcctggcgca ccgagcggaa ggtcgaaaac     10140
     agcaggacga agaccaggcc aagtgcgacc ggaactacca ccgccaaacg cgcagccgcg     10200
     cgctgctggt tctcgaactg ccccccccag gtgatgcggt agccggtagg cagggacaac     10260
     ttttccgtga cgagcgctct ggcctcttca acgaagccaa ccagatcgcg gccaccgacg     10320
     ttggcgatga ccacgctata acggctgccc atttcccgat cgatcttgac cggccctgcc     10380
     gcccgttgca gcttggcgac gctggtcaat ggcaccgtgc tgccgccctg cgtcgtgatc     10440
     cgcatggcgc caaattcagc cggcgacata cgaaccgcct cggtgccgcg caatacgatg     10500
     ggtgtgcggc ggttaccttc gatcacgatg ccggcccgct gcccctcgat ctgcgtgcgc     10560
     agcgcgtcct ggatctcttc cacgctcaaa ccaaggctac ctgcctgcag gcggtcaacc     10620
     accacctgca agtactgcac accatcgttc tggacggtgt agacgtcttg attccccggg     10680
     accgtcttga gaagtgcttc gacctcgctc gcatacgtat tgagctggtc gagatcaggc     10740
     ccgaatatct tcactgccag atcgccgcgc acgccgataa tcatttccga gacgcgcatt     10800
     tcaatgggtt gtgtgaagct gtaggagata ccaggcatgg ggtcgagcac tttgcgtatc     10860
     tcgtccatca gtgcttcctt actcttcatg cgccagtggt ctcgcggctt caacacgagg     10920
     taggtgtcgg tctggttgag ccccatcggg tcgaggccaa tttcgtcaga gccggcacgt     10980
     gcaacgatgc cggtgacctc tgggatggcc ttcatgaggg cctggtgaat cttcagatcg     11040
     agagcggcgc tttgttccag gctgatggag ggcaatttct cgataccgac gatcaaatcg     11100
     ccttcgtcca tcgtcggcat gaaggtcttg ccaacctggg tgtacacccc gcccgctccc     11160
     agcagtagca gcactgccac gccgacgacg ataccctgcc gtcgcagtcc ccaggctagg     11220
     gccggctcat agagtgccag caatttgcgt ggcaaccacg gatcctcatg cttgacctcg     11280
     cgcagcaaat acgacgccag caccggaatg acggttagcg aaagcagcag cgacccggcc     11340
     agggcaaaga cgatggtcag tgccaccggc acgaagaact tgccttccag atcctgtagc     11400
     gtcagaagcg gcagaaagac ggtaatgatg atcaggatcc cggacgagac cggaaccgca     11460
     acctcgcgca ctgcgcgata gatggtatgc aagcgcggca gcttgccggc cgtcgggtcg     11520
     gtcgccaggc gctgtacgat gttttcgacc accaccactg ccgcgtcgag caacatgccg     11580
     atagcaattg cgaggcctcc cagactcatc aggttggccg acataccgaa gccgcgcatc     11640
     aggataaagg tgatcagtgc cgccagaggc agtactagag ccacggtcac ggccgcgcgg     11700
     atattgccca ggaacagccc cagcaaaatg atgaccagga ctgacgcctc gagcagcgct     11760
     gccgagaccg caccgaccgc cttgctgacg agggaggcgc gatcgtagaa aacgccgagc     11820
     tgcacatctt tcgggagcgt tggttgcagt tcatccagtt tcttgcgcac gccttcaacg     11880
     actttttgcg cattggcacc tgccagtccc agcaccagtc cctggacggc ttcggctttg     11940
     ccatcttgcg tcaccacacc atagcgcgtg acagtgccga tcttgacctc ggccaggttg     12000
     cccagacgaa ccggcgaatc gtccttgatc gtcaccacga tcgcacgcag gtcgtccagg     12060
     ctcgtgacac ttccttcgct gcgcaccagc aatacttcgt cgccttcgcc caaccggccc     12120
     gcgccatcgt tgcggttatt ggcgtcaatc gcctccttca actgggccac cgtcacgccg     12180
     ctggcagcca tcttgatctg atcgggcaca acctcgaagg cgcgaacgac gccacccagc     12240
     gcattcacgt cggcgacgcc aggcactgtg cgcaacgctg gccggatgac ccaatccagg     12300
     aggctgcgcc gttcggccag cgacaagcca tcggcgtcga cggtgaacat gaacatttcc     12360
     cccagcgggg tagtgatcgg cgccattccg cccgtgatgc cggccggcag actgtccgtc     12420
     aggccgccca ggcgttcact cacctgctgg cgcgcccagt agatgtcggt accgtcctcg     12480
     aagtcgatgg ttacgtcgac caggccgtac ttggtgaccg agcgcaggat tttggttttc     12540
     gggatgccga gcatttctac ttcgatcggc accgcgattc ggctttcgac ctcctccggg     12600
     gtcatgccgg gggccttcat gatgattttg acctgcgtgc tcgacacatc ggggaatgca     12660
     tcaatcggca agccgaggta ggccatccat cccgcaccag cgacaatcag cgtcgccaac     12720
     aagacgaaca ggcgctgcga cagggaaagc tgaacgagac gagcaagcat cacttgctct     12780
     ccttcgcgtc gagccaggcg cccttgagtg ctaccacgcc gctgatggcg atctgttcac     12840
     cttctttgag cgggccttgt acgcgcacac gctgaccagc gctaaccaca accttcacgg     12900
     gtctggcttc gaaaccgtcc gcggtgcgga cgaggaggta agcttgttcg ccgtcatgaa     12960
     ccaccgcgga caagggcaca tcccaattgc cttgagtagc ggtgattggc agttcgacag     13020
     ttaccaactc gccgggtcga acctcgccgg tcttgccttc gacggctgcc cgcagtacta     13080
     ctgtctgact gccgtgggag acggtcgggc ttacgctcaa gattcgcgcc gtgaggctgc     13140
     ggccgagcac ttttacctgg gttccggctg gccagcccac acgttccgac accggaagct     13200
     gaatatcgag ccacagagag tccgtttgag ccacgtgcaa caaagccgtc gctgcctcga     13260
     ctcgctggcc aggtttgacc gcgataacgg tgacgatccc ggcctgcgtc gcgagcagag     13320
     tcacgctgtc ttggggcttg ccagacgtcg caatgcgctc gatcgtcgcg gacggcatgc     13380
     cgcttagacg cagcgctgcc ttggcctgat tgagcgtggc ttcggcttcc tgcagcgccg     13440
     ctcgcgcttc ctgcactcga cgtttggcaa taattccttc atcaaacaaa gcgtgctcgc     13500
     gctgcgccgc ttgccgtgca agggtggcgc gaacggttgc ttgtaacaac tgcagctgca     13560
     actggcccag ttcgggactg acgatgcgca ccagtggtgc gcctgaaggc acgacctggt     13620
     tttgctgcac cagcaattgc gctactaggc cggcgacggg cgaactgatc acctgttccg     13680
     cttctggcgg caccacgaca tgtgcgggat aactcgcctt taccaagtcg gtatcattct     13740
     gcaatggcgt ggtttgaatg cccaacgcct gaatctggct gtttggaacg gtgaattttg     13800
     ctggccggtc ggctgcctgc gtggtagccg tgaggatgca catcacggcc attgcccatg     13860
     cgcttcccgc cgggaagggg gagctgcttg ttttcattat caacctcttt atagcgtctg     13920
     ccgacacaac aagcgtgacc acgccgctcg tcgagccagg ggaaagacaa acctgcggaa     13980
     ctccgcgagc gacgcggagt taaacgaggg atgcgctacg gggaggtcgg aaagggggct     14040
     cgagttctgc cgggagcaga gtgagggcgc tcggtagcac gatggctgtc cgagcaggcg     14100
     gctcagcaag gtgactgaca gccgaattgg gaaatagctc gcagtggctc aaggcgtgca     14160
     acagttcatg ttcggcatcg ttcgatggtt cggcggccgg attgctcttg gcatcaagcc     14220
     gcggcgcgtg atcgtgattg atcgacgcgg tgcgcgtttg gcgatcgtga tcaagttcgt     14280
     gtgaaaaccg cttcaagttg aagccatagg cgccgacgct catcacaaaa aaaaggatga     14340
     gcattagtag ccgtatggtt tttcgatgcg gcctgtgcat tacagatact ttatgatttt     14400
     tctgaagtca tcgagtgcag ccgaactgcc tgggcgcagc gtgatcggtg gtgggtccga     14460
     gacaatgatt gaggtggtca tgcgcgaggg tctttttccg cagtgagcat cttctcaaca     14520
     gcgtgcaact gctgcgagac actcagacaa cagcggccag cttccatcat tccgccatga     14580
     tctgcaagtg gccttcgact ttctctagcc gcttgttgat acacgagtgc gatggatgaa     14640
     ttgctccttc tttcatggcg gcatcttatc ctgggagggg tacattctgt ctaatggaga     14700
     ggtggctcat atcttccaac agcagcctac tcgtcaggcc agcgcttgca ggccttggta     14760
     gccaacataa agaccaacga gaaggatgag cgcagcagag aaatacggtg ctctccgcgc     14820
     aaacttgccg aaaccgctcc agcgcctgga aacgtgtttc acgctcaagg ctgccaaggc     14880
     gccagaaagc accatcgtca aggccaggcc gatactgaag ctcagcacca gcgtcgcacc     14940
     gagcgcgatc tccttcagtt gcaagcacag caacagcacg gtaatcgagg cgggacaggg     15000
     aatcagcccg ccagtcaacc cgaacatcac gatctgcccg gtcgtcactt cccgattggt     15060
     gaaacggtgg cggatatcgt tggcatgcgc cagttcgtgc ggatcctggt atccgggagc     15120
     tgacacatcc agcccttcgt agtccttgat ggcgtggtgc tggtggtcgt gctcgacgaa     15180
     ctcgacatca tagtcgtggc tgtggtgctc atgacccagg cgcagacgag ccacgaattc     15240
     gtgtggctct tgaatttcct gctccgactc cacaaagccg tcgcgctgca cgaaccggaa     15300
     tgactggcgg ctaccgtctg gtcgttcggt ttcgatcctc acctgatcgg ctgtccaggt     15360
     gtggccgtgc ccgctttctg cgaacaagcg gaagcgcggc ggcacgccgt cctcgaacac     15420
     atccaggcgt accacgccgt gaccggtatc gatgcgtttg ctgtcgtcat gatgatgatc     15480
     gtgatcgtgg tcctgctcgg caagctgctg ttgtcgccag ttccgccaga tcatccagag     15540
     agcaacgccg atgatcacca aggcggacgc cacctgcaga tagggctcac tggtttccgc     15600
     gtcccatttc tggccgaagt acatgccgcc aagcgcgatc acccacacca cagctgtgtg     15660
     tgaaatcgtc gccgacaccc cgagcagaac ggcttgcccc accgtgccac gaatcgccac     15720
     aatgaaagcg gccatcatgg tcttggagtg gcctggttcg aggccgtgca ggccgccgag     15780
     caagatcgca ctcgggataa acagccaggc gtttcccgcg ccctgcgcca gcagggtgga     15840
     aaaactggtc atcgtgtttc cttcagagat atttggtgat ggctttgaac tcgcggatag     15900
     tctcttccgc gctttgcggc gcgtcgcgca ctgcttgttc aaggcagtgg tcgatgtggt     15960
     cgtgcaccag cgtcttcttg gcattgccga ctgcgctttc gacggcctgc agttgctggg     16020
     cgatcgccag acagtcacgg ctgtcctcaa gcatggtgat ggtgctcctg aggtggcctt     16080
     cagcccgttt caggcgcttg atgatctctg gatgggaagt gtgcgtgctc atacctcgta     16140
     tcctatccag ggggatagga tacgtcaagc cattaaaagg ccccaaatcc cgcgattgaa     16200
     aacctcgccg gccggttgcc ggggctcttg cccatgctga aggcgcgcga agtgcgagag     16260
     gggccacgca agaggcggcg gcagttcgca gagtacgcaa aagcggaggg gtggatcccg     16320
     atagcatagt ggtggcacga gttctggacg aacggttcct cgcgcagtgc tgcacggagg     16380
     agtcttgccg gggtgccgag cggaagcggc tatggagaat ttgccacggg ctgcgcgaag     16440
     ctgcgggtgc ggatgctgtg gaacaagtcg acgctatctg tagcgacgca aaatgatgtc     16500
     ggccaagaca cacaatcaag ggggcgttct gacgcaaatt agttgagacg gatagcgact     16560
     ccagacgcac attcggtgat tctcaaacca cattacgtga gacgaacgca cattgttgag     16620
     acgctcaatc gcgttcgcgg tgcggatggt cacagtggca gtcccgctgc ccgcatctcc     16680
     tcgattagtt ccgtcgatcg ctgcgaattc agcagggctt ggccgtcgag tctatcggca     16740
     ccaggcgctc cggatgtcgt atcggcaagg ccgctaatct gcggcgcgag gccacgatcg     16800
     cctccatcgg aacggcggca ccggcgccca ctatgcgctc cgctggacag tggataccgt     16860
     gtctggtgat tcgtcgcccg tttcggtgcg cagcaaagca gtaccagcgg ctttcggaga     16920
     accatcaccg ttgacgtagc tgtaaagcgt ggtcgtcgtg atgcccaagc gcttggcgac     16980
     gtcggcagta actgcctttg gatccgacag ggctgccatc gccatggtca gcattgctcg     17040
     atccatcttg cgcggacgcc cacccaagcg cccacgagca cgtgccgccg cgagacccgc     17100
     ctgggtgcgc tcggcgatca gttcgcgctc gaattcggcg aaggctgcaa agatgccgaa     17160
     ggccagtcgt ccattggcgg tggtggtgtc aatctgcgcc ccggcgccgg tcagtacctt     17220
     caagccgatg ccccgcacgc gcaagtcttc ggcggtgttg accaggtgtc gaagatcacg     17280
     ccccaggcga tccaatttcc agaggacgag cgtgttaccg ggctgaagcg ccttgaggca     17340
     agcgatcaag ccaggacgcg cgtcattgcg ccctgaagcc aggtcttcat agatgcgctc     17400
     agggtctacg cccgcaacaa gcagtgcatt gcgctgcgga gctaccgtct gggagccatc     17460
     ggacttcgat accctggcgt aaccgattag cagaacttct tcgctccgtc aggaaacaag     17520
     gagcatagga tgcaatcttg tgttgatttt agcaacgagt tttctggtga cccgtcggag     17580
     caaaaagctg ccgcctgctg cccaccagaa aaccggccgt tttcttggcg agctacactg     17640
     tgaaatggcg ggtgtgagcc ccccgagccg cgtaggaaag tcgaaattca tccagacgtt     17700
     cggtaccaat atttcgtgag cccgccgctt tgaccgtctg tgccgcgaac gcggtcgagt     17760
     gtctcaacaa tgtgcgtccg tctcacgtaa tgtggtttga gaatcaccga atgtgcgtct     17820
     ggagtcgcta tccgtctcaa ctaatttgcg tcagaaagcc ctcttgattg cgcgtctggg     17880
     ccgacatcat tttgcgtcgc tacagctagg ggacgtctca gaaaacggaa aatagagcac     17940
     gctaagcctt ttcgccgcgc catgacgcaa acagcccgcg caaaggcggg ctgtcgatgg     18000
     tgccggggaa agcctggaac tacccgcaac tcctgttctg cgcctgaatc ggtgggcatt     18060
     ttaccgagcc gaaggaacag aatacgcaac agtcgccgga gttggggcgc agcaggttct     18120
     tgcagttgcg gcactcgtag tagaactggc aagcgtcagt cgacatggtt tcctgctggg     18180
     cgaatccaca gtgtgggggt agaacaagca gccgtgtcac cagccgccat ttgaggaatc     18240
     agctcacgaa acgggaaaaa gttgtacgcc aagacctcga ttagccgagg tgcgtatgcc     18300
     ttttatgccg aggttctgtt tccatagacg ccagcccctg caagattcca caggcgtcca     18360
     tggcctgctc gctctggcag cgctgacgta gctcactgag ctgctgcttg agctgagaca     18420
     gctcggccat acgcacatcg acgtgggcaa tgtgttcgtc cagtagttga ttgacgccac     18480
     cgcaatcacc ggcaggctga tccatcaaac ccagtagcgt gcggatttcc gcatgcgtca     18540
     tatccagggc acgacaattc cgtataaagc gaagccgctc gacgtggaac tcgccatagc     18600
     tgcggtagtt ggcccgcgtc cgtgccggcg cggatagcag tccttccttt tcgtagtaac     18660
     gcacggtttc caccgtgcat tgcgccactt gggcgagttc accgatcttc acgggtagtc     18720
     tccaaaacac ttgaccctat agtaacttca gggtgtgaaa tggacaatat accaacaatt     18780
     ggacgacgcc atgccctctc gccccgtgaa aattacgcat gttcaccacg catgcggcga     18840
     cgatcagtct catgctcacg gcgctttgcc cgctcatcac gatcatgggc attcgcacga     18900
     ccatggtcat gagtgtggcg ctgccgatcc gtcaccaaca ccgccatcag gcaacgccag     18960
     tcttgtcaca gccaaaattc cggccggcta cacactcact cggttacgcg tcgcacagat     19020
     ggattgcccg accgaggagg cgttgatccg caacaagctg ggtggcctag ccacggtgag     19080
     cgggatggaa ttcaacctca tgcagcgggt cctgaccgtt gtccaccaga acaacacgct     19140
     agctgccgtt gagacggcca tccgtgactt gggcatgagt accgagccaa tggaggcaag     19200
     cagccaaggc cgcgcgccca ccgaggcagt cagtaagcct tggtggccgt tggcgctggc     19260
     cgggcttgcc gctctcggcg cggaaattgt ccattggctt ggcttgccgg aatggttgtc     19320
     cggactgttg gctctcgtcg ccatcacaat cagcggtgtc ggcactttca agaagggctg     19380
     gattgcgttg cgccacggca atctcaatat caatgccttg atgagcattg ccgtgacggg     19440
     tgcggtattg ctgcggcagt ggccggaagc ggccatggtc atggtcttgt ttactgttgc     19500
     cgagctgatc gaagcgaagt cacttgatcg ggcacgcaat gccattcgca gcctggtgca     19560
     gttggcgccg gaaatggcga cagtacagca ggcggacggt gattgggccg aactgcctgc     19620
     caaggccgtg gccattggcc aaatcgtgcg cgtcaaacct ggtgagcgcg tcgcccttga     19680
     tggtgtcgtg acggctgggc gatcaagcat caatcaggcg cctattaccg gcgagagctt     19740
     gccggtcgac aagtcggctg gagacagtgt attcgccggg accatcaacc aatcgggctc     19800
     cgtcgaattc cgggttactg ccgaatccac gcattcgacc ttggcacgca tcattcacgc     19860
     ggtcgaagag gcgcaaggcg cacgtgcgcc aacccagcgt ttcgtcgatc agtttgccaa     19920
     gatctacacg ccggcggtgt tcgtcttcgc catcgcggta gcccttgtgc cgcccctgct     19980
     acttggtggc agctggcagg attgggtata ccaggcgctg gttctgctgg tcatagcctg     20040
     tccgtgcgcc ttggtcattt ccacgcccat caccatcgtc agcggtctgg cagcagcagc     20100
     ccgccacggc attctgatca agggcggtgt ttatcttgag gaaggtcaca agctcgcgtg     20160
     gctggcattc gacaagaccg gcaccatcac gcacggcaaa ccggtattga ccgatacggt     20220
     cttgctcgat cagacggacg gagtggatgc cgtccgagtt gccaccagtc ttgctgcacg     20280
     ctccgatcac ccggtttctc acgccatagc cacaagcgga caacggaacg acaccgtcct     20340
     gcttgatgta gcggacttcg ccgccattcc agggcgaggt gtgctcggaa ccgttggcgg     20400
     cgtgcaatat cagcttggta accatcggtt gatccatgag cttggcgtat gtactcctcc     20460
     cctggaggct cggcttggtg aattggaaga gcaaggcaag acggtcattc tgctcaccga     20520
     tggcgagcgc gtgctggtcc tgtttgcggt ggccgatacg gtcaaggaca gtagccgcgc     20580
     cgcgatccgg gcgctacatg agttgggtat caaaacagtc atgctgaccg gcgacaacgc     20640
     acacaccgcg cgagccatcg cggcccaggt tcagattgac gaagccttgg gcgatcaact     20700
     gccggaagac aagctgcgcg ctatcgaacg ctacgcgcaa acaggcaagg ttggcatggt     20760
     gggtgacggc atcaacgatg caccagcgtt ggctcgagct gacatcggct ttgccatggg     20820
     cgcggcgggt accgatacgg ctatcgagac tgctgacgtc gcactgatgg atgatgacct     20880
     gaacaagatt gcgcgttttg tccgcctgtc gcgcactacc cggacggtac tggtacagaa     20940
     catcacgctg gcattgggca tcaaagtcgt ttttctcgca ctcacgctac tcggtatggg     21000
     cactatgtgg atggcggtat tcgctgatat gggcgcgagt cttctggttg tggccaacgc     21060
     tctaaggctg gtgcgccgat gagctggaaa tttgtcctct acgactgggg tggtctgaac     21120
     gttgcgttgt tccgagccat caatgcaggc acacccgaag cattcgcgcc gctggcgtgg     21180
     ttcttcagcc tcataggtgt tggcggcagt ctggatccgc agaagtttgg cggcgacaat     21240
     gccgatctgc ataccggttc gcaccaagaa aggcttcttg gttatacttc gcccgtgatc     21300
     aagcgcctcg tccttatcct cttgctagta gttgcgccgc tccaggctgc ttggggcgtg     21360
     gcgggcggct attgtccgca tgacgagcgg agtgcggaca cgcagcattt tggccatcac     21420
     gtacaccagc atcaggcggc cgaccagaac gacgtcggcg atccaaccgc gacaggttct     21480
     gatgccgact gcttctcgtg tcacctcgga tgtgtcggcg tcaccatgtc acctgcccca     21540
     gtgctgtcgt ccacgccagc atcgtcggct gtcgcccccc ccgctcgctt tcccctctcc     21600
     gtctttctcc agggtccaga acgacccaat tgggcgcccg ccgtctgatc cggcggaacg     21660
     tccacagctt tcaaccgcaa attctctcct taagccccag aacaggggct aagcggccgt     21720
     cgcaaacggt gcttcagagt aatggcggcc accaagctag aaccgtggcg caatcgcgca     21780
     aatcggcggc aaacgcctgc caatacgggc tttcagcgcg cctcccgcgg caacaactga     21840
     taaatccaag gccaactttc tggtcgcctt gccgcctaca tgcgcgggta tcaaacggag     21900
     atttcaacga gacatgcatt caaatattca tcgtgggcgt gtggcccgct tcatcacaac     21960
     gctgatcttg gcggccgcca cgtcggcggt gctggctgca gagtcacccc tgaccttggc     22020
     agcggccttg cagattgccg aagcggccaa cccccaactt cgggcagcgc aagccgatct     22080
     ggccgccacc gaggggcaac tcgctgatac ccgtggcctg ctctggaaca acccgcaact     22140
     aaccgccgaa caggcccgcc gcaaggttcc tctcccgggc cagggagatg acaccctgcg     22200
     ggagtggggt gccgatcttt cccagaccct ggagatcgca ggtcagcatg gctatcgtcg     22260
     cagcgcggct gagcaggatc tggccgcact caaggaaagc atcgaagaga cccgccggcg     22320
     ggtcctcgcc gaggtcgagc aaaagttcgt ccaggtattg ggcctgcaga cgcgtgctac     22380
     gaccgaggct gaactggtca gcttgatcag ggatgctgct ggagcggcaa gaaaacgctt     22440
     tgcggcgggc gaggatacca agctcgacag caatctcgcg gaggttgagc tcggccgcgc     22500
     cgacaatcag ctgcaagcgg cgcgcgaaca gctcatccag gcccgcgcag atctcgccgc     22560
     cacactgcaa ttgccggccg aagcgctgcc ggaagtacga gggacactgg cccccgaagt     22620
     ggccacgcca tacaccctgg acgagctgct ggccgcagcc gctgaccggc cgcgattacg     22680
     tgcgctggag taccaggagc aggccgcccg cagtcgcctg ggcttggagc gtgccgcggc     22740
     atacccggac gtgactgttg gcgttttcac ggcccgtgaa ggatcaagcg atgcacgcga     22800
     gcagatcacc ggcgtttccg tttccttacc cctgccactg tttcgccgca acgccaccgg     22860
     catcggcaga gcggtcaccg acgtgagcaa agtccagatt gagcgcgaag tggccaatcg     22920
     ggacgcgcgc gcaacggtcc tggctctgtg gcagaagcgg gaaagcctgc gtggtcgggt     22980
     aaagcagctc gatcaagttg tcctgcaacg cctgaacgag aacaagcgtc tgtccgtagc     23040
     aggctaccgg gccggtgaga tcagcctcac tcaactcttg ctagcaaccc ggcaagttct     23100
     cgatacccgc cgcgaagtgc tggaggccat gaccgatctg gccctggtgc gcatcgaact     23160
     cgagcaggca gcgggctggc atcggcagcc gaaaggctcg tgatgagtca tcaccgagtc     23220
     gcacaccgca cccgtcacct gaaaacgtat ccattgaaag atcattcatg aacaacctat     23280
     tccacgtact cccggcgcag cgggctgcac ttttcgcact cggcttctcc gccctgattc     23340
     tcggcggctg tggcaagacc gaatctccgg ccaccgccgc caaagccggc acggcaatga     23400
     gcagcgccga agagcagcac gccgctgccg agaagccagg cgaacacgct gcgagcgaga     23460
     aagccggggc acacgctggg gaggttagca aagacgggga cgaccacggc gacgagcatg     23520
     aagccggggg ggtggaagca ctcaagctca gtgccgaaga gattcaatct gccggcatcg     23580
     agagcgcaga aatactggtg caggaagtga gcgaaccgct caccctgacc gccaccatcc     23640
     gcccgaatca agaccgcata gcgcacgtgg cgccacgcgt ccctgggcgc atcgtcaatg     23700
     tcaaaaccaa tctcggggac caggtaaagg ccgggcagac gctggccgtt ctcgatagcc     23760
     tggaagtcgg cgacgcgtac tcggcttacc tgcaggcagc gacccagcag tcggtagcca     23820
     aggccgactt cgagcgcgcc gagaagctgc acggcgatca gatcattgcc cagaaagacc     23880
     atctgcgcgc ccatgccgag tacgagaagt ccaaggccgc tctcgcagcg gccagggaca     23940
     ggctgcgcat gctgggtgtg gacgcctcgc ctacgggcga cggcaaagca cgatccacct     24000
     tcccggtcag cacgccgttc gccggaacgg taatcgaaaa gcacgccatc ctcggcgagc     24060
     tctcccagcc agacagtccg cttttcgtcg tcgccgacct gtcgaaactg tggatcgcag     24120
     ccgatctgtt cgagaaggat ctcggccgca tccaggtagg cgccagtgcg attgttaccg     24180
     tcgccgccta tccagacgag tccttcgagg gcacgctgac ctacatcgcg gcagtggtcg     24240
     acaaggagac ccgtaccgtg caagcgcgtg tggaagtgac gaatctggac ggccggctca     24300
     aaccggaaat gttcgccacc gtcgccatcc gtaccatcga gacgaccaga cagggtgcga     24360
     cagtcaaagc cttgctggtc cccaccgagg ccgtcgtgtt gatgaatggt cagcccacgg     24420
     tgtttatcga ggacagcgac ggcttcgagc cgagaaatgt cgtgctcggg cagaaactgc     24480
     gtgggcgcct ggtggtcaag agtggcctgg cggcgggcga gcgggtggtg acggcgggcg     24540
     cttacgccct taaggcacgc atcatgaagt cggagcttgg cgcaggtcac gggcactgag     24600
     gggaaaacca tgctgaaccg tatcgttgat ctctcattgc gctacaagct gctcgtcttg     24660
     ctggctttcg tgctgatggc tttctttggc gtccgcgcct ttctcaacgt cccggtggat     24720
     gcgttcccgg acgttacccc gaaccaggtc aacgtctata cagagtcgcc tggactggcc     24780
     gccgaagatg tcgaacaact gctcacgacg ccgattgaaa cggccatggc tggcctgcct     24840
     ggggtcgagc agattcgctc ggtttcccta ttcggcctgt cttacgtcgg tgtctatttc     24900
     aaggatgatg tggacatcta cttcgcccgg cgcctggtcg gagagaagtt gcaggaggcc     24960
     aaggaacgtt tacccgcagg ctatggcgag ccttctctcg gaccgaacag ctcggggctt     25020
     ggccaggttt tttggtacac cgtggaatcg gccgacgaga aactctcggc catggacctg     25080
     cgcaccttgc atgactggac cgtgcgtctc atgttgcgca ccgcgccggg ggtagatgac     25140
     gtcaccacct ggggtgggca ggaaaagcaa taccaggtcc agatcaatcc agaaaaactg     25200
     atcaagtacg gactctcctt caaggccgtc atggaagcgc ttgccgccaa taatcggcag     25260
     gtgggcggac agtacatcaa cctcggccag gagcaatatc tggttcgcgg ccttggtctg     25320
     gtggccaaca ccacggacat tggcaacgtg gtcattgccg agcgcgaggg cgtgccgatc     25380
     cacgtgcgcg aggtggccga agtcaaggaa ggcccggcgc tgcgcttcgg ggcagtgacg     25440
     cgcgacggca aggaggtggc tctcggtatc gccctcgcac ggatcaacga aaaccccaag     25500
     aatgtcgttg atgcggtgaa gcagaaactc gatctcgctg gccaggcgct acctcctggc     25560
     gtcagcatca agccggtcta cgaccgtacc gagctggtcg acaaggcgct cgcgaccgcc     25620
     gaaagcgccc tcgtggaagg atcgatcctg gtggcgatcg tgctcttcct gttcctcggg     25680
     gaaattcgct cggcagtggt cgtgatcgcc actttgccgc tggcgatgct gttcgccttt     25740
     ctgatgatgc aatattttgg gctgtcggcc aatctcatgt ctctggcagg tctggcgatc     25800
     ggcatcggca tgatggtgga cggtgccgtg gtcatggtgg agaacgcctt ccgcttgctc     25860
     tcgcataaga ctggtcaggt cgtaaaccgc actcacgtca tgctggaagc tgcgcgcgag     25920
     gtcatcaacc cgatcgcttt tgccattctc atcattatcg tggtgttcct gccgcttttc     25980
     tcgctgaccg gtctggaggg caagctgttc aaacccatgg ccttcacgat cacttttgcc     26040
     atggtgggct cgctgattct cacgcttacc ctggtgcctg tgctcgccgc gctgatcctg     26100
     aaacccaagg aagaaaaaga cacgtttctg gtccgctgga tcaaggctgg ctacctgccg     26160
     gttctcgact gggcgctgga aaacaagaag aaggtgatcg tcgcttcgct gaccttgctc     26220
     gtctcggccc tcgccacctt ccccttcctc ggcaaggagt tcatgccgac gctccaggaa     26280
     ggcgccatca tgttcagagc gaccggcatc ccgtcgacct cgctggagga gtcgatacgc     26340
     gtctcgcaac aaatgaatga tgtactcaag aaagagtacc cacagaccaa gatggtgctg     26400
     gccaccattg gacgcgcaga gaagggcgaa accgccgacg ccaactacat ggaggtgttg     26460
     gtagaggtga aaccgcaagc tgagtggcct gagaagatgt ccataccgga actttcagac     26520
     cgcatgaagg aaaccctgga ggtggcgcta ccgaccgtgg tggtaggcaa cacccagcca     26580
     atccagatgc gcgtcgaaga actgatctcg ggcgtacgtg caacgcttgc cctcaaactt     26640
     tacggaccag acctcgccga actcgaccgc ctgggcgcag aaagcaaggg catcctgagc     26700
     agtgtacctg gcgtcgccga cctgtctctg gaagccaaca agggcaagcc gcaactgata     26760
     gtgaaggtca accgcgaagc agccgcgcgt ttcgggatca acgctgacga gattctggag     26820
     atggtgcagg ccggaatcgg cgggatggct gtcagcacgc tcattgatgg cgtacgccgc     26880
     ttcgacattc aggtgcgtct cgatgcagca ttccgtgata cgccgcaggc aatcggtaat     26940
     atcccggtgc gtacctcatc cggcgccatg gtcccgctct cgcgcgtggc gacggtggag     27000
     atggacgagg gctatacctt cgtgcgccgc gagcaattga gtcgctatgc tgtcttgcag     27060
     atggacgtga gaggccgcga cgtggacggt ttcgtccagg aagcggacga gaaaatccgg     27120
     agtcagctga agcttcccga aggctactgg attgaatggg gcggggcttt cgagaatcag     27180
     cagcgggcga tggcgcgact ggcgcttatc gtaccgctca ccattggact catctttgtc     27240
     ctgctgtaca ccgccttcaa ctcgctgacc ctcgccacgc taattattgc caacgtgccc     27300
     ttcgcggcaa ttggcggggt cttcggactg gcgataaccg gccagtacgt ctcggtgccc     27360
     tcggcgattg gcttcatcgc cgtgttcggg gtagccatgt tgaacggtat cgtactggtg     27420
     tcatttctca acaaccagcg tggccagggc ttgtcgatcc gtgacgcggt acgacagggg     27480
     acggagctac gcctgaggcc cgtactgatg accgcctcgg tggccatcct cggcctcatc     27540
     ccgatgttgc ttgcgcaggg cgttggcgca gaaacacaac ggcctttggc gacagtcgtc     27600
     gtcggtggcc tgctcacctc gacggccctg acgctgctcc tgctgccgct catgtacgag     27660
     tgggtcgaga cgcgccgcga gcgtcgcacc agaacttcac agtgaaaggc acaaagatga     27720
     atacagtgat cgctatcgtc ggtctggccg cgctgacgct taccggttgc gcagggcata     27780
     cgcacgcgct tgcgccggca agtggcaacc caagcgtcac ggttggcacc ttcagtcacg     27840
     aggggcgcga ggcgcctgca gtggtcctgg aggtcggggg gcggcgtttc accgcccagg     27900
     gcttcgcaat acgccgcgac gcgaaccgct cggccttgca acagcacgac agtcgcggcc     27960
     ggcgtcccag cgggatctcg cctggaagcg ataccgaaca ctaccaatac tcggccaatc     28020
     cggaattgcg cgcggcggat ggcgcggtgc tgcgatgcac cctgacctgg cctgctcggc     28080
     aagcgcctgc gggctattgc gagatggcgg aagggacgcg tatcgctgtc cgctttgagt     28140
     aagcgaatcg gaaatcacga ataatccaaa ggagaactga cgtgaaggaa atcaaggcat     28200
     tcatccggca gcaccgcatc gccaacgtgc ttcaggcgct gcgcgatctg aaggctgccg     28260
     acatcagcta tcacaacatc acggtatccc aggtgcagcg acccttggtg agcgaggacc     28320
     cagcgcagca gcactacgcc atggatctcg ccgaagccgt cgtctccgaa tacaaactgg     28380
     acctcgtatg taccgatgaa gtggccgacg agctgattgg cgccatcacg acagcggcgc     28440
     atacgggtct gccggacgcc ggctggatct ttgtgagcga ggtgacgacg gcgattgaaa     28500
     ttcgctgaaa gcctgcacaa cttgcagctt tccgaagctt caccctcaag ccgaccgtat     28560
     gacgaccagc tgggtgtttc ggaccatggc ctgacgccca aggcgtggcg caacggcgtg     28620
     attaccttcg aggtcgtctt cgaggtcgtg tccacgctcg gcgtcgcggc catcgcctgc     28680
     gcgaggccgg cgacccgcgc catcgcgggc gcgtatctgg cccagaaaac cattggggag     28740
     gccatcgaag cgtactccgg cttttgggcc ctggatgagg cctaccgccc ggttcgggtc     28800
     gaagcggaaa tgatcgacct gcaaaccggc cgcacggtgt gggccgacag cgaaaccgga     28860
     ttctccaacc ggcgtttgtc gcgcatctat acgaccgtca cgcccggcga gcgcaaagct     28920
     caactgagcg tcgctttgca tgaagccatc atcaaggttg tgcatgattt cgagcagagc     28980
     gctggccgcc atgcaggtcc cgccgccgct cctacctcgg acaacaggca gccttctgct     29040
     gaataggcgg acacggcacc gagccgaacg aacagaacac gcagcagtcg cccggattcg     29100
     ggcgcagcag cgcgtggcag gccgggtact cgtagtagaa ctggcaggcg tccgtggacg     29160
     actttgtaat catacgcttg cggcatgttt tggcatatgc tgtccgagtg ccgaggccct     29220
     ggcctcatag agcgcctgcg aggcggattt ttgaaaacag tgcttgaaga accgcaggac     29280
     ttggcggctc accttggagg tgtagcggaa taccggggtg ctgtgctcca gtcggggcgg     29340
     tcggtcccgt cggtggcgga ggtctggcga cggtcctgct tgcgcaatgc tttctcgggc     29400
     ggtaacaaaa accgagcgtg ccaagccggc ggtgtcgcag ctcgttttac ccctgttctt     29460
     gtttacgggt agtggaattt ggcattgcaa aagtcaaacc tgaaacgctc cggcccatag     29520
     gccagacctc ccctcctgga ctatcgataa cgtattttat caatagttac gcggggtggt     29580
     gttatggcgc catgatctgc tttcttgtag acacatcgcc cgcaatatga tattgctgat     29640
     gatatgaggc ttgttctcga cactaacgtt atcgttgctg ctatgcgcag tccaactggc     29700
     gcttcagccg ccttgttgat ggccgcccgt cggggcgagg tgacgcttgt ggccaatgtg     29760
     gcgctggcgc tcgaatacga agcgacctgt tgtcgacctg aacacggcat agctgccggt     29820
     cttagccccg cccaggtgag catctttctg gatgccgtca tcgccatggt cgcgccggtt     29880
     gagacgcatt ttttgtggcg accgctgttg cgcgatcccg gcgacgaact ggtgctcgaa     29940
     gccgccgcca acggcctcgc gtcggctatc gtgacgttta atcaacgcga tttcggcact     30000
     gtgcccctgc aatttggcat cgaagtattg acccctatca ccgccttacg gaggatcaga     30060
     ctatgagaaa ttctcaaagc acctacccgc tgcgtctgcc taattcgatc aaggccgaag     30120
     ttgtgcgccg cgccaaggcc gacggcacga gcttaaacca gttcgtggcg accgctgtcg     30180
     ccgaaaagct ggcggccatg aacaccgcga cgttcttcgc tgaacgtcgg gagcgggctg     30240
     attttgatgc tttcgaccgc attatgcagc gccagggcgg tgagccgccg cagccagacg     30300
     atctgattcc ttgaaccgga cgcggccatg accacgagcg gcctgccagc caccctgccc     30360
     tccgcttccc ggctcctgac cgccgagcag ttccagcgcc tggccgatgt tccccccgaa     30420
     atcgaatggt ttgccaatct cggcaacaag gccacccgcc gcgcctacga aaacgccctc     30480
     ggggatttta tgaagttcac cggcatcgtg aagcccgagg aattccgcac cgtgatccgc     30540
     gcccacgtca tcgcctggcg tgacgacctg gtgcagcgcg ccttgagcgg catgaccgtc     30600
     cggcatcgcc tggcggccct gtcgtcgctg ttcgagtccc tgtgcgagaa gaacgccgtg     30660
     acccataacc cagtcaaggg ggtcaagcgc ccaccggtgg aaagctacga aggcaagacc     30720
     ccggcgctcg gcgaccacca ggcgcgcaag ctgctggacg cgcccgacgg cgcgtcgctc     30780
     aagggcaagc gcgaccgcgc catcctggcc accctgctct atcacgctct gcggcgtgac     30840
     gagctgtgtc ggttgacggt caaggactac aaacacgagc ggcgcggggt gccgcacctc     30900
     aaggtattcg gcaagggcgg caagatccgt tatgtcccgc tgcaccccgc ggccggcggc     30960
     ttgatcggcg actatcttga gatcgcaggg catggcgcgg acgatgccgg cgccctattc     31020
     cggccgctgc gcaacaactg cactactggc ggactggaaa gagcgatcac gcccgacgcg     31080
     gtatacaaac tggtgcggca atactcaacg gcactgggtt tcgcgatcgg ggcgcacgcg     31140
     ttgcgggcga ccgccgcgac caatgcgctt gaccaccagg ccgacatcgc caaggtgcag     31200
     gagtggctgg gtcacgccaa catcgccacg acgcgtattt atgaccaccg caagactagg     31260
     ccggaggata gtccgacctt caaggtcgcc tactagcagc ctgtcggact tgatcccggt     31320
     caagtccgac aggctgctag cgccgatgtg gccggggtgt tctcgaaaac cgctctcgct     31380
     tgaagcggcg ttaaatggcg atcttcgaaa aggtcaggca gcttcaagca cccgcatttc     31440
     gatgtgaagc ccggcagccg tcgccatgtt caccagtgca tcgaggccga acaggttgat     31500
     cttgccgcgc atcaggtcag agacacgcgg ctgagtcaca ccaaagagtt tggcggcctg     31560
     cgtctggctc atttcggtcc gggtaaggtg gttcttcagc gccgtcagca ggacagaacg     31620
     cagcttcatg ttttccgctg cttccggggt gtcctcgatg gcatcccaga cgctggcaaa     31680
     tcgttcgttg ctcattggtt tagctccttc aacaaatcgc ggtaacgctt ggcggccaag     31740
     cccagatcgg ccttgctggt cttcgcggtc ttcttctgga agcagtgaag cacgtagacg     31800
     gcatcagcga acttggcgac gtagatgatc cgaaacgccc cggctgcatc ccgaatccga     31860
     atctccctta ccccctggcc cacggcgctc ataggcttcc agtcgtccgg ttcctggccg     31920
     ttctgtatct ggtcgagttg atggcctgcc tcgcgtttgg ccgcgagtgg gaaggcgcga     31980
     aggtcatcaa gggagcatcc acggaattcg actggcttga gattgatcat gtctagacta     32040
     tacaaaaact tgtatgtact gacaagatgg attggagccg cggcacaggc aaccggctta     32100
     gcgcacgact tttccgacct ctacgcgcct cgttccttga gccacgctgc gcggacctcc     32160
     gcctgtccag tgacgcgcct tccggtcact ttaccgccaa gaaaaacaac tctgcttcta     32220
     ttcagcttga ccaccttcca gaatttggtt aatttcatga aatgtttatt tccttcattc     32280
     atgaacggtg gttttcatga aaacaatcgt aatcacatcc caaaaaggtg gcagcggtaa     32340
     aacgaccctt gccgctcacc tcgcagtcga agctgaacgc atcggcgatg tccccgtgtg     32400
     gctcattgat accgatgagc aaggcacact cagccaatgg cacgcgcgac gggagcaaga     32460
     cacccccaac cgcgccgaaa tgccatttgc ccgtatcgca gagggactgg ccaacatggc     32520
     tcaacgtggc gcggcctatt gtttcattga taccgccccc acgatctccg gtcagagctc     32580
     cgccgtcatc aacatggccg atctcgtgtt aatccccgtt cgcccttctc ccgccgatct     32640
     ttgggccgtt tcggaaaccg ttgccttggt caagcaagcg gggaaacctt tcctcttcgt     32700
     catcactcaa gccaagcccc aggccaccat caccgcccaa acgatcgccg ctctttccga     32760
     gcatggtcgg gttgctcaag ccttcatcgc cgaccgcgtt ccctacgcag gcgcgatgac     32820
     cggaggccgc accgccccag agcttgcccc gaagagccca gccgccgacg aaatcgcccg     32880
     tttatggctt agcgtgaaat catgttttca tgaaaacatt aaatcagtaa ggaaagttaa     32940
     gcatggctaa gactgttgct atcaccgccg ccgacctttc gccgaccaag ccacgccagc     33000
     agagcatcac ccgtcagcgc ggcgtgacct catccgccga gctcgtgcct ttgcaattcc     33060
     gcatgccccc agatttcgtg cgatccttca agcaagcggc tctcgatcga ggcttaaaac     33120
     ttaatgaatt gctgaatgaa tgttttcatg aattcattaa aaaaacaggc tagccaccaa     33180
     gtagggtagg gcggtagtgc agccgcgctt aagaaaaccc aggatacttg ccccgccgct     33240
     tacagaacgc cagaaagtga gcctgagcat gaagcgggct gatcttctta cgatcaatcc     33300
     aagctcgcca ctctgcttca attctgtgaa tgtcccagcc aggcgcgtag ttacgcccca     33360
     gcgcgtaagc atcctcactc aagcggataa aaaccccgcg ctcggtagag gatggcagct     33420
     tgctcttggt tcgcatttca accatatcgc catcgagcct gaaaccgtac cctggcatgt     33480
     ggtcatgcaa ctggtcggca tcaatgatcg tctgcaacag gcgccgaaac tcttttagcg     33540
     tggattgtgc cccgcacttt gcccgcagct tctccaagcc aatcttaaac gaaagctgtt     33600
     gcccgacatg cttgcgtgcc agctcgtaaa gtcgccgttc gagcggcttg gcgagttgaa     33660
     aatactggcg atcaagcgtt agtacttcat gagcttcgac cgcctgaaac acccaatccg     33720
     aaaggacaat ttcgatttct tgcattcgcc cttcgcggct ctcccgcacg atccgcgccc     33780
     gatcaatcag gctgaacaaa tcgaacgtct ccttgccacc cgtaatgatg ttggtcgcaa     33840
     tctgcgtgcc ctgcagccgt tcgagagctt ccctgagctg caagtagcca cgcccgcttg     33900
     tgtcccgatt ggtcgcaatc aagagatcat gcgcccgcag ccgcagggtt cgcgacaccg     33960
     gacggctatc attcaccgcc gccataagct ggcttatgca ataaatcaga atgtctcggt     34020
     caaagaccgt tgctaacccc ttcgcgccag gccgcacctc cgcccaactc gccccgttct     34080
     cataacgacg ggtcttcatg tctggtttct tcgacagcga gaatatcggg tgctccatcg     34140
     aggcgctatc gcccttcagg gcagcatcaa aaacgtcgca aacgaagaaa tcccgctcgt     34200
     gccgaattgg aagaagaggg gacctctcct tcgtgttatc acccaccgag acttccgagt     34260
     tcgtgttatc acccaccatt cacggatttt tcgtgttttc acacgccatg tcaatattgt     34320
     tcgtgttatt acccaccttt gagcctgttg ataacttttc cgtacatgct ctcagcattc     34380
     gtgtttttac acaccaaact tcgtgttttt acacaccaaa cttcgtgttt ttacacaccg     34440
     gaacattcaa aaagcacctt ttttcttgtt taacatcaga catttacagc tttgcaagaa     34500
     tcacgtaact ctattaactc tatttaacaa gactctagcg ttgttgataa ctagccagcc     34560
     gtggtcacta ccaccagcat ccagccacct cttttggtct caaccaacgc aaaagcaggg     34620
     gctccacctc gctttcccgc gcccaattta tcccgacgcc gaacaggttc accgccgcac     34680
     gaccccaagt gatcggcctt cggcctcaaa ataccaacac cacaggcgcg gcccttcggg     34740
     ccgcgtcaag cagacgcccg ctaacgcggg cgggaatttt caattgaaag cccgtcccgg     34800
     cgccggtagt tttccggaaa ggtccgagga cagggaaagc aaatagaagc cacggcgggg     34860
     ggcagggtac tttgatcaac gggaaggggt ctgccgacgc aggcgaacct atcgccgaag     34920
     cgctgcgcct gctcgacttg tttgccagtg ttggggccga ggctttcgat atcacccaca     34980
     ccaacctcca gcaggagaaa cggggctttc gcccggggca gagcctagcc caggcccggc     35040
     agtccatgcc ctacctggtg cccagcgccg cgcggcggca gaataatcta atcatccgtc     35100
     cgcgcgccgg cgctgacgtc accctggtgc agctcgatga cctcgcgcca gatactctgg     35160
     cccacatcgc tccggccgca ttcctgattc tgcgtaccag tcccggcggt cagcaggcct     35220
     gggtcgccgt caccaacgct ccccggggct tcgccgcgcg gctcaaggaa gggacgggcg     35280
     ccgacaagga agcgtccggc gccactcgtg tcgccggcac cgccaatttc aaacccgcct     35340
     acgccccgaa cttcccccgg gtccggatcg acgccgctca gcccgggctg aacgtcacta     35400
     cgcagaccct cgacgcgatg ggggtggtcg cgccggcccg gccgatcccg gtgtcgctac     35460
     cccccgtcgc gtcctccagc gattcgcgga cgagcaaatg gcccagctac gcgcgctgcc     35520
     tcgaaggggc gccgatcggc gccggcggta atcccaaacg cactagcgcg gatttcatct     35580
     ggtgcaagat cgcgctctcc tggggccacg gcatcgaagc gaccgccgaa cggctgctgg     35640
     aagaaagcgc caaggcccgc gaaaacggcg aagcctatgc caggcagacc gccgagcatg     35700
     ccgactacgc cgcccggcaa cgcaacgccc tgccacgagg gcgaccggcg agggggtaag     35760
     gggaggcccc cgccgggggg aggcccgtcg ctcggagcac cccgtgaatc ggccacagcg     35820
     ggccgtgagc gcgtttttcc cggttgggcc agcccctctc tatctaaaac catcctggcg     35880
     cgctctacgg gctttgtctg gcgtgacctt ggactacccc gggtttctgt ggacaagcct     35940
     ttgcacaacc cggtgcgtta cccacgcgct ccgcctaatg gctcacgatc aggcgtccgc     36000
     ccgtttttgc ggcggcgggc cgttcggtgc ctcgtttgtt tcggcttttc tgcgacggag     36060
     ttcttgcgaa attatggtaa ttaccgtaat cttattacca taataacgat aattttagga     36120
     tgctatttca aggacatcag atcatggcta aggcattggt gacgcaagag cgtgttttcg     36180
     aggtggcgca ggccctgacg gatcagggca cggcgccgac catcttgaac gtgcaggaag     36240
     ggatcggcgg gggcagttat acgacggtca agcgctatct ggatcagtgg cgggaggcgg     36300
     cgccgaagca gcggcagccg gtagaactac cggaacccgc ggttgcccgg ctgatgagcc     36360
     tcggccggga gttctggggc ttgctcgacg aacaggccgg acagcaggtg gaagcgctgc     36420
     gagcggcgac gcgggaagag gtcgcggcga tccagacgca gctcgaccag gcggagcagg     36480
     cgatcggccg actggaggcc gagcgcgagc aggccgagag tcatgctgca gcgcaggagc     36540
     aggccttgcg cgaagcggta gcagcacggg cggcgcagac cgaacggatg gccgccgccg     36600
     aggcgaaggc cggcgaactg gcggcacggg tcgaggacct caagggcgaa ctggagcggg     36660
     cccatgcgcg acagacggcc gaacgcgaag caacaacggc ggcccgtgcc gaagcccagg     36720
     ccgctgcggt ggaagctgcc cggctgcagg gcgagctggc ggcacttaag aaaccgcgtt     36780
     caagcgctta acctggcgaa gggggcacgg caacgggcag ctttcttcgg gaactcgtcg     36840
     tcgcgcgggg ggtggttggg tggccgcaag agggccatgg cggcgacaaa gcgtggttac     36900
     gacgctttgt cgccgttgtt tgtccgggct ggcgttggca aaacaacggt tgttaacggt     36960
     gtcgcttttc cgccgaaatc tggcgtccac ggcctgacgt ggtggaaagg ccggtccgtt     37020
     ttgttttggt ttttgacttt cagccaagca tgaatatgct ggttttccgg tttgccgccg     37080
     gctaggctcc cggcggacgg gttgcgcagc aaaccgtcgt ctggcaagcg aagcgcggca     37140
     ggggtgggca ccaggaatcg ctgagcgccg tcggctatcg acttcactgg gtttgagcgg     37200
     gctgtgagct gcggctcggc atgaccggcg cgccagtagc gttcgcgtgg ccgatgcggt     37260
     agaaagcccg gcggccggtg gaaaggcagg cgcgacaccg gttcgaaccg cgaagccaga     37320
     cccgatgccg cgccccgtag cccccacagc ggcgacgttg cctgcctagt atttcacgaa     37380
     gcgcacctcg ccgtcagatt cccattggcc gggacggcca atggatctcc ctggaagacg     37440
     ctaccactgc gccggctgcc gcacggccgt gctcatttgc agccactgcg atcgcggtca     37500
     ccggtactgt accgcgaggt gcgccaacca ggcccgccga cagtctgtcc gtgcctcggg     37560
     tcgccgctat caagacagct tgcgcggccg tcacgcccac gccgaacgcc agcgccgtta     37620
     cagggcccgg cagcagaaag tgacgcatca gggttcccca cccagggtcg cacctgatca     37680
     actcccctgc gaaccgacgt tgccggttgc gcctcagcca gggcactgct gtcgttgtca     37740
     tcgtcccttg ccggacgggg tgcgccagaa ctttctgcag cgtcggattc gccgtcaccc     37800
     acccgaccgg agaagacatg gccctcagcc ccgagattga agcgcagatc ctgcgttact     37860
     accacgccga acgctggcgt atcggcacta tcgcgaccca actgcaagtg catcgcgata     37920
     gcgtcgcccg cgtgctcgcc caagccggct tgccggcact cgaagcggtt cgccgccctt     37980
     cggcgattga tccctacctg ccgttcatcc tcgatacctt gacgcagttt ccgcgcctac     38040
     gcgcctcccg cgtatacgac atggtcaaga gtcgcggtta cccgggacgc ccggatcatt     38100
     tccggcacct gatcgcccgc caccgaccgc ggccgaaagc cgaagcctac ctggggtcgc     38160
     ctcagaaaac ggaaaataaa gcacgctaag cccttactta cccagatgtt tgacttttcg     38220
     tggcactttc accatggcaa ttgcaattgc ccaacccttg caaaatgccg cacgcctcta     38280
     cagatcgaga gccagaacac ttctcgcgca aatcaaccaa gtgccgcttt aactgcaaca     38340
     gcgcggacac acgcatttcc acctgttgaa tatgggcctc cagcagcgtg ttgacctccc     38400
     cacagtcctg catcgggttg tctcgcagac ccagcaatgc gcgaatctcg ctcaacgtca     38460
     tgtcgagcga acggcaatga cggatgaatt gcaagcgctc aatgtgcgcc tcaccgtaca     38520
     gccggaagtt gccaccgctt cgcgctggct tcggcagtag cccttccttc tcgtagtagc     38580
     ggatggtcac aacctcgcat ccagagcgct tggcgaggtc gccaattctg atttccatgc     38640
     atcaatctcc tttatttcac ttgactctat agtaactata gggtttgtaa tggaagttgt     38700
     atagatttga aggagttatt tatgagcgaa tgcgcttcca cggcgtgtgg ctgctcggct     38760
     gggccgatca tccaacccac gacacaagcc ccagcgacaa ccggatcggc tcaagcggtg     38820
     tatcgcatcg agaacatgga ctgccccacg gaagaggcgc tgatccgagg caagctggtc     38880
     gggctggcgg gggtggttgg tcttgagttc aacctgatgc agcgtacttt ggccgttcgg     38940
     cacgaactgc cttcgttgtt tcccgttgag caggcgctaa ccgccatcgg catgcaagcc     39000
     gtgcgcatgg atcaggcatc gaccgggcaa acgaccaagc tgtccattac caaaatggat     39060
     tgcccgaccg aagagacgtt gatccgcaac aagctcggta ccatggccgg agttgccgat     39120
     ctcgatttca acctgatgca gcgcacgctg tcggtacgcc atgcggacca ggttctgccg     39180
     gacgtgctcg cggcactgca agcgcttgga ttcgaggcgc aggtgttgga caccgcagag     39240
     gccgcatcgc catccgcatc ccttgtgacc acgccgacca actggtggcc gctgggcatc     39300
     tcctttgtaa ctgcatcggc ggccgaggcg gtctactggc tccacaacgg caatcattgg     39360
     tcggtcgtcg ttctggcgct cgtcgcggtc ttcaccggcg gtctgtccac ctacaagaaa     39420
     ggttggattg cgctcaagaa ccgtaatctc aacatgaacg ccctgatgtc gattgccgtc     39480
     acgggtgcca tgttgatcgg gcactggccc gaggcggcaa tggtgatggt gcttttcgcg     39540
     ctggccgagg tgatcgaagc caagtcgctg gatcgcgccc gcaatgccat ccgtggcctg     39600
     ctcgacctga ccccggaaca ggccacggtg cagcaggctg acggcacatg gcgcgaggtg     39660
     ggtgcaaagc aaattgccat cggtagccgc gtccgggtca agccaggtga gcgcatcgcc     39720
     ctggatggtg aggtgctgga aggccgctct gccgtcaacc aagccccgat cacgggtgaa     39780
     agccttccgg tcgagaaatc ccccggtgat ccggtgtttg cgggcacgat caacgaatcc     39840
     ggttcattcg agtaccgcgt caccgccgtg gccagcaact ccacattggc ccgcatcatt     39900
     cacgcggtag aggctgccca aggaagccgt gcgccgactc agcgctttgt cgatcagttc     39960
     gcccgctggt acacgcccat tgttttcggt gttgccatcg ccgtcgcgtt gttgccaccg     40020
     ctgttcatgg gtgcggcatg gctcgactgg atttaccgtg cattggttct gctggtggtc     40080
     gcctgcccgt gcgcactggt gatctctacg ccggtcagca tcgtcagcgg cctggccgct     40140
     gccgcccgcc acggcattct catcaagggc ggcgtctatc tggaagaagg ccgcaagctg     40200
     cgctggctgg ctctggacaa gaccggcacg atcacgcacg gcaagcccgc acagaccgat     40260
     tttgtcactt ggggcaatgc actcgccgca aacagccgca gcatcgctgc cagtctggcg     40320
     gctcgttccg accaccctgt atccaaagcg gtggcacaag ccgcgcagac ggatggggtt     40380
     gccttactcg acgtagccga gttcagcgcg ctgcccggtc ggggcgtgca aggccaaatc     40440
     aacggtgaga cctaccatct tggcaaccag cggatgctcg aagcgctggg gcaatgcaca     40500
     ccagaactgg aacagcgcat cgcggcgctg gaaaccatgg gtaaaactgt cgtgatgttg     40560
     gtcagcgcaa aaggggttca tgccttattt gccgtagcgg acaccatcaa ggaaagcagc     40620
     aggagcgcca ttgccgagct tcatgcactg ggcatcaaca ccatgatgct gaccggcgac     40680
     aacccccaca cggcacaggc cattgccgca caagccggga tcgacagtgc gcaaggcaat     40740
     ctgctcccag acgacaaact gcgcgaagtt gagctactgg ccataaaggg caaggtcggc     40800
     atggtcggtg atggcatcaa cgatgccccg gccttggcgc gtgcggacat cggctttgcc     40860
     atgggagcgg ctggcaccga taccgccatc gagaccgctg acgtggccct gatggacgac     40920
     aacctgggca agattccgac cttcgtgcgc ctgtcgcgtg cgacggcgca ggtgctgatg     40980
     caaaacattg tgctggccct tggcatcaag gcagtatttc tggtgctgac cttcacgggt     41040
     caagcgacca tgtggatggc ggtgtttgct gatatggggg ccagcttgct cgtcgttggc     41100
     aatggcttga ggctgttgcg caaatgagct ggaaattctt tctctacgac tggggtggtc     41160
     taaacatcgc gttgttccaa gccatcaaca tgagcacacc tgcagcgctg gaaccgccgg     41220
     tatcgttctt caaccttgtg ataggcaact actggactgc accactgatg ctcttggcga     41280
     tgtggggatg gtcaaagtcg gcacctgacc caacgcgggc cgatgccatc cggtacagac     41340
     tcagagtctt tagcgtggcc tttgcgttgg catttctcgt cgccaccatc ttgaagctat     41400
     ggatcgactt tccacgcccg cctgccgttt ttggcgacat ggtgcgcgtt atcgggggca     41460
     tcgaacgaca ctacagcctg cccagcgggc atgccaccta tgccgcgctg gtggtcggcg     41520
     cgctctggcc tttgataggc cgtcgtggcc gcatcggctt ggtgttgtac gccgcattgg     41580
     tcggttggtc acgcatcgca gccggaatgc actttcctgc cgatgtgctg gcggggtggg     41640
     tacttggatt gagctgcacg gcgctcgccg ggtggctgat gccgctggcc gcccctgtgt     41700
     ggcaatcggc tcgccgcaca tcgacttggg tctggttcgc agtggccgcc agttctgtca     41760
     tgacagatca gctcgcaaag ttcgccatca cccgcacgtt tgcctacggt gaacaggtcg     41820
     aagtcagcac cttcttcaac attgtccatg tcctgaatcc cggcgcggca ttcagctttc     41880
     tggcgaacgc tggcggctgg caacgttact ttctcatggc gctgggtctg gtcgtttctg     41940
     cttggctggg ccgcatgctg tgccagcagc ggccacgcct tgaagcggtg ggctacagcc     42000
     tgatccttgg tggtgcgctc ggcaatgtcg tggatcgtgt gctgcgtgga tcggttgtcg     42060
     atttcctcga cttccattgg cagcttgtgc actggcccgc cttcaacctc gctgatgtgg     42120
     cgataactat cggagcgctc tgcctgttct tgacggttgt accgaaaagc agtagaggca     42180
     cagaggccga tgtgtccggt taagctatac cctaacttgg cgtcaagtgc tgcactcgaa     42240
     atgcgtcagg atagagtatt aatgaatatt tattgacaca tgtagcaaag gcttataaat     42300
     tctttcctga cacatttgtg cagga                                           42325
//

If you have problems or comments...

PBIL Back to PBIL home page