(data stored in SCRATCH zone)

EMBL: CP001720

ID   CP001720; SV 1; circular; genomic DNA; STD; PRO; 4545624 BP.
AC   CP001720; ABTQ01000000-ABTQ01000186;
PR   Project:PRJNA27947;
DT   11-SEP-2009 (Rel. 102, Created)
DT   18-JAN-2015 (Rel. 123, Last updated, Version 8)
DE   Desulfotomaculum acetoxidans DSM 771, complete genome.
KW   .
OS   Desulfofarcimen acetoxidans DSM 771
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae;
OC   Desulfofarcimen.
RN   [1]
RC   Publication Status: Online-Only
RP   1-4545624
RX   PUBMED; 21304664.
RA   Spring S., Lapidus A., Schroder M., Gleim D., Sims D., Meincke L.,
RA   Glavina Del Rio T., Tice H., Copeland A., Cheng J.F., Lucas S., Chen F.,
RA   Nolan M., Bruce D., Goodwin L., Pitluck S., Ivanova N., Mavromatis K.,
RA   Mikhailova N., Pati A., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Chain P., Saunders E., Brettin T., Detter J.C.,
RA   Goker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P., Han C.;
RT   "Complete genome sequence of Desulfotomaculum acetoxidans type strain
RT   (5575)";
RL   Stand Genomic Sci 1(3):242-253(2009).
RN   [2]
RP   1-4545624
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Desulfotomaculum acetoxidans DSM 771";
RL   Unpublished.
RN   [3]
RP   1-4545624
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (01-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; 86aab51775f119251267971e243ea9f1.
DR   BioSample; SAMN02598455.
DR   CABRI; DSM 771.
DR   EnsemblGenomes-Gn; Dtox_R0001.
DR   EnsemblGenomes-Gn; Dtox_R0002.
DR   EnsemblGenomes-Gn; Dtox_R0003.
DR   EnsemblGenomes-Gn; Dtox_R0004.
DR   EnsemblGenomes-Gn; Dtox_R0005.
DR   EnsemblGenomes-Gn; Dtox_R0006.
DR   EnsemblGenomes-Gn; Dtox_R0007.
DR   EnsemblGenomes-Gn; Dtox_R0008.
DR   EnsemblGenomes-Gn; Dtox_R0009.
DR   EnsemblGenomes-Gn; Dtox_R0010.
DR   EnsemblGenomes-Gn; Dtox_R0011.
DR   EnsemblGenomes-Gn; Dtox_R0012.
DR   EnsemblGenomes-Gn; Dtox_R0013.
DR   EnsemblGenomes-Gn; Dtox_R0014.
DR   EnsemblGenomes-Gn; Dtox_R0015.
DR   EnsemblGenomes-Gn; Dtox_R0016.
DR   EnsemblGenomes-Gn; Dtox_R0017.
DR   EnsemblGenomes-Gn; Dtox_R0018.
DR   EnsemblGenomes-Gn; Dtox_R0019.
DR   EnsemblGenomes-Gn; Dtox_R0020.
DR   EnsemblGenomes-Gn; Dtox_R0021.
DR   EnsemblGenomes-Gn; Dtox_R0022.
DR   EnsemblGenomes-Gn; Dtox_R0023.
DR   EnsemblGenomes-Gn; Dtox_R0024.
DR   EnsemblGenomes-Gn; Dtox_R0025.
DR   EnsemblGenomes-Gn; Dtox_R0026.
DR   EnsemblGenomes-Gn; Dtox_R0027.
DR   EnsemblGenomes-Gn; Dtox_R0028.
DR   EnsemblGenomes-Gn; Dtox_R0029.
DR   EnsemblGenomes-Gn; Dtox_R0030.
DR   EnsemblGenomes-Gn; Dtox_R0031.
DR   EnsemblGenomes-Gn; Dtox_R0032.
DR   EnsemblGenomes-Gn; Dtox_R0033.
DR   EnsemblGenomes-Gn; Dtox_R0034.
DR   EnsemblGenomes-Gn; Dtox_R0035.
DR   EnsemblGenomes-Gn; Dtox_R0036.
DR   EnsemblGenomes-Gn; Dtox_R0037.
DR   EnsemblGenomes-Gn; Dtox_R0038.
DR   EnsemblGenomes-Gn; Dtox_R0039.
DR   EnsemblGenomes-Gn; Dtox_R0040.
DR   EnsemblGenomes-Gn; Dtox_R0041.
DR   EnsemblGenomes-Gn; Dtox_R0042.
DR   EnsemblGenomes-Gn; Dtox_R0043.
DR   EnsemblGenomes-Gn; Dtox_R0044.
DR   EnsemblGenomes-Gn; Dtox_R0045.
DR   EnsemblGenomes-Gn; Dtox_R0046.
DR   EnsemblGenomes-Gn; Dtox_R0047.
DR   EnsemblGenomes-Gn; Dtox_R0048.
DR   EnsemblGenomes-Gn; Dtox_R0049.
DR   EnsemblGenomes-Gn; Dtox_R0050.
DR   EnsemblGenomes-Gn; Dtox_R0051.
DR   EnsemblGenomes-Gn; Dtox_R0052.
DR   EnsemblGenomes-Gn; Dtox_R0053.
DR   EnsemblGenomes-Gn; Dtox_R0054.
DR   EnsemblGenomes-Gn; Dtox_R0055.
DR   EnsemblGenomes-Gn; Dtox_R0056.
DR   EnsemblGenomes-Gn; Dtox_R0057.
DR   EnsemblGenomes-Gn; Dtox_R0058.
DR   EnsemblGenomes-Gn; Dtox_R0059.
DR   EnsemblGenomes-Gn; Dtox_R0060.
DR   EnsemblGenomes-Gn; Dtox_R0061.
DR   EnsemblGenomes-Gn; Dtox_R0062.
DR   EnsemblGenomes-Gn; Dtox_R0063.
DR   EnsemblGenomes-Gn; Dtox_R0064.
DR   EnsemblGenomes-Gn; Dtox_R0065.
DR   EnsemblGenomes-Gn; Dtox_R0066.
DR   EnsemblGenomes-Gn; Dtox_R0067.
DR   EnsemblGenomes-Gn; Dtox_R0068.
DR   EnsemblGenomes-Gn; Dtox_R0069.
DR   EnsemblGenomes-Gn; Dtox_R0070.
DR   EnsemblGenomes-Gn; Dtox_R0071.
DR   EnsemblGenomes-Gn; Dtox_R0072.
DR   EnsemblGenomes-Gn; Dtox_R0073.
DR   EnsemblGenomes-Gn; Dtox_R0074.
DR   EnsemblGenomes-Gn; Dtox_R0075.
DR   EnsemblGenomes-Gn; Dtox_R0076.
DR   EnsemblGenomes-Gn; Dtox_R0077.
DR   EnsemblGenomes-Gn; Dtox_R0078.
DR   EnsemblGenomes-Gn; Dtox_R0079.
DR   EnsemblGenomes-Gn; Dtox_R0080.
DR   EnsemblGenomes-Gn; Dtox_R0081.
DR   EnsemblGenomes-Gn; Dtox_R0082.
DR   EnsemblGenomes-Gn; Dtox_R0083.
DR   EnsemblGenomes-Gn; Dtox_R0084.
DR   EnsemblGenomes-Gn; Dtox_R0085.
DR   EnsemblGenomes-Gn; Dtox_R0086.
DR   EnsemblGenomes-Gn; Dtox_R0087.
DR   EnsemblGenomes-Gn; Dtox_R0088.
DR   EnsemblGenomes-Gn; Dtox_R0089.
DR   EnsemblGenomes-Gn; Dtox_R0090.
DR   EnsemblGenomes-Gn; Dtox_R0091.
DR   EnsemblGenomes-Gn; Dtox_R0092.
DR   EnsemblGenomes-Gn; Dtox_R0093.
DR   EnsemblGenomes-Gn; Dtox_R0094.
DR   EnsemblGenomes-Gn; Dtox_R0095.
DR   EnsemblGenomes-Gn; Dtox_R0096.
DR   EnsemblGenomes-Gn; Dtox_R0097.
DR   EnsemblGenomes-Gn; Dtox_R0098.
DR   EnsemblGenomes-Gn; Dtox_R0099.
DR   EnsemblGenomes-Gn; Dtox_R0100.
DR   EnsemblGenomes-Gn; Dtox_R0101.
DR   EnsemblGenomes-Gn; EBG00001274014.
DR   EnsemblGenomes-Gn; EBG00001274015.
DR   EnsemblGenomes-Gn; EBG00001274016.
DR   EnsemblGenomes-Gn; EBG00001274017.
DR   EnsemblGenomes-Gn; EBG00001274018.
DR   EnsemblGenomes-Gn; EBG00001274019.
DR   EnsemblGenomes-Gn; EBG00001274020.
DR   EnsemblGenomes-Gn; EBG00001274021.
DR   EnsemblGenomes-Gn; EBG00001274022.
DR   EnsemblGenomes-Gn; EBG00001274023.
DR   EnsemblGenomes-Gn; EBG00001274024.
DR   EnsemblGenomes-Gn; EBG00001274025.
DR   EnsemblGenomes-Gn; EBG00001274026.
DR   EnsemblGenomes-Gn; EBG00001274027.
DR   EnsemblGenomes-Gn; EBG00001274028.
DR   EnsemblGenomes-Gn; EBG00001274029.
DR   EnsemblGenomes-Gn; EBG00001274030.
DR   EnsemblGenomes-Gn; EBG00001274031.
DR   EnsemblGenomes-Gn; EBG00001274032.
DR   EnsemblGenomes-Gn; EBG00001274033.
DR   EnsemblGenomes-Gn; EBG00001274034.
DR   EnsemblGenomes-Gn; EBG00001274035.
DR   EnsemblGenomes-Gn; EBG00001274036.
DR   EnsemblGenomes-Gn; EBG00001274037.
DR   EnsemblGenomes-Gn; EBG00001274038.
DR   EnsemblGenomes-Gn; EBG00001274039.
DR   EnsemblGenomes-Gn; EBG00001274040.
DR   EnsemblGenomes-Gn; EBG00001274041.
DR   EnsemblGenomes-Gn; EBG00001274042.
DR   EnsemblGenomes-Gn; EBG00001274043.
DR   EnsemblGenomes-Gn; EBG00001274044.
DR   EnsemblGenomes-Gn; EBG00001274045.
DR   EnsemblGenomes-Gn; EBG00001274046.
DR   EnsemblGenomes-Gn; EBG00001274047.
DR   EnsemblGenomes-Gn; EBG00001274048.
DR   EnsemblGenomes-Gn; EBG00001274049.
DR   EnsemblGenomes-Gn; EBG00001274050.
DR   EnsemblGenomes-Gn; EBG00001274051.
DR   EnsemblGenomes-Gn; EBG00001274052.
DR   EnsemblGenomes-Gn; EBG00001274053.
DR   EnsemblGenomes-Gn; EBG00001274054.
DR   EnsemblGenomes-Gn; EBG00001274055.
DR   EnsemblGenomes-Gn; EBG00001274056.
DR   EnsemblGenomes-Gn; EBG00001274057.
DR   EnsemblGenomes-Gn; EBG00001274058.
DR   EnsemblGenomes-Gn; EBG00001274059.
DR   EnsemblGenomes-Gn; EBG00001274060.
DR   EnsemblGenomes-Gn; EBG00001274061.
DR   EnsemblGenomes-Gn; EBG00001274062.
DR   EnsemblGenomes-Gn; EBG00001274063.
DR   EnsemblGenomes-Gn; EBG00001274064.
DR   EnsemblGenomes-Gn; EBG00001274065.
DR   EnsemblGenomes-Gn; EBG00001274066.
DR   EnsemblGenomes-Gn; EBG00001274067.
DR   EnsemblGenomes-Gn; EBG00001274068.
DR   EnsemblGenomes-Gn; EBG00001274069.
DR   EnsemblGenomes-Gn; EBG00001274070.
DR   EnsemblGenomes-Gn; EBG00001274071.
DR   EnsemblGenomes-Gn; EBG00001274072.
DR   EnsemblGenomes-Gn; EBG00001274073.
DR   EnsemblGenomes-Gn; EBG00001274074.
DR   EnsemblGenomes-Gn; EBG00001274075.
DR   EnsemblGenomes-Gn; EBG00001274076.
DR   EnsemblGenomes-Gn; EBG00001274077.
DR   EnsemblGenomes-Gn; EBG00001274078.
DR   EnsemblGenomes-Gn; EBG00001274079.
DR   EnsemblGenomes-Gn; EBG00001274080.
DR   EnsemblGenomes-Gn; EBG00001274081.
DR   EnsemblGenomes-Gn; EBG00001274082.
DR   EnsemblGenomes-Gn; EBG00001274083.
DR   EnsemblGenomes-Gn; EBG00001274084.
DR   EnsemblGenomes-Gn; EBG00001274085.
DR   EnsemblGenomes-Gn; EBG00001274086.
DR   EnsemblGenomes-Gn; EBG00001274087.
DR   EnsemblGenomes-Gn; EBG00001274088.
DR   EnsemblGenomes-Gn; EBG00001274089.
DR   EnsemblGenomes-Gn; EBG00001274090.
DR   EnsemblGenomes-Gn; EBG00001274091.
DR   EnsemblGenomes-Gn; EBG00001274092.
DR   EnsemblGenomes-Gn; EBG00001274093.
DR   EnsemblGenomes-Gn; EBG00001274094.
DR   EnsemblGenomes-Gn; EBG00001274095.
DR   EnsemblGenomes-Gn; EBG00001274096.
DR   EnsemblGenomes-Gn; EBG00001274097.
DR   EnsemblGenomes-Gn; EBG00001274098.
DR   EnsemblGenomes-Gn; EBG00001274099.
DR   EnsemblGenomes-Gn; EBG00001274100.
DR   EnsemblGenomes-Gn; EBG00001274101.
DR   EnsemblGenomes-Gn; EBG00001274102.
DR   EnsemblGenomes-Gn; EBG00001274103.
DR   EnsemblGenomes-Gn; EBG00001274104.
DR   EnsemblGenomes-Gn; EBG00001274105.
DR   EnsemblGenomes-Gn; EBG00001274106.
DR   EnsemblGenomes-Gn; EBG00001274107.
DR   EnsemblGenomes-Gn; EBG00001274108.
DR   EnsemblGenomes-Gn; EBG00001274109.
DR   EnsemblGenomes-Gn; EBG00001274110.
DR   EnsemblGenomes-Gn; EBG00001274111.
DR   EnsemblGenomes-Gn; EBG00001274112.
DR   EnsemblGenomes-Gn; EBG00001274113.
DR   EnsemblGenomes-Gn; EBG00001274114.
DR   EnsemblGenomes-Gn; EBG00001274115.
DR   EnsemblGenomes-Gn; EBG00001274116.
DR   EnsemblGenomes-Gn; EBG00001274117.
DR   EnsemblGenomes-Gn; EBG00001274118.
DR   EnsemblGenomes-Gn; EBG00001274119.
DR   EnsemblGenomes-Gn; EBG00001274120.
DR   EnsemblGenomes-Gn; EBG00001274121.
DR   EnsemblGenomes-Gn; EBG00001274122.
DR   EnsemblGenomes-Gn; EBG00001274123.
DR   EnsemblGenomes-Gn; EBG00001274124.
DR   EnsemblGenomes-Gn; EBG00001274125.
DR   EnsemblGenomes-Gn; EBG00001274126.
DR   EnsemblGenomes-Gn; EBG00001274127.
DR   EnsemblGenomes-Gn; EBG00001274128.
DR   EnsemblGenomes-Gn; EBG00001274129.
DR   EnsemblGenomes-Gn; EBG00001274130.
DR   EnsemblGenomes-Gn; EBG00001274131.
DR   EnsemblGenomes-Gn; EBG00001274132.
DR   EnsemblGenomes-Gn; EBG00001274133.
DR   EnsemblGenomes-Gn; EBG00001274134.
DR   EnsemblGenomes-Gn; EBG00001274135.
DR   EnsemblGenomes-Gn; EBG00001274136.
DR   EnsemblGenomes-Gn; EBG00001274137.
DR   EnsemblGenomes-Gn; EBG00001274138.
DR   EnsemblGenomes-Gn; EBG00001274139.
DR   EnsemblGenomes-Gn; EBG00001274140.
DR   EnsemblGenomes-Gn; EBG00001274141.
DR   EnsemblGenomes-Gn; EBG00001274142.
DR   EnsemblGenomes-Gn; EBG00001274143.
DR   EnsemblGenomes-Gn; EBG00001274144.
DR   EnsemblGenomes-Gn; EBG00001274145.
DR   EnsemblGenomes-Gn; EBG00001274146.
DR   EnsemblGenomes-Gn; EBG00001274147.
DR   EnsemblGenomes-Gn; EBG00001274148.
DR   EnsemblGenomes-Gn; EBG00001274149.
DR   EnsemblGenomes-Gn; EBG00001274150.
DR   EnsemblGenomes-Gn; EBG00001274151.
DR   EnsemblGenomes-Gn; EBG00001274152.
DR   EnsemblGenomes-Gn; EBG00001274153.
DR   EnsemblGenomes-Gn; EBG00001274154.
DR   EnsemblGenomes-Gn; EBG00001274155.
DR   EnsemblGenomes-Gn; EBG00001274156.
DR   EnsemblGenomes-Gn; EBG00001274157.
DR   EnsemblGenomes-Gn; EBG00001274158.
DR   EnsemblGenomes-Gn; EBG00001274159.
DR   EnsemblGenomes-Gn; EBG00001274160.
DR   EnsemblGenomes-Gn; EBG00001274161.
DR   EnsemblGenomes-Gn; EBG00001274162.
DR   EnsemblGenomes-Gn; EBG00001274163.
DR   EnsemblGenomes-Gn; EBG00001274164.
DR   EnsemblGenomes-Gn; EBG00001274165.
DR   EnsemblGenomes-Gn; EBG00001274166.
DR   EnsemblGenomes-Gn; EBG00001274167.
DR   EnsemblGenomes-Gn; EBG00001274168.
DR   EnsemblGenomes-Gn; EBG00001274169.
DR   EnsemblGenomes-Gn; EBG00001274170.
DR   EnsemblGenomes-Gn; EBG00001274171.
DR   EnsemblGenomes-Gn; EBG00001274172.
DR   EnsemblGenomes-Gn; EBG00001274173.
DR   EnsemblGenomes-Gn; EBG00001274174.
DR   EnsemblGenomes-Gn; EBG00001274175.
DR   EnsemblGenomes-Gn; EBG00001274176.
DR   EnsemblGenomes-Gn; EBG00001274177.
DR   EnsemblGenomes-Gn; EBG00001274178.
DR   EnsemblGenomes-Gn; EBG00001274179.
DR   EnsemblGenomes-Gn; EBG00001274180.
DR   EnsemblGenomes-Gn; EBG00001274181.
DR   EnsemblGenomes-Gn; EBG00001274182.
DR   EnsemblGenomes-Gn; EBG00001274183.
DR   EnsemblGenomes-Gn; EBG00001274184.
DR   EnsemblGenomes-Gn; EBG00001274185.
DR   EnsemblGenomes-Gn; EBG00001274186.
DR   EnsemblGenomes-Gn; EBG00001274187.
DR   EnsemblGenomes-Gn; EBG00001274188.
DR   EnsemblGenomes-Gn; EBG00001274189.
DR   EnsemblGenomes-Gn; EBG00001274190.
DR   EnsemblGenomes-Gn; EBG00001274191.
DR   EnsemblGenomes-Gn; EBG00001274192.
DR   EnsemblGenomes-Gn; EBG00001274193.
DR   EnsemblGenomes-Gn; EBG00001274194.
DR   EnsemblGenomes-Gn; EBG00001274195.
DR   EnsemblGenomes-Gn; EBG00001274196.
DR   EnsemblGenomes-Gn; EBG00001274197.
DR   EnsemblGenomes-Gn; EBG00001274198.
DR   EnsemblGenomes-Gn; EBG00001274199.
DR   EnsemblGenomes-Gn; EBG00001274200.
DR   EnsemblGenomes-Gn; EBG00001274201.
DR   EnsemblGenomes-Gn; EBG00001274202.
DR   EnsemblGenomes-Gn; EBG00001274203.
DR   EnsemblGenomes-Gn; EBG00001274204.
DR   EnsemblGenomes-Gn; EBG00001274205.
DR   EnsemblGenomes-Gn; EBG00001274206.
DR   EnsemblGenomes-Gn; EBG00001274207.
DR   EnsemblGenomes-Gn; EBG00001274208.
DR   EnsemblGenomes-Gn; EBG00001274209.
DR   EnsemblGenomes-Gn; EBG00001274210.
DR   EnsemblGenomes-Gn; EBG00001274211.
DR   EnsemblGenomes-Gn; EBG00001274212.
DR   EnsemblGenomes-Gn; EBG00001274213.
DR   EnsemblGenomes-Gn; EBG00001274214.
DR   EnsemblGenomes-Gn; EBG00001274215.
DR   EnsemblGenomes-Gn; EBG00001274216.
DR   EnsemblGenomes-Gn; EBG00001274217.
DR   EnsemblGenomes-Gn; EBG00001274218.
DR   EnsemblGenomes-Gn; EBG00001274219.
DR   EnsemblGenomes-Gn; EBG00001274220.
DR   EnsemblGenomes-Gn; EBG00001274221.
DR   EnsemblGenomes-Gn; EBG00001274222.
DR   EnsemblGenomes-Gn; EBG00001274223.
DR   EnsemblGenomes-Gn; EBG00001274224.
DR   EnsemblGenomes-Gn; EBG00001274225.
DR   EnsemblGenomes-Gn; EBG00001274226.
DR   EnsemblGenomes-Gn; EBG00001274227.
DR   EnsemblGenomes-Gn; EBG00001274228.
DR   EnsemblGenomes-Gn; EBG00001274229.
DR   EnsemblGenomes-Gn; EBG00001274230.
DR   EnsemblGenomes-Gn; EBG00001274231.
DR   EnsemblGenomes-Gn; EBG00001274232.
DR   EnsemblGenomes-Gn; EBG00001274233.
DR   EnsemblGenomes-Gn; EBG00001274234.
DR   EnsemblGenomes-Gn; EBG00001274235.
DR   EnsemblGenomes-Gn; EBG00001274236.
DR   EnsemblGenomes-Gn; EBG00001274237.
DR   EnsemblGenomes-Gn; EBG00001274238.
DR   EnsemblGenomes-Gn; EBG00001274239.
DR   EnsemblGenomes-Gn; EBG00001274240.
DR   EnsemblGenomes-Gn; EBG00001274241.
DR   EnsemblGenomes-Gn; EBG00001274242.
DR   EnsemblGenomes-Gn; EBG00001274243.
DR   EnsemblGenomes-Gn; EBG00001274244.
DR   EnsemblGenomes-Gn; EBG00001274245.
DR   EnsemblGenomes-Gn; EBG00001274246.
DR   EnsemblGenomes-Gn; EBG00001274247.
DR   EnsemblGenomes-Gn; EBG00001274248.
DR   EnsemblGenomes-Gn; EBG00001274249.
DR   EnsemblGenomes-Gn; EBG00001274250.
DR   EnsemblGenomes-Gn; EBG00001274251.
DR   EnsemblGenomes-Gn; EBG00001274252.
DR   EnsemblGenomes-Gn; EBG00001274253.
DR   EnsemblGenomes-Gn; EBG00001274254.
DR   EnsemblGenomes-Gn; EBG00001274255.
DR   EnsemblGenomes-Gn; EBG00001274256.
DR   EnsemblGenomes-Gn; EBG00001274257.
DR   EnsemblGenomes-Gn; EBG00001274258.
DR   EnsemblGenomes-Tr; Dtox_R0001-1.
DR   EnsemblGenomes-Tr; Dtox_R0002-1.
DR   EnsemblGenomes-Tr; Dtox_R0003-1.
DR   EnsemblGenomes-Tr; Dtox_R0004-1.
DR   EnsemblGenomes-Tr; Dtox_R0005-1.
DR   EnsemblGenomes-Tr; Dtox_R0006-1.
DR   EnsemblGenomes-Tr; Dtox_R0007-1.
DR   EnsemblGenomes-Tr; Dtox_R0008-1.
DR   EnsemblGenomes-Tr; Dtox_R0009-1.
DR   EnsemblGenomes-Tr; Dtox_R0010-1.
DR   EnsemblGenomes-Tr; Dtox_R0011-1.
DR   EnsemblGenomes-Tr; Dtox_R0012-1.
DR   EnsemblGenomes-Tr; Dtox_R0013-1.
DR   EnsemblGenomes-Tr; Dtox_R0014-1.
DR   EnsemblGenomes-Tr; Dtox_R0015-1.
DR   EnsemblGenomes-Tr; Dtox_R0016-1.
DR   EnsemblGenomes-Tr; Dtox_R0017-1.
DR   EnsemblGenomes-Tr; Dtox_R0018-1.
DR   EnsemblGenomes-Tr; Dtox_R0019-1.
DR   EnsemblGenomes-Tr; Dtox_R0020-1.
DR   EnsemblGenomes-Tr; Dtox_R0021-1.
DR   EnsemblGenomes-Tr; Dtox_R0022-1.
DR   EnsemblGenomes-Tr; Dtox_R0023-1.
DR   EnsemblGenomes-Tr; Dtox_R0024-1.
DR   EnsemblGenomes-Tr; Dtox_R0025-1.
DR   EnsemblGenomes-Tr; Dtox_R0026-1.
DR   EnsemblGenomes-Tr; Dtox_R0027-1.
DR   EnsemblGenomes-Tr; Dtox_R0028-1.
DR   EnsemblGenomes-Tr; Dtox_R0029-1.
DR   EnsemblGenomes-Tr; Dtox_R0030-1.
DR   EnsemblGenomes-Tr; Dtox_R0031-1.
DR   EnsemblGenomes-Tr; Dtox_R0032-1.
DR   EnsemblGenomes-Tr; Dtox_R0033-1.
DR   EnsemblGenomes-Tr; Dtox_R0034-1.
DR   EnsemblGenomes-Tr; Dtox_R0035-1.
DR   EnsemblGenomes-Tr; Dtox_R0036-1.
DR   EnsemblGenomes-Tr; Dtox_R0037-1.
DR   EnsemblGenomes-Tr; Dtox_R0038-1.
DR   EnsemblGenomes-Tr; Dtox_R0039-1.
DR   EnsemblGenomes-Tr; Dtox_R0040-1.
DR   EnsemblGenomes-Tr; Dtox_R0041-1.
DR   EnsemblGenomes-Tr; Dtox_R0042-1.
DR   EnsemblGenomes-Tr; Dtox_R0043-1.
DR   EnsemblGenomes-Tr; Dtox_R0044-1.
DR   EnsemblGenomes-Tr; Dtox_R0045-1.
DR   EnsemblGenomes-Tr; Dtox_R0046-1.
DR   EnsemblGenomes-Tr; Dtox_R0047-1.
DR   EnsemblGenomes-Tr; Dtox_R0048-1.
DR   EnsemblGenomes-Tr; Dtox_R0049-1.
DR   EnsemblGenomes-Tr; Dtox_R0050-1.
DR   EnsemblGenomes-Tr; Dtox_R0051-1.
DR   EnsemblGenomes-Tr; Dtox_R0052-1.
DR   EnsemblGenomes-Tr; Dtox_R0053-1.
DR   EnsemblGenomes-Tr; Dtox_R0054-1.
DR   EnsemblGenomes-Tr; Dtox_R0055-1.
DR   EnsemblGenomes-Tr; Dtox_R0056-1.
DR   EnsemblGenomes-Tr; Dtox_R0057-1.
DR   EnsemblGenomes-Tr; Dtox_R0058-1.
DR   EnsemblGenomes-Tr; Dtox_R0059-1.
DR   EnsemblGenomes-Tr; Dtox_R0060-1.
DR   EnsemblGenomes-Tr; Dtox_R0061-1.
DR   EnsemblGenomes-Tr; Dtox_R0062-1.
DR   EnsemblGenomes-Tr; Dtox_R0063-1.
DR   EnsemblGenomes-Tr; Dtox_R0064-1.
DR   EnsemblGenomes-Tr; Dtox_R0065-1.
DR   EnsemblGenomes-Tr; Dtox_R0066-1.
DR   EnsemblGenomes-Tr; Dtox_R0067-1.
DR   EnsemblGenomes-Tr; Dtox_R0068-1.
DR   EnsemblGenomes-Tr; Dtox_R0069-1.
DR   EnsemblGenomes-Tr; Dtox_R0070-1.
DR   EnsemblGenomes-Tr; Dtox_R0071-1.
DR   EnsemblGenomes-Tr; Dtox_R0072-1.
DR   EnsemblGenomes-Tr; Dtox_R0073-1.
DR   EnsemblGenomes-Tr; Dtox_R0074-1.
DR   EnsemblGenomes-Tr; Dtox_R0075-1.
DR   EnsemblGenomes-Tr; Dtox_R0076-1.
DR   EnsemblGenomes-Tr; Dtox_R0077-1.
DR   EnsemblGenomes-Tr; Dtox_R0078-1.
DR   EnsemblGenomes-Tr; Dtox_R0079-1.
DR   EnsemblGenomes-Tr; Dtox_R0080-1.
DR   EnsemblGenomes-Tr; Dtox_R0081-1.
DR   EnsemblGenomes-Tr; Dtox_R0082-1.
DR   EnsemblGenomes-Tr; Dtox_R0083-1.
DR   EnsemblGenomes-Tr; Dtox_R0084-1.
DR   EnsemblGenomes-Tr; Dtox_R0085-1.
DR   EnsemblGenomes-Tr; Dtox_R0086-1.
DR   EnsemblGenomes-Tr; Dtox_R0087-1.
DR   EnsemblGenomes-Tr; Dtox_R0088-1.
DR   EnsemblGenomes-Tr; Dtox_R0089-1.
DR   EnsemblGenomes-Tr; Dtox_R0090-1.
DR   EnsemblGenomes-Tr; Dtox_R0091-1.
DR   EnsemblGenomes-Tr; Dtox_R0092-1.
DR   EnsemblGenomes-Tr; Dtox_R0093-1.
DR   EnsemblGenomes-Tr; Dtox_R0094-1.
DR   EnsemblGenomes-Tr; Dtox_R0095-1.
DR   EnsemblGenomes-Tr; Dtox_R0096-1.
DR   EnsemblGenomes-Tr; Dtox_R0097-1.
DR   EnsemblGenomes-Tr; Dtox_R0098-1.
DR   EnsemblGenomes-Tr; Dtox_R0099-1.
DR   EnsemblGenomes-Tr; Dtox_R0100-1.
DR   EnsemblGenomes-Tr; Dtox_R0101-1.
DR   EnsemblGenomes-Tr; EBT00001806238.
DR   EnsemblGenomes-Tr; EBT00001806239.
DR   EnsemblGenomes-Tr; EBT00001806240.
DR   EnsemblGenomes-Tr; EBT00001806241.
DR   EnsemblGenomes-Tr; EBT00001806242.
DR   EnsemblGenomes-Tr; EBT00001806243.
DR   EnsemblGenomes-Tr; EBT00001806244.
DR   EnsemblGenomes-Tr; EBT00001806245.
DR   EnsemblGenomes-Tr; EBT00001806246.
DR   EnsemblGenomes-Tr; EBT00001806247.
DR   EnsemblGenomes-Tr; EBT00001806248.
DR   EnsemblGenomes-Tr; EBT00001806249.
DR   EnsemblGenomes-Tr; EBT00001806250.
DR   EnsemblGenomes-Tr; EBT00001806251.
DR   EnsemblGenomes-Tr; EBT00001806252.
DR   EnsemblGenomes-Tr; EBT00001806253.
DR   EnsemblGenomes-Tr; EBT00001806254.
DR   EnsemblGenomes-Tr; EBT00001806255.
DR   EnsemblGenomes-Tr; EBT00001806256.
DR   EnsemblGenomes-Tr; EBT00001806257.
DR   EnsemblGenomes-Tr; EBT00001806258.
DR   EnsemblGenomes-Tr; EBT00001806259.
DR   EnsemblGenomes-Tr; EBT00001806260.
DR   EnsemblGenomes-Tr; EBT00001806261.
DR   EnsemblGenomes-Tr; EBT00001806262.
DR   EnsemblGenomes-Tr; EBT00001806263.
DR   EnsemblGenomes-Tr; EBT00001806264.
DR   EnsemblGenomes-Tr; EBT00001806265.
DR   EnsemblGenomes-Tr; EBT00001806266.
DR   EnsemblGenomes-Tr; EBT00001806267.
DR   EnsemblGenomes-Tr; EBT00001806268.
DR   EnsemblGenomes-Tr; EBT00001806269.
DR   EnsemblGenomes-Tr; EBT00001806270.
DR   EnsemblGenomes-Tr; EBT00001806271.
DR   EnsemblGenomes-Tr; EBT00001806272.
DR   EnsemblGenomes-Tr; EBT00001806273.
DR   EnsemblGenomes-Tr; EBT00001806274.
DR   EnsemblGenomes-Tr; EBT00001806275.
DR   EnsemblGenomes-Tr; EBT00001806276.
DR   EnsemblGenomes-Tr; EBT00001806277.
DR   EnsemblGenomes-Tr; EBT00001806278.
DR   EnsemblGenomes-Tr; EBT00001806279.
DR   EnsemblGenomes-Tr; EBT00001806280.
DR   EnsemblGenomes-Tr; EBT00001806281.
DR   EnsemblGenomes-Tr; EBT00001806282.
DR   EnsemblGenomes-Tr; EBT00001806283.
DR   EnsemblGenomes-Tr; EBT00001806284.
DR   EnsemblGenomes-Tr; EBT00001806285.
DR   EnsemblGenomes-Tr; EBT00001806286.
DR   EnsemblGenomes-Tr; EBT00001806287.
DR   EnsemblGenomes-Tr; EBT00001806288.
DR   EnsemblGenomes-Tr; EBT00001806289.
DR   EnsemblGenomes-Tr; EBT00001806290.
DR   EnsemblGenomes-Tr; EBT00001806291.
DR   EnsemblGenomes-Tr; EBT00001806292.
DR   EnsemblGenomes-Tr; EBT00001806293.
DR   EnsemblGenomes-Tr; EBT00001806294.
DR   EnsemblGenomes-Tr; EBT00001806295.
DR   EnsemblGenomes-Tr; EBT00001806296.
DR   EnsemblGenomes-Tr; EBT00001806297.
DR   EnsemblGenomes-Tr; EBT00001806298.
DR   EnsemblGenomes-Tr; EBT00001806299.
DR   EnsemblGenomes-Tr; EBT00001806300.
DR   EnsemblGenomes-Tr; EBT00001806301.
DR   EnsemblGenomes-Tr; EBT00001806302.
DR   EnsemblGenomes-Tr; EBT00001806303.
DR   EnsemblGenomes-Tr; EBT00001806304.
DR   EnsemblGenomes-Tr; EBT00001806305.
DR   EnsemblGenomes-Tr; EBT00001806306.
DR   EnsemblGenomes-Tr; EBT00001806307.
DR   EnsemblGenomes-Tr; EBT00001806308.
DR   EnsemblGenomes-Tr; EBT00001806309.
DR   EnsemblGenomes-Tr; EBT00001806310.
DR   EnsemblGenomes-Tr; EBT00001806311.
DR   EnsemblGenomes-Tr; EBT00001806312.
DR   EnsemblGenomes-Tr; EBT00001806313.
DR   EnsemblGenomes-Tr; EBT00001806314.
DR   EnsemblGenomes-Tr; EBT00001806315.
DR   EnsemblGenomes-Tr; EBT00001806316.
DR   EnsemblGenomes-Tr; EBT00001806317.
DR   EnsemblGenomes-Tr; EBT00001806318.
DR   EnsemblGenomes-Tr; EBT00001806319.
DR   EnsemblGenomes-Tr; EBT00001806320.
DR   EnsemblGenomes-Tr; EBT00001806321.
DR   EnsemblGenomes-Tr; EBT00001806322.
DR   EnsemblGenomes-Tr; EBT00001806323.
DR   EnsemblGenomes-Tr; EBT00001806324.
DR   EnsemblGenomes-Tr; EBT00001806325.
DR   EnsemblGenomes-Tr; EBT00001806326.
DR   EnsemblGenomes-Tr; EBT00001806327.
DR   EnsemblGenomes-Tr; EBT00001806328.
DR   EnsemblGenomes-Tr; EBT00001806329.
DR   EnsemblGenomes-Tr; EBT00001806330.
DR   EnsemblGenomes-Tr; EBT00001806331.
DR   EnsemblGenomes-Tr; EBT00001806332.
DR   EnsemblGenomes-Tr; EBT00001806333.
DR   EnsemblGenomes-Tr; EBT00001806334.
DR   EnsemblGenomes-Tr; EBT00001806335.
DR   EnsemblGenomes-Tr; EBT00001806336.
DR   EnsemblGenomes-Tr; EBT00001806337.
DR   EnsemblGenomes-Tr; EBT00001806338.
DR   EnsemblGenomes-Tr; EBT00001806339.
DR   EnsemblGenomes-Tr; EBT00001806340.
DR   EnsemblGenomes-Tr; EBT00001806341.
DR   EnsemblGenomes-Tr; EBT00001806342.
DR   EnsemblGenomes-Tr; EBT00001806343.
DR   EnsemblGenomes-Tr; EBT00001806344.
DR   EnsemblGenomes-Tr; EBT00001806345.
DR   EnsemblGenomes-Tr; EBT00001806346.
DR   EnsemblGenomes-Tr; EBT00001806347.
DR   EnsemblGenomes-Tr; EBT00001806348.
DR   EnsemblGenomes-Tr; EBT00001806349.
DR   EnsemblGenomes-Tr; EBT00001806350.
DR   EnsemblGenomes-Tr; EBT00001806351.
DR   EnsemblGenomes-Tr; EBT00001806352.
DR   EnsemblGenomes-Tr; EBT00001806353.
DR   EnsemblGenomes-Tr; EBT00001806354.
DR   EnsemblGenomes-Tr; EBT00001806355.
DR   EnsemblGenomes-Tr; EBT00001806356.
DR   EnsemblGenomes-Tr; EBT00001806357.
DR   EnsemblGenomes-Tr; EBT00001806358.
DR   EnsemblGenomes-Tr; EBT00001806359.
DR   EnsemblGenomes-Tr; EBT00001806360.
DR   EnsemblGenomes-Tr; EBT00001806361.
DR   EnsemblGenomes-Tr; EBT00001806362.
DR   EnsemblGenomes-Tr; EBT00001806363.
DR   EnsemblGenomes-Tr; EBT00001806364.
DR   EnsemblGenomes-Tr; EBT00001806365.
DR   EnsemblGenomes-Tr; EBT00001806366.
DR   EnsemblGenomes-Tr; EBT00001806367.
DR   EnsemblGenomes-Tr; EBT00001806368.
DR   EnsemblGenomes-Tr; EBT00001806369.
DR   EnsemblGenomes-Tr; EBT00001806370.
DR   EnsemblGenomes-Tr; EBT00001806371.
DR   EnsemblGenomes-Tr; EBT00001806372.
DR   EnsemblGenomes-Tr; EBT00001806373.
DR   EnsemblGenomes-Tr; EBT00001806374.
DR   EnsemblGenomes-Tr; EBT00001806375.
DR   EnsemblGenomes-Tr; EBT00001806376.
DR   EnsemblGenomes-Tr; EBT00001806377.
DR   EnsemblGenomes-Tr; EBT00001806378.
DR   EnsemblGenomes-Tr; EBT00001806379.
DR   EnsemblGenomes-Tr; EBT00001806380.
DR   EnsemblGenomes-Tr; EBT00001806381.
DR   EnsemblGenomes-Tr; EBT00001806382.
DR   EnsemblGenomes-Tr; EBT00001806383.
DR   EnsemblGenomes-Tr; EBT00001806384.
DR   EnsemblGenomes-Tr; EBT00001806385.
DR   EnsemblGenomes-Tr; EBT00001806386.
DR   EnsemblGenomes-Tr; EBT00001806387.
DR   EnsemblGenomes-Tr; EBT00001806388.
DR   EnsemblGenomes-Tr; EBT00001806389.
DR   EnsemblGenomes-Tr; EBT00001806390.
DR   EnsemblGenomes-Tr; EBT00001806391.
DR   EnsemblGenomes-Tr; EBT00001806392.
DR   EnsemblGenomes-Tr; EBT00001806393.
DR   EnsemblGenomes-Tr; EBT00001806394.
DR   EnsemblGenomes-Tr; EBT00001806395.
DR   EnsemblGenomes-Tr; EBT00001806396.
DR   EnsemblGenomes-Tr; EBT00001806397.
DR   EnsemblGenomes-Tr; EBT00001806398.
DR   EnsemblGenomes-Tr; EBT00001806399.
DR   EnsemblGenomes-Tr; EBT00001806400.
DR   EnsemblGenomes-Tr; EBT00001806401.
DR   EnsemblGenomes-Tr; EBT00001806402.
DR   EnsemblGenomes-Tr; EBT00001806403.
DR   EnsemblGenomes-Tr; EBT00001806404.
DR   EnsemblGenomes-Tr; EBT00001806405.
DR   EnsemblGenomes-Tr; EBT00001806406.
DR   EnsemblGenomes-Tr; EBT00001806407.
DR   EnsemblGenomes-Tr; EBT00001806408.
DR   EnsemblGenomes-Tr; EBT00001806409.
DR   EnsemblGenomes-Tr; EBT00001806410.
DR   EnsemblGenomes-Tr; EBT00001806411.
DR   EnsemblGenomes-Tr; EBT00001806412.
DR   EnsemblGenomes-Tr; EBT00001806413.
DR   EnsemblGenomes-Tr; EBT00001806414.
DR   EnsemblGenomes-Tr; EBT00001806415.
DR   EnsemblGenomes-Tr; EBT00001806416.
DR   EnsemblGenomes-Tr; EBT00001806417.
DR   EnsemblGenomes-Tr; EBT00001806418.
DR   EnsemblGenomes-Tr; EBT00001806419.
DR   EnsemblGenomes-Tr; EBT00001806420.
DR   EnsemblGenomes-Tr; EBT00001806421.
DR   EnsemblGenomes-Tr; EBT00001806422.
DR   EnsemblGenomes-Tr; EBT00001806423.
DR   EnsemblGenomes-Tr; EBT00001806424.
DR   EnsemblGenomes-Tr; EBT00001806425.
DR   EnsemblGenomes-Tr; EBT00001806426.
DR   EnsemblGenomes-Tr; EBT00001806427.
DR   EnsemblGenomes-Tr; EBT00001806428.
DR   EnsemblGenomes-Tr; EBT00001806429.
DR   EnsemblGenomes-Tr; EBT00001806430.
DR   EnsemblGenomes-Tr; EBT00001806431.
DR   EnsemblGenomes-Tr; EBT00001806432.
DR   EnsemblGenomes-Tr; EBT00001806433.
DR   EnsemblGenomes-Tr; EBT00001806434.
DR   EnsemblGenomes-Tr; EBT00001806435.
DR   EnsemblGenomes-Tr; EBT00001806436.
DR   EnsemblGenomes-Tr; EBT00001806437.
DR   EnsemblGenomes-Tr; EBT00001806438.
DR   EnsemblGenomes-Tr; EBT00001806439.
DR   EnsemblGenomes-Tr; EBT00001806440.
DR   EnsemblGenomes-Tr; EBT00001806441.
DR   EnsemblGenomes-Tr; EBT00001806442.
DR   EnsemblGenomes-Tr; EBT00001806443.
DR   EnsemblGenomes-Tr; EBT00001806444.
DR   EnsemblGenomes-Tr; EBT00001806445.
DR   EnsemblGenomes-Tr; EBT00001806446.
DR   EnsemblGenomes-Tr; EBT00001806447.
DR   EnsemblGenomes-Tr; EBT00001806448.
DR   EnsemblGenomes-Tr; EBT00001806449.
DR   EnsemblGenomes-Tr; EBT00001806450.
DR   EnsemblGenomes-Tr; EBT00001806451.
DR   EnsemblGenomes-Tr; EBT00001806452.
DR   EnsemblGenomes-Tr; EBT00001806453.
DR   EnsemblGenomes-Tr; EBT00001806454.
DR   EnsemblGenomes-Tr; EBT00001806455.
DR   EnsemblGenomes-Tr; EBT00001806456.
DR   EnsemblGenomes-Tr; EBT00001806457.
DR   EnsemblGenomes-Tr; EBT00001806458.
DR   EnsemblGenomes-Tr; EBT00001806459.
DR   EnsemblGenomes-Tr; EBT00001806460.
DR   EnsemblGenomes-Tr; EBT00001806461.
DR   EnsemblGenomes-Tr; EBT00001806462.
DR   EnsemblGenomes-Tr; EBT00001806463.
DR   EnsemblGenomes-Tr; EBT00001806464.
DR   EnsemblGenomes-Tr; EBT00001806465.
DR   EnsemblGenomes-Tr; EBT00001806466.
DR   EnsemblGenomes-Tr; EBT00001806467.
DR   EnsemblGenomes-Tr; EBT00001806468.
DR   EnsemblGenomes-Tr; EBT00001806469.
DR   EnsemblGenomes-Tr; EBT00001806470.
DR   EnsemblGenomes-Tr; EBT00001806471.
DR   EnsemblGenomes-Tr; EBT00001806472.
DR   EnsemblGenomes-Tr; EBT00001806473.
DR   EnsemblGenomes-Tr; EBT00001806474.
DR   EnsemblGenomes-Tr; EBT00001806475.
DR   EnsemblGenomes-Tr; EBT00001806476.
DR   EnsemblGenomes-Tr; EBT00001806477.
DR   EnsemblGenomes-Tr; EBT00001806478.
DR   EnsemblGenomes-Tr; EBT00001806479.
DR   EnsemblGenomes-Tr; EBT00001806480.
DR   EnsemblGenomes-Tr; EBT00001806481.
DR   EnsemblGenomes-Tr; EBT00001806482.
DR   EuropePMC; PMC6136694; 30212463.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001720.
DR   SILVA-SSU; CP001720.
DR   StrainInfo; 113915; 1.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082966
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Desulfotomaculum acetoxidans 5575, DSM 771
CC   Culture Collection ID :: DSM 771, ATCC 49208, VKM B-1644
CC   GOLD Stamp ID         :: Gi02239
CC   Greengenes ID         :: 13678
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Piggery waste in Gottingen, Germany
CC   Isolation Country     :: Germany
CC   Latitude              :: 51.533333
CC   Longitude             :: 9.933333
CC   Oxygen Requirement    :: Obligate anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   pH                    :: 7 - 7.2
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Animal intestinal microflora, Fresh water,
CC                            Mud, Sea water, Soil
CC   Phenotypes            :: Hydrogen sulfide gas release, Sulfate
CC                            reducer
CC   ##Metadata-END##
FH   Key             Location/Qualifiers
FT   source          1..4545624
FT                   /organism="Desulfofarcimen acetoxidans DSM 771"
FT                   /strain="DSM 771"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:485916"
FT                   /culture_collection="DSM:771"
FT   gene            31..1371
FT                   /locus_tag="Dtox_0001"
FT   CDS_pept        31..1371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60966"
FT                   /db_xref="GOA:C8VV97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV97"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACV60966.1"
FT   gene            1591..2694
FT                   /locus_tag="Dtox_0002"
FT   CDS_pept        1591..2694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0597 DNA polymerase III beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60967"
FT                   /db_xref="GOA:C8VV98"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV98"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACV60967.1"
FT   gene            2713..2928
FT                   /locus_tag="Dtox_0003"
FT   CDS_pept        2713..2928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   geo:Geob_1253 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60968"
FT                   /db_xref="GOA:C8VV99"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV99"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACV60968.1"
FT   gene            2952..4082
FT                   /locus_tag="Dtox_0004"
FT   CDS_pept        2952..4082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: baa:BA_0599 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60969"
FT                   /db_xref="GOA:C8VVA0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACV60969.1"
FT   gene            4083..4331
FT                   /locus_tag="Dtox_0005"
FT   CDS_pept        4083..4331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60970"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA1"
FT                   /inference="similar to AA sequence:KEGG:BH0005"
FT                   /protein_id="ACV60970.1"
FT   gene            4580..6487
FT                   /locus_tag="Dtox_0006"
FT   CDS_pept        4580..6487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60971"
FT                   /db_xref="GOA:C8VVA2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACV60971.1"
FT                   "
FT   gene            6533..8968
FT                   /locus_tag="Dtox_0007"
FT   CDS_pept        6533..8968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH0007 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60972"
FT                   /db_xref="GOA:C8VVA3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACV60972.1"
FT   gene            9395..9616
FT                   /locus_tag="Dtox_0008"
FT   CDS_pept        9395..9616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60973"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60973.1"
FT   gene            9951..11333
FT                   /locus_tag="Dtox_0009"
FT   CDS_pept        9951..11333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0009"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sat:SYN_02917 FAD-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60974"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACV60974.1"
FT                   NK"
FT   gene            11364..12647
FT                   /locus_tag="Dtox_0010"
FT   CDS_pept        11364..12647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0010"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU40420 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60975"
FT                   /db_xref="GOA:C8VVA6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA6"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACV60975.1"
FT   gene            12772..12847
FT                   /locus_tag="Dtox_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            12772..12847
FT                   /locus_tag="Dtox_R0001"
FT                   /product="tRNA-Lys"
FT   gene            12851..12926
FT                   /locus_tag="Dtox_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            12851..12926
FT                   /locus_tag="Dtox_R0002"
FT                   /product="tRNA-Glu"
FT   gene            13021..15402
FT                   /locus_tag="Dtox_0011"
FT   CDS_pept        13021..15402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0011"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="KEGG: nmu:Nmul_A2304 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; HRDC domain protein; SMART: helicase domain
FT                   protein; HRDC domain protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60976"
FT                   /db_xref="GOA:C8VVA7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029491"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA7"
FT                   /inference="protein motif:TFAM:TIGR00614"
FT                   /protein_id="ACV60976.1"
FT   gene            15463..15537
FT                   /locus_tag="Dtox_R0003"
FT                   /note="tRNA-Gly1"
FT   tRNA            15463..15537
FT                   /locus_tag="Dtox_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(15672..16171)
FT                   /pseudo
FT                   /locus_tag="Dtox_0012"
FT   gene            16460..16975
FT                   /locus_tag="Dtox_0013"
FT   CDS_pept        16460..16975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60977"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60977.1"
FT                   EEVSYNGH"
FT   gene            16965..17210
FT                   /locus_tag="Dtox_0014"
FT   CDS_pept        16965..17210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60978"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60978.1"
FT   gene            17213..17644
FT                   /locus_tag="Dtox_0015"
FT   CDS_pept        17213..17644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_3490 protein export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60979"
FT                   /db_xref="GOA:C8VVB0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60979.1"
FT   gene            complement(18103..18381)
FT                   /locus_tag="Dtox_0016"
FT   CDS_pept        complement(18103..18381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60980"
FT                   /db_xref="GOA:C8VVB1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60980.1"
FT   gene            18498..19040
FT                   /locus_tag="Dtox_0017"
FT   CDS_pept        18498..19040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0017"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   noc:Noc_2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60981"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB2"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACV60981.1"
FT                   SPLLSGLEINMKELFDI"
FT   gene            19563..20468
FT                   /locus_tag="Dtox_0018"
FT   CDS_pept        19563..20468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0018"
FT                   /product="Domain of unknown function DUF1848"
FT                   /note="PFAM: Domain of unknown function DUF1848; KEGG:
FT                   ppd:Ppro_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60982"
FT                   /db_xref="InterPro:IPR014998"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB3"
FT                   /inference="protein motif:PFAM:PF08902"
FT                   /protein_id="ACV60982.1"
FT   gene            complement(20864..21844)
FT                   /locus_tag="Dtox_0019"
FT   CDS_pept        complement(20864..21844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0019"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: xau:Xaut_3952 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60983"
FT                   /db_xref="GOA:C8VVB4"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB4"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACV60983.1"
FT   gene            22081..22455
FT                   /locus_tag="Dtox_0020"
FT   CDS_pept        22081..22455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0020"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: eca:ECA2828
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60984"
FT                   /db_xref="GOA:C8VVB5"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB5"
FT                   /inference="protein motif:PFAM:PF03788"
FT                   /protein_id="ACV60984.1"
FT   gene            22461..23162
FT                   /locus_tag="Dtox_0021"
FT   CDS_pept        22461..23162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0021"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: tcx:Tcr_1938
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60985"
FT                   /db_xref="GOA:C8VVB6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB6"
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /protein_id="ACV60985.1"
FT                   SMINIFKEYIF"
FT   gene            complement(23189..23683)
FT                   /locus_tag="Dtox_0022"
FT   CDS_pept        complement(23189..23683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0022"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: ilo:IL0694
FT                   DNA-binding transcriptional regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60986"
FT                   /db_xref="GOA:C8VVB7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB7"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACV60986.1"
FT                   E"
FT   gene            24271..25284
FT                   /locus_tag="Dtox_0023"
FT   CDS_pept        24271..25284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0023"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   dal:Dalk_2920 cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60987"
FT                   /db_xref="GOA:C8VVB8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB8"
FT                   /inference="protein motif:PFAM:PF01208"
FT                   /protein_id="ACV60987.1"
FT   gene            25296..25958
FT                   /locus_tag="Dtox_0024"
FT   CDS_pept        25296..25958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0024"
FT                   /product="methyltransferase cognate corrinoid protein"
FT                   /note="TIGRFAM: methyltransferase cognate corrinoid
FT                   protein; PFAM: cobalamin B12-binding domain protein;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   KEGG: geo:Geob_2541 cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60988"
FT                   /db_xref="GOA:C8VVB9"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR012741"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB9"
FT                   /inference="protein motif:TFAM:TIGR02370"
FT                   /protein_id="ACV60988.1"
FT   gene            25960..27348
FT                   /locus_tag="Dtox_0025"
FT   CDS_pept        25960..27348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:26566..26568,aa:Pyl)
FT                   /locus_tag="Dtox_0025"
FT                   /product="Monomethylamine methyltransferase MtmB"
FT                   /note="PFAM: Monomethylamine methyltransferase MtmB;
FT                   Contains pyrrolysine"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60989"
FT                   /db_xref="GOA:C8VVC4"
FT                   /db_xref="InterPro:IPR008031"
FT                   /db_xref="InterPro:IPR036655"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC4"
FT                   /inference="protein motif:PFAM:PF05369"
FT                   /protein_id="ACV60989.1"
FT                   YWTK"
FT   gene            27663..29606
FT                   /locus_tag="Dtox_0026"
FT   CDS_pept        27663..29606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0026"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: sit:TM1040_1226 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60990"
FT                   /db_xref="GOA:C8VVC5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR040506"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC5"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACV60990.1"
FT                   PHMQNILDGEEK"
FT   gene            29729..30565
FT                   /locus_tag="Dtox_0027"
FT   CDS_pept        29729..30565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0027"
FT                   /product="Pyrrolysine-tRNA ligase"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   wpi:WPa_1006 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60991"
FT                   /db_xref="GOA:C8VVC8"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC8"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV60991.1"
FT   gene            30609..31715
FT                   /locus_tag="Dtox_0028"
FT   CDS_pept        30609..31715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0028"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dat:HRM2_15240 BioB2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60992"
FT                   /db_xref="GOA:C8VVC9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023891"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV60992.1"
FT   gene            31706..32866
FT                   /locus_tag="Dtox_0029"
FT   CDS_pept        31706..32866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0029"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   abu:Abu_2250 ATP-grasp domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60993"
FT                   /db_xref="GOA:C8VVD0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD0"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ACV60993.1"
FT   gene            32918..33733
FT                   /locus_tag="Dtox_0030"
FT   CDS_pept        32918..33733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsk:RSKD131_3009 alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60994"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR023914"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60994.1"
FT   gene            33752..34114
FT                   /locus_tag="Dtox_0031"
FT   CDS_pept        33752..34114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_15230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60995"
FT                   /db_xref="GOA:C8VVE4"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE4"
FT                   /inference="similar to AA sequence:KEGG:HRM2_15230"
FT                   /protein_id="ACV60995.1"
FT                   EKYTTTMMTQKWGSGL"
FT   gene            34794..36182
FT                   /locus_tag="Dtox_0032"
FT   CDS_pept        34794..36182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0032"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: sfu:Sfum_0727 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60996"
FT                   /db_xref="GOA:C8VVC0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACV60996.1"
FT                   KPAF"
FT   sig_peptide     34794..34865
FT                   /locus_tag="Dtox_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 24"
FT   gene            36240..36578
FT                   /locus_tag="Dtox_0033"
FT   CDS_pept        36240..36578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0033"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   lhk:LHK_01236 GlnB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60997"
FT                   /db_xref="GOA:C8VVC1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC1"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACV60997.1"
FT                   GETGENAI"
FT   gene            complement(36797..37036)
FT                   /locus_tag="Dtox_0034"
FT   CDS_pept        complement(36797..37036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60998"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60998.1"
FT   gene            37173..37316
FT                   /locus_tag="Dtox_0035"
FT   CDS_pept        37173..37316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60999"
FT                   /db_xref="GOA:C8VVC3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60999.1"
FT                   SN"
FT   gene            37341..38129
FT                   /locus_tag="Dtox_0036"
FT   CDS_pept        37341..38129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0036"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   avi:Avi_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61000"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC6"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ACV61000.1"
FT   gene            complement(38143..38841)
FT                   /locus_tag="Dtox_0037"
FT   CDS_pept        complement(38143..38841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0037"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   mmr:Mmar10_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61001"
FT                   /db_xref="GOA:C8VVC7"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC7"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ACV61001.1"
FT                   EYQKTHVRKV"
FT   gene            complement(38838..39107)
FT                   /locus_tag="Dtox_0038"
FT   CDS_pept        complement(38838..39107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0038"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bsu:BSU33790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61002"
FT                   /db_xref="GOA:C8VVD1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD1"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV61002.1"
FT   gene            39354..40082
FT                   /locus_tag="Dtox_0039"
FT   CDS_pept        39354..40082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0039"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="TIGRFAM: spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; Peptidoglycan- binding domain 1 protein;
FT                   KEGG: bar:GBAA2748 spore cortex-lytic enzyme prepeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61003"
FT                   /db_xref="GOA:C8VVD2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD2"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ACV61003.1"
FT   sig_peptide     39354..39455
FT                   /locus_tag="Dtox_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 34"
FT   gene            40101..41465
FT                   /locus_tag="Dtox_0040"
FT   CDS_pept        40101..41465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0040"
FT                   /product="germination protein YpeB"
FT                   /note="TIGRFAM: germination protein YpeB; PFAM: Propeptide
FT                   PepSY amd peptidase M4; KEGG: bha:BH1632 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61004"
FT                   /db_xref="GOA:C8VVD3"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD3"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ACV61004.1"
FT   gene            41935..43143
FT                   /locus_tag="Dtox_0041"
FT   CDS_pept        41935..43143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0041"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class V; KEGG: bha:BH3350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61005"
FT                   /db_xref="GOA:C8VVD5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV61005.1"
FT                   YSS"
FT   gene            43421..44719
FT                   /locus_tag="Dtox_0042"
FT   CDS_pept        43421..44719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0042"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number=""
FT                   /note="KEGG: gsu:GSU1729 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61006"
FT                   /db_xref="GOA:C8VVD6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61006.1"
FT   gene            44861..45118
FT                   /pseudo
FT                   /locus_tag="Dtox_0043"
FT   gene            45177..46634
FT                   /locus_tag="Dtox_0044"
FT   CDS_pept        45177..46634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0044"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; KEGG:
FT                   bar:GBAA1783 IS605 family transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61007"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61007.1"
FT   gene            46902..48671
FT                   /locus_tag="Dtox_0045"
FT   CDS_pept        46902..48671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0045"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit; PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: geo:Geob_2794 indolepyruvate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61008"
FT                   /db_xref="GOA:C8VVD8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD8"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ACV61008.1"
FT                   KHGALRQGGERNE"
FT   gene            48664..49239
FT                   /locus_tag="Dtox_0046"
FT   CDS_pept        48664..49239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0046"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number=""
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: glo:Glov_1857 indolepyruvate ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61009"
FT                   /db_xref="GOA:C8VVD9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61009.1"
FT   gene            complement(49431..51647)
FT                   /locus_tag="Dtox_0047"
FT   CDS_pept        complement(49431..51647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0047"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: nmu:Nmul_A0328 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; GGDEF
FT                   domain-containing protein; PAS fold domain protein; SMART:
FT                   EAL domain protein; GGDEF domain-containing protein; PAC
FT                   repeat-containing protein; PAS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61010"
FT                   /db_xref="GOA:C8VVE0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV61010.1"
FT   gene            complement(51719..52291)
FT                   /locus_tag="Dtox_0048"
FT   CDS_pept        complement(51719..52291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61011"
FT                   /db_xref="GOA:C8VVE1"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61011.1"
FT   gene            complement(52663..54123)
FT                   /locus_tag="Dtox_0049"
FT   CDS_pept        complement(52663..54123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0049"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: dvl:Dvul_2284 two component, sigma54 specific, Fis
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61012"
FT                   /db_xref="GOA:C8VVE2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV61012.1"
FT   gene            complement(54120..56735)
FT                   /locus_tag="Dtox_0050"
FT   CDS_pept        complement(54120..56735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0050"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dvu:DVUA0087 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61013"
FT                   /db_xref="GOA:C8VVE3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61013.1"
FT                   "
FT   gene            57041..57463
FT                   /locus_tag="Dtox_0051"
FT   CDS_pept        57041..57463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0051"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   bsu:BSU37340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61014"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE5"
FT                   /inference="protein motif:PFAM:PF09148"
FT                   /protein_id="ACV61014.1"
FT   gene            57471..59183
FT                   /locus_tag="Dtox_0052"
FT   CDS_pept        57471..59183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0052"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH3808 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61015"
FT                   /db_xref="GOA:C8VVE6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE6"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACV61015.1"
FT   gene            59197..59370
FT                   /locus_tag="Dtox_0053"
FT   CDS_pept        59197..59370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_3656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61016"
FT                   /db_xref="GOA:C8VVE7"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61016.1"
FT                   YILAVRVMGWGK"
FT   sig_peptide     59197..59262
FT                   /locus_tag="Dtox_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.662 at
FT                   residue 22"
FT   gene            59444..61054
FT                   /locus_tag="Dtox_0054"
FT   CDS_pept        59444..61054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0054"
FT                   /product="CTP synthase"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61017"
FT                   /db_xref="GOA:C8VVE8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE8"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACV61017.1"
FT   gene            61350..61751
FT                   /locus_tag="Dtox_0055"
FT   CDS_pept        61350..61751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0055"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: bsu:BSU37130 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61018"
FT                   /db_xref="GOA:C8VVE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61018.1"
FT   gene            61854..62534
FT                   /locus_tag="Dtox_0056"
FT   CDS_pept        61854..62534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61019"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61019.1"
FT                   RRRK"
FT   gene            62600..63454
FT                   /locus_tag="Dtox_0057"
FT   CDS_pept        62600..63454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0057"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH3786 fructose-1,6-bisphosphate aldolase;
FT                   TIGRFAM: fructose-1,6-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61020"
FT                   /db_xref="GOA:C8VVF1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF1"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ACV61020.1"
FT                   GKA"
FT   gene            63460..64119
FT                   /locus_tag="Dtox_0058"
FT   CDS_pept        63460..64119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0058"
FT                   /product="transaldolase"
FT                   /EC_number=""
FT                   /note="KEGG: geo:Geob_0911 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61021"
FT                   /db_xref="GOA:C8VVF5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF5"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACV61021.1"
FT   gene            64192..65502
FT                   /locus_tag="Dtox_0059"
FT   CDS_pept        64192..65502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0059"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: bar:GBAA5575 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Ribonuclease B OB region domain; Rho termination
FT                   factor domain protein; Rho termination factor RNA-binding;
FT                   SMART: Cold shock protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61022"
FT                   /db_xref="GOA:C8VVF6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF6"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ACV61022.1"
FT   gene            65587..66549
FT                   /locus_tag="Dtox_0060"
FT   CDS_pept        65587..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0060"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Peptidoglycan-binding LysM;
FT                   SMART: Peptidoglycan-binding LysM; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61023"
FT                   /db_xref="GOA:C8VVF7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACV61023.1"
FT   gene            66645..67910
FT                   /locus_tag="Dtox_0061"
FT   CDS_pept        66645..67910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0061"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gme:Gmet_2730 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61024"
FT                   /db_xref="GOA:C8VVF8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61024.1"
FT   gene            68055..68261
FT                   /locus_tag="Dtox_0062"
FT   CDS_pept        68055..68261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0062"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: ilo:IL2462 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61025"
FT                   /db_xref="GOA:C8VVF9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF9"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACV61025.1"
FT   gene            68532..69407
FT                   /locus_tag="Dtox_0063"
FT   CDS_pept        68532..69407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0063"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   gme:Gmet_0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61026"
FT                   /db_xref="GOA:C8VVG0"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG0"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ACV61026.1"
FT                   AVLKDGEASV"
FT   gene            69400..70467
FT                   /locus_tag="Dtox_0064"
FT   CDS_pept        69400..70467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0064"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   bsu:BSU37010 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61027"
FT                   /db_xref="GOA:C8VVG1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG1"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACV61027.1"
FT                   ALITTDQADRLRSTE"
FT   gene            70489..71358
FT                   /locus_tag="Dtox_0065"
FT   CDS_pept        70489..71358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0065"
FT                   /product="modification methylase, HemK family"
FT                   /EC_number=""
FT                   /note="KEGG: gsu:GSU3103 HemK family modification
FT                   methylase; TIGRFAM: modification methylase, HemK family;
FT                   PFAM: methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61028"
FT                   /db_xref="GOA:C8VVG2"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG2"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACV61028.1"
FT                   RVVLAEKE"
FT   gene            71904..72830
FT                   /locus_tag="Dtox_0066"
FT   CDS_pept        71904..72830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0066"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /note="PFAM: CheW domain protein; response regulator
FT                   receiver; SMART: CheW domain protein; response regulator
FT                   receiver; KEGG: bha:BH2262 modulation of CheA activity in
FT                   response to attractants (chemotaxis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61029"
FT                   /db_xref="GOA:C8VVG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACV61029.1"
FT   gene            73077..73337
FT                   /locus_tag="Dtox_0067"
FT   CDS_pept        73077..73337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61030"
FT                   /db_xref="GOA:C8VVG4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61030.1"
FT   gene            73396..73548
FT                   /locus_tag="Dtox_0068"
FT   CDS_pept        73396..73548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61031"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61031.1"
FT                   KEKQN"
FT   gene            73616..74974
FT                   /locus_tag="Dtox_0069"
FT   CDS_pept        73616..74974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0069"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   nar:Saro_3029 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61032"
FT                   /db_xref="GOA:C8VVG7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024025"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61032.1"
FT   gene            75136..75741
FT                   /locus_tag="Dtox_0070"
FT   CDS_pept        75136..75741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0070"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: TPR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61033"
FT                   /db_xref="GOA:C8VVG8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG8"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACV61033.1"
FT   sig_peptide     75136..75267
FT                   /locus_tag="Dtox_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.422 at
FT                   residue 44"
FT   gene            75959..76873
FT                   /locus_tag="Dtox_0071"
FT   CDS_pept        75959..76873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2630 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61034"
FT                   /db_xref="GOA:C8VVG9"
FT                   /db_xref="InterPro:IPR039568"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61034.1"
FT   sig_peptide     75959..76090
FT                   /locus_tag="Dtox_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.643 at
FT                   residue 44"
FT   gene            76973..78229
FT                   /locus_tag="Dtox_0072"
FT   CDS_pept        76973..78229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0072"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bha:BH3784 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61035"
FT                   /db_xref="GOA:C8VVH0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVH0"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACV61035.1"
FT   gene            78247..78726
FT                   /locus_tag="Dtox_0073"
FT   CDS_pept        78247..78726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0073"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   bha:BH4007 SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61036"
FT                   /db_xref="GOA:C8VVF2"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF2"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACV61036.1"
FT   gene            78981..79169
FT                   /locus_tag="Dtox_0074"
FT   CDS_pept        78981..79169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0074"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_0113 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61037"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61037.1"
FT                   ETCVSVCPAGATSIEEK"
FT   gene            79361..80230
FT                   /locus_tag="Dtox_0075"
FT   CDS_pept        79361..80230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0075"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   ppd:Ppro_1535 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61038"
FT                   /db_xref="GOA:C8VVF4"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF4"
FT                   /inference="protein motif:PFAM:PF02665"
FT                   /protein_id="ACV61038.1"
FT                   GGVKNAGV"
FT   gene            80217..81581
FT                   /locus_tag="Dtox_0076"
FT   CDS_pept        80217..81581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0076"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: ppd:Ppro_1534
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61039"
FT                   /db_xref="GOA:C8VVG6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG6"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACV61039.1"
FT   gene            81736..82053
FT                   /locus_tag="Dtox_0077"
FT   CDS_pept        81736..82053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0077"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="TIGRFAM: sulfur relay protein, TusE/DsrC/DsvC
FT                   family; PFAM: DsrC family protein; KEGG: dat:HRM2_22050
FT                   DsrC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61040"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:C8W193"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ACV61040.1"
FT                   V"
FT   gene            82275..83684
FT                   /locus_tag="Dtox_0078"
FT   CDS_pept        82275..83684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0078"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; KEGG: sfu:Sfum_4044
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61041"
FT                   /db_xref="GOA:C8W1Y7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Y7"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ACV61041.1"
FT                   VNRAAEYRQIP"
FT   gene            83925..85343
FT                   /locus_tag="Dtox_0079"
FT   CDS_pept        83925..85343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0079"
FT                   /product="sulfite reductase, dissimilatory-type alpha
FT                   subunit"
FT                   /EC_number=""
FT                   /note="KEGG: dal:Dalk_4301 sulfite reductase,
FT                   dissimilatory-type alpha subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type alpha subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61042"
FT                   /db_xref="GOA:C8W1Y8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Y8"
FT                   /inference="protein motif:TFAM:TIGR02064"
FT                   /protein_id="ACV61042.1"
FT                   WDRDINEYRARHKR"
FT   gene            85377..86564
FT                   /locus_tag="Dtox_0080"
FT   CDS_pept        85377..86564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0080"
FT                   /product="sulfite reductase, dissimilatory-type beta
FT                   subunit"
FT                   /EC_number=""
FT                   /note="KEGG: dat:HRM2_42390 DsrB2; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type beta subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region; nitrite/sulfite
FT                   reductase hemoprotein beta-component ferrodoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61043"
FT                   /db_xref="GOA:C8W1Y9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Y9"
FT                   /inference="protein motif:TFAM:TIGR02066"
FT                   /protein_id="ACV61043.1"
FT   gene            86595..86828
FT                   /locus_tag="Dtox_0081"
FT   CDS_pept        86595..86828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0081"
FT                   /product="Dissimilatory sulfite reductase D"
FT                   /note="PFAM: Dissimilatory sulfite reductase D; KEGG:
FT                   dvl:Dvul_2530 dissimilatory sulfite reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61044"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z0"
FT                   /inference="protein motif:PFAM:PF08679"
FT                   /protein_id="ACV61044.1"
FT   gene            86931..87557
FT                   /locus_tag="Dtox_0082"
FT   CDS_pept        86931..87557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0082"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Sel1 domain protein repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: dde:Dde_3772 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61045"
FT                   /db_xref="GOA:C8W1Z1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z1"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACV61045.1"
FT   gene            87560..88153
FT                   /locus_tag="Dtox_0083"
FT   CDS_pept        87560..88153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0083"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="KEGG: dal:Dalk_4306 protein of unknown function
FT                   UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61046"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z2"
FT                   /inference="similar to AA sequence:KEGG:Dalk_4306"
FT                   /protein_id="ACV61046.1"
FT   gene            88158..88358
FT                   /locus_tag="Dtox_0084"
FT   CDS_pept        88158..88358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61047"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61047.1"
FT   gene            complement(88463..89593)
FT                   /locus_tag="Dtox_0085"
FT   CDS_pept        complement(88463..89593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61048"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61048.1"
FT   gene            complement(89597..89842)
FT                   /locus_tag="Dtox_0086"
FT   CDS_pept        complement(89597..89842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0086"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   dal:Dalk_1639 regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61049"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z5"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACV61049.1"
FT   gene            90047..90214
FT                   /locus_tag="Dtox_0087"
FT   CDS_pept        90047..90214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61050"
FT                   /db_xref="InterPro:IPR024209"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61050.1"
FT                   AKEWVDKNQK"
FT   gene            complement(90540..94163)
FT                   /locus_tag="Dtox_0088"
FT   CDS_pept        complement(90540..94163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0088"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: eca:ECA2957
FT                   pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61051"
FT                   /db_xref="GOA:C8W1Z7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z7"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61051.1"
FT   gene            complement(94315..96738)
FT                   /locus_tag="Dtox_0089"
FT   CDS_pept        complement(94315..96738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0089"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61052"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032329"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z8"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61052.1"
FT   sig_peptide     complement(96664..96738)
FT                   /locus_tag="Dtox_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(96839..97030)
FT                   /locus_tag="Dtox_0090"
FT   CDS_pept        complement(96839..97030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61053"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61053.1"
FT                   NQNISADPNLGAILDIKV"
FT   gene            complement(97058..99118)
FT                   /locus_tag="Dtox_0091"
FT   CDS_pept        complement(97058..99118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0091"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: bsu:BSU13530 two-component sensor histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; GAF domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; GAF domain protein; PAS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61054"
FT                   /db_xref="GOA:C8W2P8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2P8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61054.1"
FT   gene            99355..99449
FT                   /locus_tag="Dtox_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            99355..99449
FT                   /locus_tag="Dtox_R0004"
FT                   /product="tRNA-Ser"
FT   gene            99928..101511
FT                   /locus_tag="Dtox_0092"
FT   CDS_pept        99928..101511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0092"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0613 ATPase family associated with
FT                   various cellular activities (AAA); TIGRFAM: DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein; DNA polymerase III delta; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61055"
FT                   /db_xref="GOA:C8W2P9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2P9"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACV61055.1"
FT                   TQSIINLFEA"
FT   gene            101549..101863
FT                   /locus_tag="Dtox_0093"
FT   CDS_pept        101549..101863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61056"
FT                   /db_xref="GOA:C8W2Q0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV61056.1"
FT                   "
FT   gene            101875..102474
FT                   /locus_tag="Dtox_0094"
FT   CDS_pept        101875..102474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0094"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bsu:BSU00210 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61057"
FT                   /db_xref="GOA:C8W2Q1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q1"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACV61057.1"
FT   gene            102577..102840
FT                   /locus_tag="Dtox_0095"
FT   CDS_pept        102577..102840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0095"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="TIGRFAM: pro-sigmaK processing inhibitor BofA; PFAM:
FT                   sigmaK-factor processing regulatory BofA; KEGG:
FT                   bar:GBAA0024 sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61058"
FT                   /db_xref="GOA:C8W2Q2"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q2"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ACV61058.1"
FT   gene            103104..106628
FT                   /locus_tag="Dtox_0096"
FT   CDS_pept        103104..106628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0096"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: dvl:Dvul_0348
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61059"
FT                   /db_xref="GOA:C8W2Q3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q3"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61059.1"
FT                   NYKRLAGE"
FT   gene            106834..107010
FT                   /locus_tag="Dtox_0097"
FT   CDS_pept        106834..107010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU00240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61060"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q4"
FT                   /inference="similar to AA sequence:KEGG:BSU00240"
FT                   /protein_id="ACV61060.1"
FT                   INGLKKIWCCGEE"
FT   gene            complement(106965..107231)
FT                   /locus_tag="Dtox_0098"
FT   CDS_pept        complement(106965..107231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61061.1"
FT   gene            107386..108915
FT                   /locus_tag="Dtox_0099"
FT   CDS_pept        107386..108915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0099"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bar:GBAA4172 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61062"
FT                   /db_xref="GOA:C8W2Q6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q6"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACV61062.1"
FT   gene            109028..109729
FT                   /locus_tag="Dtox_0100"
FT   CDS_pept        109028..109729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0100"
FT                   /product="thymidylate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: geo:Geob_2152 dTMP kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61063"
FT                   /db_xref="GOA:C8W2Q7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q7"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACV61063.1"
FT                   NCLPKLAVQFR"
FT   gene            109875..110951
FT                   /locus_tag="Dtox_0101"
FT   CDS_pept        109875..110951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0101"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: geo:Geob_2151 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61064"
FT                   /db_xref="GOA:C8W2Q8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q8"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACV61064.1"
FT                   AALDVLLLSLTRLGRGEH"
FT   gene            110954..111766
FT                   /locus_tag="Dtox_0102"
FT   CDS_pept        110954..111766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0102"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: baa:BA_0620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61065"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q9"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACV61065.1"
FT   gene            111772..112107
FT                   /locus_tag="Dtox_0103"
FT   CDS_pept        111772..112107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0103"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   bsu:BSU00330 DNA replication intiation control protein
FT                   YabA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61066"
FT                   /db_xref="GOA:C8W2R0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R0"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ACV61066.1"
FT                   GAEQKNT"
FT   gene            112147..113013
FT                   /locus_tag="Dtox_0104"
FT   CDS_pept        112147..113013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0104"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bha:BH0049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61067"
FT                   /db_xref="GOA:C8W2R1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R1"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACV61067.1"
FT                   SKENLLR"
FT   gene            complement(113089..113349)
FT                   /locus_tag="Dtox_0105"
FT   CDS_pept        complement(113089..113349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0105"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: bsu:BSU00370
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61068"
FT                   /db_xref="GOA:C8W2R2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R2"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACV61068.1"
FT   gene            114182..115783
FT                   /locus_tag="Dtox_0106"
FT   CDS_pept        114182..115783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0106"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); aminoacyl-tRNA synthetase class Ia;
FT                   KEGG: bha:BH0053 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61069"
FT                   /db_xref="GOA:C8W2R3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R3"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACV61069.1"
FT                   GDAIFPRIDLKTLEKE"
FT   gene            115808..116578
FT                   /locus_tag="Dtox_0107"
FT   CDS_pept        115808..116578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0107"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: baa:BA_0627 TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61070"
FT                   /db_xref="GOA:C8W2R4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R4"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACV61070.1"
FT   gene            116606..117145
FT                   /locus_tag="Dtox_0108"
FT   CDS_pept        116606..117145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0108"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: scl:sce0214 cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61071"
FT                   /db_xref="GOA:C8W2R5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R5"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACV61071.1"
FT                   KHPYKQGIVAQKGVEF"
FT   gene            117330..118751
FT                   /locus_tag="Dtox_0109"
FT   CDS_pept        117330..118751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0109"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: bsu:BSU00400 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61072"
FT                   /db_xref="GOA:C8W2R6"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R6"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACV61072.1"
FT                   CRKWGVRKVKVYVLG"
FT   gene            118738..118893
FT                   /locus_tag="Dtox_0110"
FT   CDS_pept        118738..118893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61073"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61073.1"
FT                   KWYNML"
FT   gene            118923..119840
FT                   /locus_tag="Dtox_0111"
FT   CDS_pept        118923..119840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0111"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: baa:BA_0629 ribosomal RNA adenine dimethylase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61074"
FT                   /db_xref="GOA:C8W2R8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R8"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACV61074.1"
FT   gene            119853..120350
FT                   /locus_tag="Dtox_0112"
FT   CDS_pept        119853..120350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0112"
FT                   /product="protein of unknown function DUF458"
FT                   /note="PFAM: protein of unknown function DUF458; KEGG:
FT                   bsu:BSU14110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61075"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R9"
FT                   /inference="protein motif:PFAM:PF04308"
FT                   /protein_id="ACV61075.1"
FT                   YI"
FT   gene            120605..121486
FT                   /locus_tag="Dtox_0113"
FT   CDS_pept        120605..121486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0113"
FT                   /product="sporulation peptidase YabG"
FT                   /note="TIGRFAM: sporulation peptidase YabG; PFAM: peptidase
FT                   U57 YabG; KEGG: bha:BH0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61076"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S0"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ACV61076.1"
FT                   IPKSSIEQKPLS"
FT   gene            121577..122071
FT                   /locus_tag="Dtox_0114"
FT   CDS_pept        121577..122071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_43210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61077"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S1"
FT                   /inference="similar to AA sequence:KEGG:HRM2_43210"
FT                   /protein_id="ACV61077.1"
FT                   Y"
FT   gene            122667..123737
FT                   /locus_tag="Dtox_0115"
FT   CDS_pept        122667..123737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0115"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="TIGRFAM: sporulation integral membrane protein YtvI;
FT                   PFAM: protein of unknown function UPF0118; KEGG:
FT                   bar:GBAA4841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61078"
FT                   /db_xref="GOA:C8W2S2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S2"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ACV61078.1"
FT                   NSMVKSGLLGSLLIDK"
FT   gene            complement(123831..124628)
FT                   /locus_tag="Dtox_0116"
FT   CDS_pept        complement(123831..124628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0116"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   sfu:Sfum_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61079"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S3"
FT                   /inference="protein motif:PFAM:PF02596"
FT                   /protein_id="ACV61079.1"
FT   gene            complement(124630..124863)
FT                   /locus_tag="Dtox_0117"
FT   CDS_pept        complement(124630..124863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61080"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61080.1"
FT   gene            complement(125103..125906)
FT                   /locus_tag="Dtox_0118"
FT   CDS_pept        complement(125103..125906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0118"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /EC_number=""
FT                   /note="KEGG: dal:Dalk_3067 CoA-substrate-specific enzyme
FT                   activase; TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61081"
FT                   /db_xref="GOA:C8W2S5"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S5"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ACV61081.1"
FT   gene            complement(125910..127184)
FT                   /locus_tag="Dtox_0119"
FT   CDS_pept        complement(125910..127184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0119"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-
FT                   component; KEGG: sfu:Sfum_3256 2-hydroxyglutaryl-CoA
FT                   dehydratase, D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61082"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S6"
FT                   /inference="protein motif:PFAM:PF06050"
FT                   /protein_id="ACV61082.1"
FT   gene            complement(127354..128649)
FT                   /locus_tag="Dtox_0120"
FT   CDS_pept        complement(127354..128649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61083"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61083.1"
FT   gene            128744..130240
FT                   /locus_tag="Dtox_0121"
FT   CDS_pept        128744..130240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zinc finger protein ; K10696 E3 ubiquitin-
FT                   protein ligase BRE1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61084"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61084.1"
FT   gene            130296..130946
FT                   /locus_tag="Dtox_0122"
FT   CDS_pept        130296..130946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61085"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61085.1"
FT   gene            131079..131636
FT                   /locus_tag="Dtox_0123"
FT   CDS_pept        131079..131636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0123"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   noc:Noc_2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61086"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T0"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACV61086.1"
FT   gene            131786..132661
FT                   /locus_tag="Dtox_0124"
FT   CDS_pept        131786..132661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0124"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gsu:GSU2769 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61087"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV61087.1"
FT                   ERYYLPIQWF"
FT   gene            complement(132785..133531)
FT                   /locus_tag="Dtox_0125"
FT   CDS_pept        complement(132785..133531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_3640 phosphate ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61088"
FT                   /db_xref="GOA:C8W2T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61088.1"
FT   gene            complement(133547..134386)
FT                   /locus_tag="Dtox_0126"
FT   CDS_pept        complement(133547..134386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0126"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: sat:SYN_00058
FT                   ABC-type phosphate transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61089"
FT                   /db_xref="GOA:C8W2T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T3"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACV61089.1"
FT   gene            complement(134383..135282)
FT                   /locus_tag="Dtox_0127"
FT   CDS_pept        complement(134383..135282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0127"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: vsa:VSAL_I2119
FT                   phosphate ABC transporter, inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61090"
FT                   /db_xref="GOA:C8W2T4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACV61090.1"
FT                   NLFLTFLRRPVGNEVRKS"
FT   sig_peptide     complement(135184..135282)
FT                   /locus_tag="Dtox_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.555 at
FT                   residue 33"
FT   gene            complement(135457..136380)
FT                   /locus_tag="Dtox_0128"
FT   CDS_pept        complement(135457..136380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0128"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   vch:VCA0070 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61091"
FT                   /db_xref="GOA:C8W2T5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T5"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACV61091.1"
FT   sig_peptide     complement(136294..136380)
FT                   /locus_tag="Dtox_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 29"
FT   gene            136695..141458
FT                   /locus_tag="Dtox_0129"
FT   CDS_pept        136695..141458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0129"
FT                   /product="Chromosome segregation ATPase-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61092"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T6"
FT                   /inference="protein motif:COG:COG1196"
FT                   /protein_id="ACV61092.1"
FT                   QEGASFSN"
FT   gene            141455..142699
FT                   /locus_tag="Dtox_0130"
FT   CDS_pept        141455..142699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0130"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61093"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T7"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61093.1"
FT                   SDEAKEKQAYVYPVN"
FT   sig_peptide     141455..141547
FT                   /locus_tag="Dtox_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.951 at
FT                   residue 31"
FT   gene            complement(142959..143090)
FT                   /pseudo
FT                   /locus_tag="Dtox_0131"
FT   gene            143549..150598
FT                   /locus_tag="Dtox_0132"
FT   CDS_pept        143549..150598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0132"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM:
FT                   Carbohydrate-binding CenC domain protein; YD
FT                   repeat-containing protein; KEGG: baa:BA_1645 CBD_6,
FT                   cellulose binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61094"
FT                   /db_xref="GOA:C8W2T8"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T8"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61094.1"
FT                   FLP"
FT   gene            150618..151118
FT                   /locus_tag="Dtox_0133"
FT   CDS_pept        150618..151118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61095.1"
FT                   SNY"
FT   gene            complement(151802..153109)
FT                   /locus_tag="Dtox_0134"
FT   CDS_pept        complement(151802..153109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0134"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: eba:ebA6749 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61096"
FT                   /db_xref="GOA:C8W2U0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV61096.1"
FT   gene            153332..154465
FT                   /locus_tag="Dtox_0135"
FT   CDS_pept        153332..154465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61097"
FT                   /db_xref="GOA:C8W2U1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U1"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2747"
FT                   /protein_id="ACV61097.1"
FT   gene            154873..155742
FT                   /locus_tag="Dtox_0136"
FT   CDS_pept        154873..155742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61098"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61098.1"
FT                   KVKPEQKK"
FT   gene            156836..157414
FT                   /locus_tag="Dtox_0137"
FT   CDS_pept        156836..157414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61099"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61099.1"
FT   gene            157431..157619
FT                   /locus_tag="Dtox_0138"
FT   CDS_pept        157431..157619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61100"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61100.1"
FT                   YTYKEIENIARDISEGN"
FT   gene            157779..158117
FT                   /locus_tag="Dtox_0139"
FT   CDS_pept        157779..158117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avi:Avi_3476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61101"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61101.1"
FT                   NKHFVVFE"
FT   gene            158297..158377
FT                   /pseudo
FT                   /locus_tag="Dtox_0140"
FT   gene            158534..158785
FT                   /pseudo
FT                   /locus_tag="Dtox_0141"
FT   gene            158796..159383
FT                   /locus_tag="Dtox_0142"
FT   CDS_pept        158796..159383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61102"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61102.1"
FT   gene            complement(159783..160172)
FT                   /pseudo
FT                   /locus_tag="Dtox_0143"
FT   gene            160178..161353
FT                   /pseudo
FT                   /locus_tag="Dtox_0144"
FT   gene            161366..161986
FT                   /locus_tag="Dtox_0145"
FT   CDS_pept        161366..161986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61103.1"
FT   gene            162765..163019
FT                   /locus_tag="Dtox_0146"
FT   CDS_pept        162765..163019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0146"
FT                   /product="IS110 family transposase orfA"
FT                   /note="KEGG: bar:GBAA2202 IS110 family transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61104"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U8"
FT                   /inference="similar to AA sequence:KEGG:GBAA2202"
FT                   /protein_id="ACV61104.1"
FT   gene            163362..164495
FT                   /locus_tag="Dtox_0147"
FT   CDS_pept        163362..164495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61105"
FT                   /db_xref="GOA:C8W2U9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U9"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2747"
FT                   /protein_id="ACV61105.1"
FT   gene            164800..167097
FT                   /locus_tag="Dtox_0148"
FT   CDS_pept        164800..167097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0148"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: bar:GBAA1094
FT                   wall-associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61106"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V0"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61106.1"
FT                   QFGDKFRLYRND"
FT   gene            167166..168216
FT                   /locus_tag="Dtox_0149"
FT   CDS_pept        join(167166..167684,167683..168216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Dtox_0149"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: bha:BH2521 transposase (21)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61107"
FT                   /db_xref="GOA:C8W2V1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V1"
FT                   /inference="protein motif:COG:COG3415"
FT                   /protein_id="ACV61107.1"
FT                   SEDVKKRLCV"
FT   gene            168326..168442
FT                   /locus_tag="Dtox_0150"
FT   CDS_pept        168326..168442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61108"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61108.1"
FT   gene            168492..169361
FT                   /locus_tag="Dtox_0151"
FT   CDS_pept        168492..169361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61109"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61109.1"
FT                   KVKPEQKK"
FT   gene            169803..170726
FT                   /locus_tag="Dtox_0152"
FT   CDS_pept        169803..170726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0152"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: pca:Pcar_0129 Rhs family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61110"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V4"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61110.1"
FT   gene            170739..171242
FT                   /locus_tag="Dtox_0153"
FT   CDS_pept        170739..171242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61111"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61111.1"
FT                   SVNL"
FT   gene            171711..171876
FT                   /pseudo
FT                   /locus_tag="Dtox_0154"
FT   gene            172017..172919
FT                   /locus_tag="Dtox_0155"
FT   CDS_pept        172017..172919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61112"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61112.1"
FT   gene            173075..173490
FT                   /pseudo
FT                   /locus_tag="Dtox_0156"
FT   gene            complement(173760..173834)
FT                   /locus_tag="Dtox_R0005"
FT                   /note="tRNA-Ile6"
FT   tRNA            complement(173760..173834)
FT                   /locus_tag="Dtox_R0005"
FT                   /product="tRNA-Ile"
FT   gene            173893..174144
FT                   /locus_tag="Dtox_0157"
FT   CDS_pept        173893..174144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61113"
FT                   /db_xref="GOA:C8W2V7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61113.1"
FT   gene            174146..174511
FT                   /locus_tag="Dtox_0158"
FT   CDS_pept        174146..174511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0158"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; HicB
FT                   family protein; KEGG: noc:Noc_2743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61114"
FT                   /db_xref="GOA:C8W2V8"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V8"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACV61114.1"
FT                   NQYINYQLSRGVGYTPK"
FT   gene            complement(175050..175304)
FT                   /pseudo
FT                   /locus_tag="Dtox_0159"
FT   gene            176008..183984
FT                   /locus_tag="Dtox_0160"
FT   CDS_pept        176008..183984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0160"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: bsu:BSU39230 cell
FT                   wall-associated protein precursor (CWBP200, 105, 62)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61115"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V9"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61115.1"
FT                   TIDVNGIQGLRKIKFLP"
FT   gene            183996..184577
FT                   /locus_tag="Dtox_0161"
FT   CDS_pept        183996..184577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61116"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61116.1"
FT   gene            complement(185316..185537)
FT                   /locus_tag="Dtox_0162"
FT   CDS_pept        complement(185316..185537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61117"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61117.1"
FT   gene            185859..186284
FT                   /locus_tag="Dtox_0163"
FT   CDS_pept        185859..186284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0163"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; CI repressor;
FT                   SMART: helix-turn-helix domain protein; KEGG: bsu:BSU12510
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61118"
FT                   /db_xref="GOA:C8W2W2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV61118.1"
FT   gene            complement(186582..187214)
FT                   /locus_tag="Dtox_0164"
FT   CDS_pept        complement(186582..187214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0164"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="PFAM: peptidase M56 BlaR1; KEGG: swp:swp_3950 TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61119"
FT                   /db_xref="GOA:C8W2W3"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W3"
FT                   /inference="protein motif:PFAM:PF05569"
FT                   /protein_id="ACV61119.1"
FT   gene            complement(187220..187579)
FT                   /locus_tag="Dtox_0165"
FT   CDS_pept        complement(187220..187579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0165"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="PFAM: Penicillinase repressor; KEGG: spl:Spea_3208
FT                   CopY family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61120"
FT                   /db_xref="GOA:C8W2W4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W4"
FT                   /inference="protein motif:PFAM:PF03965"
FT                   /protein_id="ACV61120.1"
FT                   KESDELQKLINQSRG"
FT   gene            188008..188238
FT                   /locus_tag="Dtox_0166"
FT   CDS_pept        188008..188238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0166"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: dat:HRM2_06850 TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61121"
FT                   /db_xref="GOA:C8W2W5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W5"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACV61121.1"
FT   gene            188272..189042
FT                   /locus_tag="Dtox_0167"
FT   CDS_pept        188272..189042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0167"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: dal:Dalk_4186 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61122"
FT                   /db_xref="GOA:C8W2W6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W6"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACV61122.1"
FT   gene            189116..190657
FT                   /locus_tag="Dtox_0168"
FT   CDS_pept        189116..190657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0168"
FT                   /product="hydrogenase, Fe-only"
FT                   /EC_number=""
FT                   /note="KEGG: sat:SYN_01370 iron only hydrogenase large
FT                   subunit; TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; 4Fe-4S ferredoxin iron- sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61123"
FT                   /db_xref="GOA:C8W2W7"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W7"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACV61123.1"
FT   gene            190679..191467
FT                   /locus_tag="Dtox_0169"
FT   CDS_pept        190679..191467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0169"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_2007 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61124"
FT                   /db_xref="GOA:C8W2W8"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61124.1"
FT   gene            191492..192628
FT                   /locus_tag="Dtox_0170"
FT   CDS_pept        191492..192628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0170"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   sus:Acid_4205 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61125"
FT                   /db_xref="GOA:C8W2W9"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W9"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACV61125.1"
FT   sig_peptide     191492..191596
FT                   /locus_tag="Dtox_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.339 at
FT                   residue 35"
FT   gene            192770..193687
FT                   /locus_tag="Dtox_0171"
FT   CDS_pept        192770..193687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0171"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tbd:Tbd_2651 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61126"
FT                   /db_xref="GOA:C8W2X0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACV61126.1"
FT   gene            complement(193919..195640)
FT                   /locus_tag="Dtox_0172"
FT   CDS_pept        complement(193919..195640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0172"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: sfu:Sfum_0844 hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61127"
FT                   /db_xref="GOA:C8W2X1"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X1"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACV61127.1"
FT   gene            complement(195664..197457)
FT                   /locus_tag="Dtox_0173"
FT   CDS_pept        complement(195664..197457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0173"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number=""
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_0845 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61128"
FT                   /db_xref="GOA:C8W2X2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61128.1"
FT   sig_peptide     complement(197386..197457)
FT                   /locus_tag="Dtox_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.660 at
FT                   residue 24"
FT   gene            complement(197471..197830)
FT                   /locus_tag="Dtox_0174"
FT   CDS_pept        complement(197471..197830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0174"
FT                   /product="NADP-reducing hydrogenase, subunit B"
FT                   /note="KEGG: dat:HRM2_16520 NADP-reducing hydrogenase,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61129"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X3"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16520"
FT                   /protein_id="ACV61129.1"
FT                   LLEGKVIEQWTKPEE"
FT   gene            complement(197827..198381)
FT                   /locus_tag="Dtox_0175"
FT   CDS_pept        complement(197827..198381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0175"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   dat:HRM2_16530 sensory signal transduction histidine kinase
FT                   (ATPase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61130"
FT                   /db_xref="GOA:C8W2X4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61130.1"
FT   gene            complement(198388..198885)
FT                   /locus_tag="Dtox_0176"
FT   CDS_pept        complement(198388..198885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0176"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: sfu:Sfum_0846 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61131"
FT                   /db_xref="GOA:C8W2X5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X5"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACV61131.1"
FT                   KE"
FT   gene            complement(198993..199343)
FT                   /locus_tag="Dtox_0177"
FT   CDS_pept        complement(198993..199343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0177"
FT                   /product="iron-sulfur binding hydrogenase"
FT                   /note="KEGG: dat:HRM2_16550 iron-sulfur binding
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61132"
FT                   /db_xref="GOA:C8W2X6"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X6"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16550"
FT                   /protein_id="ACV61132.1"
FT                   RLYHLLELKLTD"
FT   gene            complement(199343..200674)
FT                   /locus_tag="Dtox_0178"
FT   CDS_pept        complement(199343..200674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0178"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Fe-S cluster domain protein; KEGG: dat:HRM2_16550
FT                   iron-sulfur binding hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61133"
FT                   /db_xref="GOA:C8W2X7"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61133.1"
FT   gene            complement(200674..201102)
FT                   /locus_tag="Dtox_0179"
FT   CDS_pept        complement(200674..201102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0179"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: dat:HRM2_16560 RsbW2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61134"
FT                   /db_xref="GOA:C8W2X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61134.1"
FT   gene            complement(201129..201479)
FT                   /locus_tag="Dtox_0180"
FT   CDS_pept        complement(201129..201479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_16570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61135"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X9"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16570"
FT                   /protein_id="ACV61135.1"
FT                   CGILYQHGLRSY"
FT   gene            201870..202919
FT                   /locus_tag="Dtox_0181"
FT   CDS_pept        201870..202919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0181"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_0841 biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61136"
FT                   /db_xref="GOA:C8W2Y0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61136.1"
FT                   TDRGDRNKK"
FT   gene            202967..204376
FT                   /locus_tag="Dtox_0182"
FT   CDS_pept        202967..204376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0182"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: sfu:Sfum_0842 thiamine biosynthesis
FT                   protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61137"
FT                   /db_xref="GOA:C8W2Y1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y1"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ACV61137.1"
FT                   KIKQGWRDLYF"
FT   gene            complement(204452..205678)
FT                   /locus_tag="Dtox_0183"
FT   CDS_pept        complement(204452..205678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0183"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: sfu:Sfum_1843 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61138"
FT                   /db_xref="GOA:C8W2Y2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y2"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV61138.1"
FT                   RLYENKEMT"
FT   gene            complement(205662..207128)
FT                   /locus_tag="Dtox_0184"
FT   CDS_pept        complement(205662..207128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0184"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: sfu:Sfum_1842 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61139"
FT                   /db_xref="GOA:C8W2Y3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y3"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ACV61139.1"
FT   gene            207420..207809
FT                   /pseudo
FT                   /locus_tag="Dtox_0185"
FT   gene            207898..209130
FT                   /locus_tag="Dtox_0186"
FT   CDS_pept        207898..209130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0186"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: acr:Acry_3575 IS605 family
FT                   transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61140"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y4"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61140.1"
FT                   RLKVLALKKTA"
FT   gene            209546..209695
FT                   /pseudo
FT                   /locus_tag="Dtox_0187"
FT   gene            209725..210555
FT                   /locus_tag="Dtox_0188"
FT   CDS_pept        209725..210555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0188"
FT                   /product="thymidylate synthase"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU17680 thymidylate synthase; TIGRFAM:
FT                   thymidylate synthase; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61141"
FT                   /db_xref="GOA:C8W2Y5"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y5"
FT                   /inference="protein motif:TFAM:TIGR03284"
FT                   /protein_id="ACV61141.1"
FT   gene            210630..210809
FT                   /locus_tag="Dtox_0189"
FT   CDS_pept        210630..210809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61142"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61142.1"
FT                   VEEKARQLNQKTGG"
FT   gene            210849..212462
FT                   /locus_tag="Dtox_0190"
FT   CDS_pept        210849..212462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0190"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   dsh:Dshi_0396 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61143"
FT                   /db_xref="GOA:C8W2Y7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y7"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACV61143.1"
FT   gene            212510..213058
FT                   /locus_tag="Dtox_0191"
FT   CDS_pept        212510..213058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_43210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61144"
FT                   /db_xref="GOA:C8W2Y8"
FT                   /db_xref="InterPro:IPR001850"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61144.1"
FT   gene            213082..213474
FT                   /locus_tag="Dtox_0192"
FT   CDS_pept        213082..213474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61145"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61145.1"
FT   gene            213561..215171
FT                   /locus_tag="Dtox_0193"
FT   CDS_pept        213561..215171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0193"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61146"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z0"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACV61146.1"
FT   gene            215587..216327
FT                   /locus_tag="Dtox_0194"
FT   CDS_pept        215587..216327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61147"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61147.1"
FT   gene            216357..216659
FT                   /locus_tag="Dtox_0195"
FT   CDS_pept        216357..216659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sfu:Sfum_2790 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61148"
FT                   /db_xref="GOA:C8W2Z2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z2"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV61148.1"
FT   gene            216700..217200
FT                   /locus_tag="Dtox_0196"
FT   CDS_pept        216700..217200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61149"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61149.1"
FT                   LSV"
FT   gene            complement(217221..217601)
FT                   /locus_tag="Dtox_0197"
FT   CDS_pept        complement(217221..217601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0197"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bsu:BSU18610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61150"
FT                   /db_xref="GOA:C8W2Z4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z4"
FT                   /inference="similar to AA sequence:KEGG:BSU18610"
FT                   /protein_id="ACV61150.1"
FT   gene            217746..218192
FT                   /locus_tag="Dtox_0198"
FT   CDS_pept        217746..218192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0198"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   ppd:Ppro_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61151"
FT                   /db_xref="GOA:C8W2Z5"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z5"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="ACV61151.1"
FT   sig_peptide     217746..217826
FT                   /locus_tag="Dtox_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.632 at
FT                   residue 27"
FT   gene            complement(218196..218915)
FT                   /locus_tag="Dtox_0199"
FT   CDS_pept        complement(218196..218915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0199"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mca:MCA2417 ZIP zinc
FT                   transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61152"
FT                   /db_xref="GOA:C8W2Z6"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z6"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACV61152.1"
FT                   TGGFCGMLFFLLLSLLE"
FT   sig_peptide     complement(218847..218915)
FT                   /locus_tag="Dtox_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.160 at
FT                   residue 23"
FT   gene            complement(218935..219462)
FT                   /locus_tag="Dtox_0200"
FT   CDS_pept        complement(218935..219462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0200"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding LysM; SMART: Peptidoglycan-binding
FT                   LysM; KEGG: bsu:BSU14040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61153"
FT                   /db_xref="GOA:C8W2Z7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACV61153.1"
FT                   DHIFPGQTVIIP"
FT   gene            219699..220661
FT                   /locus_tag="Dtox_0201"
FT   CDS_pept        219699..220661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0201"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0633 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61154"
FT                   /db_xref="GOA:C8W2Z8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z8"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACV61154.1"
FT   gene            220762..221463
FT                   /locus_tag="Dtox_0202"
FT   CDS_pept        220762..221463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0202"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   gur:Gura_4161 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61155"
FT                   /db_xref="GOA:C8W2Z9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACV61155.1"
FT                   SMISAVQEAGV"
FT   gene            221465..222238
FT                   /locus_tag="Dtox_0203"
FT   CDS_pept        221465..222238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61156"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8W300"
FT                   /inference="similar to AA sequence:KEGG:Neut_1101"
FT                   /protein_id="ACV61156.1"
FT   gene            222584..222841
FT                   /locus_tag="Dtox_0204"
FT   CDS_pept        222584..222841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0204"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bha:BH0064
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61157"
FT                   /db_xref="GOA:C8W301"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:C8W301"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACV61157.1"
FT   gene            223131..224507
FT                   /locus_tag="Dtox_0205"
FT   CDS_pept        223131..224507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0205"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; 4-diphosphocytidyl-
FT                   2C-methyl-D-erythritol synthase; KEGG: bha:BH0065
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61158"
FT                   /db_xref="GOA:C8W302"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W302"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACV61158.1"
FT                   "
FT   gene            224549..225496
FT                   /locus_tag="Dtox_0206"
FT   CDS_pept        224549..225496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0206"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="KEGG: bar:GBAA0049 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61159"
FT                   /db_xref="GOA:C8W303"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C8W303"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACV61159.1"
FT   gene            complement(225559..226305)
FT                   /locus_tag="Dtox_0207"
FT   CDS_pept        complement(225559..226305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61160"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C8W304"
FT                   /inference="protein motif:COG:COG3881"
FT                   /protein_id="ACV61160.1"
FT   gene            226480..227139
FT                   /locus_tag="Dtox_0208"
FT   CDS_pept        226480..227139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0208"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: bha:BH0067
FT                   50S ribosomal protein L25/general stress protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61161"
FT                   /db_xref="GOA:C8W305"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C8W305"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACV61161.1"
FT   gene            227264..227854
FT                   /locus_tag="Dtox_0209"
FT   CDS_pept        227264..227854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0209"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0639 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61162"
FT                   /db_xref="GOA:C8W306"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C8W306"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACV61162.1"
FT   gene            complement(227955..228605)
FT                   /locus_tag="Dtox_0210"
FT   CDS_pept        complement(227955..228605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0210"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: dat:HRM2_17730 channel
FT                   protein (hemolysin III family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61163"
FT                   /db_xref="GOA:C8W307"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:C8W307"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ACV61163.1"
FT   gene            complement(228736..229887)
FT                   /locus_tag="Dtox_0211"
FT   CDS_pept        complement(228736..229887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0211"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: baa:BA_0817 DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61164"
FT                   /db_xref="GOA:C8W308"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W308"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACV61164.1"
FT   gene            230110..230505
FT                   /locus_tag="Dtox_0212"
FT   CDS_pept        230110..230505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61165"
FT                   /db_xref="GOA:C8W309"
FT                   /db_xref="UniProtKB/TrEMBL:C8W309"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61165.1"
FT   gene            230547..230780
FT                   /locus_tag="Dtox_0213"
FT   CDS_pept        230547..230780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61166"
FT                   /db_xref="UniProtKB/TrEMBL:C8W310"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61166.1"
FT   gene            230922..234515
FT                   /locus_tag="Dtox_0214"
FT   CDS_pept        230922..234515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0214"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bsu:BSU00550 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61167"
FT                   /db_xref="GOA:C8W311"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C8W311"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACV61167.1"
FT   gene            234622..235605
FT                   /locus_tag="Dtox_0215"
FT   CDS_pept        234622..235605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0215"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: gsu:GSU2429 peptidyl-prolyl cis-trans isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61168"
FT                   /db_xref="GOA:C8W312"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C8W312"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACV61168.1"
FT   sig_peptide     234622..234702
FT                   /locus_tag="Dtox_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.880 at
FT                   residue 27"
FT   gene            235737..236297
FT                   /locus_tag="Dtox_0216"
FT   CDS_pept        235737..236297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0216"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain protein; KEGG: baa:BA_0642 hypothetical protein
FT                   predicted by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61169"
FT                   /db_xref="GOA:C8W313"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:C8W313"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ACV61169.1"
FT   gene            236301..236417
FT                   /locus_tag="Dtox_0217"
FT   CDS_pept        236301..236417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61170"
FT                   /db_xref="UniProtKB/TrEMBL:C8W314"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61170.1"
FT   gene            236578..238053
FT                   /locus_tag="Dtox_0218"
FT   CDS_pept        236578..238053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0218"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: baa:BA_0644
FT                   tetrapyrrole (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61171"
FT                   /db_xref="GOA:C8W315"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W315"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACV61171.1"
FT   gene            238162..238452
FT                   /locus_tag="Dtox_0219"
FT   CDS_pept        238162..238452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0219"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   bha:BH1309 non-specific DNA-binding protein II (HB) (HU)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61172"
FT                   /db_xref="GOA:C8W316"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C8W316"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACV61172.1"
FT   gene            238499..238759
FT                   /locus_tag="Dtox_0220"
FT   CDS_pept        238499..238759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0220"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: bha:BH0073
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61173"
FT                   /db_xref="GOA:C8W317"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8W317"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACV61173.1"
FT   gene            238818..239768
FT                   /locus_tag="Dtox_0221"
FT   CDS_pept        238818..239768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0221"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: gur:Gura_1714
FT                   SpoIID/LytB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61174"
FT                   /db_xref="GOA:C8W318"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:C8W318"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ACV61174.1"
FT   sig_peptide     238818..238907
FT                   /locus_tag="Dtox_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.341 at
FT                   residue 30"
FT   gene            239872..240147
FT                   /locus_tag="Dtox_0222"
FT   CDS_pept        239872..240147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0222"
FT                   /product="sporulation protein YabP"
FT                   /note="TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein; KEGG: bha:BH0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61175"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:C8W319"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ACV61175.1"
FT   gene            240184..240729
FT                   /locus_tag="Dtox_0223"
FT   CDS_pept        240184..240729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0223"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="TIGRFAM: spore cortex biosynthesis protein YabQ;
FT                   KEGG: bar:GBAA0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61176"
FT                   /db_xref="GOA:C8W320"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:C8W320"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ACV61176.1"
FT                   LKSRIKKIINGIFKRKPK"
FT   gene            240938..241306
FT                   /locus_tag="Dtox_0224"
FT   CDS_pept        240938..241306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0224"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: bha:BH0076
FT                   cell-division initiation protein (septum formation)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61177"
FT                   /db_xref="GOA:C8W3S3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S3"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACV61177.1"
FT                   PGEKRIVPVDKNQPQIPD"
FT   gene            241467..241871
FT                   /locus_tag="Dtox_0225"
FT   CDS_pept        241467..241871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0225"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: bsu:BSU00630 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61178"
FT                   /db_xref="GOA:C8W3S4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S4"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACV61178.1"
FT   gene            241868..242848
FT                   /locus_tag="Dtox_0226"
FT   CDS_pept        241868..242848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0226"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: mxa:MXAN_5759
FT                   phosphatase, Ppx/GppA family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61179"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S5"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACV61179.1"
FT   gene            242863..245418
FT                   /locus_tag="Dtox_0227"
FT   CDS_pept        242863..245418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0227"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number=""
FT                   /note="KEGG: bar:GBAA0061 stage II sporulation protein E;
FT                   TIGRFAM: stage II sporulation protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61180"
FT                   /db_xref="GOA:C8W3S6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ACV61180.1"
FT   gene            245882..247303
FT                   /locus_tag="Dtox_0228"
FT   CDS_pept        245882..247303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0228"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61181"
FT                   /db_xref="GOA:C8W3S7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACV61181.1"
FT                   KINEVTTKFLHLFLV"
FT   gene            247409..249235
FT                   /locus_tag="Dtox_0229"
FT   CDS_pept        247409..249235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0229"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0654 peptidase_M41, peptidase family
FT                   M41; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61182"
FT                   /db_xref="GOA:C8W3S8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACV61182.1"
FT   gene            249306..249755
FT                   /locus_tag="Dtox_0230"
FT   CDS_pept        249306..249755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0230"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: YNK1; Nucleoside diphosphate kinase, catalyzes
FT                   the transfer of gamma phosphates from nucleoside
FT                   triphosphates, usually ATP, to nucleoside diphosphates by a
FT                   mechanism that involves formation of an autophosphorylated
FT                   enzyme in-TRUNCATED-; PFAM: nucleoside diphosphate kinase;
FT                   SMART: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61183"
FT                   /db_xref="GOA:C8W3S9"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61183.1"
FT   gene            250102..251805
FT                   /locus_tag="Dtox_0231"
FT   CDS_pept        250102..251805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0231"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number=""
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   fthS; formate-dihydrofolate ligase ; K01938
FT                   formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61184"
FT                   /db_xref="GOA:C8W3T0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61184.1"
FT   gene            252090..253772
FT                   /locus_tag="Dtox_0232"
FT   CDS_pept        252090..253772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0232"
FT                   /product="transposase (IS4 family protein)"
FT                   /note="KEGG: dat:HRM2_21770 transposase (IS4 family
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61185"
FT                   /db_xref="GOA:C8VXQ2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8VXQ2"
FT                   /inference="similar to AA sequence:KEGG:HRM2_21770"
FT                   /protein_id="ACV61185.1"
FT   gene            254196..254660
FT                   /locus_tag="Dtox_0233"
FT   CDS_pept        254196..254660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0233"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   dat:HRM2_31170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61186"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T2"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ACV61186.1"
FT   gene            254653..255141
FT                   /locus_tag="Dtox_0234"
FT   CDS_pept        254653..255141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0234"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ppd:Ppro_3312 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61187"
FT                   /db_xref="GOA:C8W3T3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T3"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACV61187.1"
FT   gene            255161..256345
FT                   /locus_tag="Dtox_0235"
FT   CDS_pept        255161..256345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0235"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH0093 dihydropteroate synthase
FT                   (dihydropteroate pyrophosphorylase); TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61188"
FT                   /db_xref="GOA:C8W3T4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T4"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACV61188.1"
FT   gene            256357..256722
FT                   /locus_tag="Dtox_0236"
FT   CDS_pept        256357..256722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0236"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: baa:BA_0662
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61189"
FT                   /db_xref="GOA:C8W3T5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T5"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACV61189.1"
FT                   PGCFEHMAVEITREKEV"
FT   gene            256726..257226
FT                   /locus_tag="Dtox_0237"
FT   CDS_pept        256726..257226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0237"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0663 7,8-dihydro-6-hydroxymethylpterin-
FT                   pyrophosphokinase (HPPK);
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   idinepyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61190"
FT                   /db_xref="GOA:C8W3T6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T6"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACV61190.1"
FT                   GDN"
FT   gene            257654..258676
FT                   /locus_tag="Dtox_0238"
FT   CDS_pept        257654..258676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0238"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: bha:BH2808
FT                   spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61191"
FT                   /db_xref="GOA:C8W3T7"
FT                   /db_xref="InterPro:IPR023897"
FT                   /db_xref="InterPro:IPR034559"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61191.1"
FT                   "
FT   gene            259066..259938
FT                   /locus_tag="Dtox_0239"
FT   CDS_pept        259066..259938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0239"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61192"
FT                   /db_xref="GOA:C8W3T8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T8"
FT                   /inference="protein motif:PFAM:PF03807"
FT                   /protein_id="ACV61192.1"
FT                   FELNQLLDM"
FT   gene            259964..260806
FT                   /locus_tag="Dtox_0240"
FT   CDS_pept        259964..260806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0240"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: sat:SYN_02773 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61193"
FT                   /db_xref="GOA:C8W3T9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T9"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ACV61193.1"
FT   gene            260831..261676
FT                   /locus_tag="Dtox_0241"
FT   CDS_pept        260831..261676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0241"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number=""
FT                   /note="KEGG: gme:Gmet_1643 pantothenate synthetase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61194"
FT                   /db_xref="GOA:C8W3U0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U0"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACV61194.1"
FT                   "
FT   gene            261742..262125
FT                   /locus_tag="Dtox_0242"
FT   CDS_pept        261742..262125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0242"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU22410 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61195"
FT                   /db_xref="GOA:C8W3U1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U1"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACV61195.1"
FT   gene            complement(262401..262949)
FT                   /locus_tag="Dtox_0243"
FT   CDS_pept        complement(262401..262949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0243"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: baa:BA_0023 BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61196"
FT                   /db_xref="GOA:C8W3U2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U2"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACV61196.1"
FT   sig_peptide     complement(262893..262949)
FT                   /locus_tag="Dtox_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.193 at
FT                   residue 19"
FT   gene            complement(262980..263969)
FT                   /locus_tag="Dtox_0244"
FT   CDS_pept        complement(262980..263969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0244"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_2078 biotin/lipoate A/B protein ligase
FT                   family; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn- helix
FT                   type 11 domain protein; biotin protein ligase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61197"
FT                   /db_xref="GOA:C8W3U3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U3"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACV61197.1"
FT   gene            complement(264254..264598)
FT                   /locus_tag="Dtox_0245"
FT   CDS_pept        complement(264254..264598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0245"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: gur:Gura_0439 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61198"
FT                   /db_xref="GOA:C8W3U4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U4"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV61198.1"
FT                   LKRDEGDNTH"
FT   gene            264828..265592
FT                   /locus_tag="Dtox_0246"
FT   CDS_pept        264828..265592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0246"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: gme:Gmet_1986
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61199"
FT                   /db_xref="GOA:C8W3U5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U5"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACV61199.1"
FT   gene            265628..266596
FT                   /locus_tag="Dtox_0247"
FT   CDS_pept        265628..266596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0247"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: bha:BH0097 nitrogen
FT                   regulation transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61200"
FT                   /db_xref="GOA:C8W3U6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U6"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACV61200.1"
FT   gene            complement(266586..266702)
FT                   /locus_tag="Dtox_0248"
FT   CDS_pept        complement(266586..266702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61201"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61201.1"
FT   gene            267210..268322
FT                   /locus_tag="Dtox_0249"
FT   CDS_pept        267210..268322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0249"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   ade:Adeh_2305 dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61202"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U8"
FT                   /inference="protein motif:PFAM:PF01488"
FT                   /protein_id="ACV61202.1"
FT   gene            268525..269001
FT                   /locus_tag="Dtox_0250"
FT   CDS_pept        268525..269001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0250"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61203"
FT                   /db_xref="GOA:C8W3U9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U9"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ACV61203.1"
FT   gene            269023..270522
FT                   /locus_tag="Dtox_0251"
FT   CDS_pept        269023..270522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0251"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bha:BH0098 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61204"
FT                   /db_xref="GOA:C8W3V0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V0"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACV61204.1"
FT   gene            270840..272397
FT                   /locus_tag="Dtox_R0006"
FT   rRNA            270840..272397
FT                   /locus_tag="Dtox_R0006"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            272529..272643
FT                   /locus_tag="Dtox_R0007"
FT   rRNA            272529..272643
FT                   /locus_tag="Dtox_R0007"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            272997..273073
FT                   /locus_tag="Dtox_R0008"
FT                   /note="tRNA-Ile1"
FT   tRNA            272997..273073
FT                   /locus_tag="Dtox_R0008"
FT                   /product="tRNA-Ile"
FT   gene            273242..273317
FT                   /locus_tag="Dtox_R0009"
FT                   /note="tRNA-Ala1"
FT   tRNA            273242..273317
FT                   /locus_tag="Dtox_R0009"
FT                   /product="tRNA-Ala"
FT   gene            273419..276352
FT                   /locus_tag="Dtox_R0010"
FT   rRNA            273419..276352
FT                   /locus_tag="Dtox_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            276394..276468
FT                   /locus_tag="Dtox_R0011"
FT                   /note="tRNA-Asn1"
FT   tRNA            276394..276468
FT                   /locus_tag="Dtox_R0011"
FT                   /product="tRNA-Asn"
FT   gene            276823..277299
FT                   /locus_tag="Dtox_0252"
FT   CDS_pept        276823..277299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0252"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: bsu:BSU00830 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61205"
FT                   /db_xref="GOA:C8W3V1"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V1"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ACV61205.1"
FT   gene            277313..277837
FT                   /locus_tag="Dtox_0253"
FT   CDS_pept        277313..277837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0253"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: bsu:BSU00840
FT                   modulation of CtsR repression"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61206"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V2"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ACV61206.1"
FT                   RLLEKDIYRKG"
FT   gene            277842..278903
FT                   /locus_tag="Dtox_0254"
FT   CDS_pept        277842..278903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0254"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   bha:BH0102 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61207"
FT                   /db_xref="GOA:C8W3V3"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V3"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ACV61207.1"
FT                   ILRAELIRERLNG"
FT   gene            279032..281464
FT                   /locus_tag="Dtox_0255"
FT   CDS_pept        279032..281464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0255"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; UvrB/UvrC
FT                   protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61208"
FT                   /db_xref="GOA:C8W3V4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V4"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACV61208.1"
FT   gene            281610..282983
FT                   /locus_tag="Dtox_0256"
FT   CDS_pept        281610..282983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0256"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: bha:BH0104 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61209"
FT                   /db_xref="GOA:C8W3V5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V5"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACV61209.1"
FT   gene            282983..284062
FT                   /locus_tag="Dtox_0257"
FT   CDS_pept        282983..284062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0257"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; helix-
FT                   hairpin-helix motif; KEGG: bsu:BSU00880 DNA integrity
FT                   scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61210"
FT                   /db_xref="GOA:C8W3V6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V6"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACV61210.1"
FT   gene            complement(284097..284495)
FT                   /locus_tag="Dtox_0258"
FT   CDS_pept        complement(284097..284495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61211"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61211.1"
FT   gene            284699..285175
FT                   /locus_tag="Dtox_0259"
FT   CDS_pept        284699..285175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0259"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: sat:SYN_00997
FT                   CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61212"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V8"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACV61212.1"
FT   gene            285368..286519
FT                   /locus_tag="Dtox_0260"
FT   CDS_pept        285368..286519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0260"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; KEGG: baa:BA_0673 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61213"
FT                   /db_xref="GOA:C8W3V9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV61213.1"
FT   sig_peptide     285368..285448
FT                   /locus_tag="Dtox_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.632 at
FT                   residue 27"
FT   gene            286506..287204
FT                   /locus_tag="Dtox_0261"
FT   CDS_pept        286506..287204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0261"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   gbm:Gbem_3797 2-C-methyl-D-erythritol 4- phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61214"
FT                   /db_xref="GOA:C8W3W0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W0"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACV61214.1"
FT                   EAILNRRKHK"
FT   gene            287201..287674
FT                   /locus_tag="Dtox_0262"
FT   CDS_pept        287201..287674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0262"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /note="KEGG: gur:Gura_4164 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61215"
FT                   /db_xref="GOA:C8W3W1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W1"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACV61215.1"
FT   gene            287754..289211
FT                   /locus_tag="Dtox_0263"
FT   CDS_pept        287754..289211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0263"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: bha:BH0109
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61216"
FT                   /db_xref="GOA:C8W3W2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W2"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ACV61216.1"
FT   gene            289257..289937
FT                   /locus_tag="Dtox_0264"
FT   CDS_pept        289257..289937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0264"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   baa:BA_0677 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61217"
FT                   /db_xref="GOA:C8W3W3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W3"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACV61217.1"
FT                   KLEL"
FT   gene            289968..291470
FT                   /locus_tag="Dtox_0265"
FT   CDS_pept        289968..291470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0265"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0678 tRNA synthetases class I (C);
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61218"
FT                   /db_xref="GOA:C8W3W4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W4"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACV61218.1"
FT   gene            291474..291905
FT                   /locus_tag="Dtox_0266"
FT   CDS_pept        291474..291905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0266"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; SMART: ribonuclease III;
FT                   KEGG: bha:BH0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61219"
FT                   /db_xref="GOA:C8W3W5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W5"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ACV61219.1"
FT   gene            292124..292864
FT                   /locus_tag="Dtox_0267"
FT   CDS_pept        292124..292864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0267"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: bha:BH0113
FT                   tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61220"
FT                   /db_xref="GOA:C8W3W6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W6"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACV61220.1"
FT   gene            292866..293378
FT                   /locus_tag="Dtox_0268"
FT   CDS_pept        292866..293378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0268"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   bha:BH0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61221"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ACV61221.1"
FT                   KLRRKKF"
FT   gene            293571..294215
FT                   /locus_tag="Dtox_0269"
FT   CDS_pept        293571..294215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0269"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bha:BH0115 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61222"
FT                   /db_xref="GOA:C8W3W8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W8"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ACV61222.1"
FT   gene            294371..294446
FT                   /locus_tag="Dtox_R0012"
FT                   /note="tRNA-Thr1"
FT   tRNA            294371..294446
FT                   /locus_tag="Dtox_R0012"
FT                   /product="tRNA-Thr"
FT   gene            294460..294545
FT                   /locus_tag="Dtox_R0013"
FT                   /note="tRNA-Tyr1"
FT   tRNA            294460..294545
FT                   /locus_tag="Dtox_R0013"
FT                   /product="tRNA-Tyr"
FT   gene            294611..294686
FT                   /locus_tag="Dtox_R0014"
FT                   /note="tRNA-Met1"
FT   tRNA            294611..294686
FT                   /locus_tag="Dtox_R0014"
FT                   /product="tRNA-Met"
FT   gene            294690..294766
FT                   /locus_tag="Dtox_R0015"
FT                   /note="tRNA-Thr2"
FT   tRNA            294690..294766
FT                   /locus_tag="Dtox_R0015"
FT                   /product="tRNA-Thr"
FT   gene            294773..294849
FT                   /locus_tag="Dtox_R0016"
FT                   /note="tRNA-Met2"
FT   tRNA            294773..294849
FT                   /locus_tag="Dtox_R0016"
FT                   /product="tRNA-Met"
FT   gene            295055..296257
FT                   /locus_tag="Dtox_0270"
FT   CDS_pept        295055..296257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0270"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bsu:BSU01130
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61223"
FT                   /db_xref="GOA:C8W3W9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W9"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACV61223.1"
FT                   E"
FT   gene            296417..296566
FT                   /locus_tag="Dtox_0271"
FT   CDS_pept        296417..296566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0271"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: gsu:GSU2870 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61224"
FT                   /db_xref="GOA:C8W3X0"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X0"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACV61224.1"
FT                   KETR"
FT   gene            296692..297063
FT                   /locus_tag="Dtox_0272"
FT   CDS_pept        296692..297063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0272"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bsu:BSU01000
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61225"
FT                   /db_xref="GOA:C8W3X1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X1"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACV61225.1"
FT   gene            297118..297645
FT                   /locus_tag="Dtox_0273"
FT   CDS_pept        297118..297645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0273"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: bsu:BSU01010 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM: NGN domain
FT                   protein; SMART: NGN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61226"
FT                   /db_xref="GOA:C8W3X2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X2"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACV61226.1"
FT                   VELDFTQIARLD"
FT   gene            297703..298128
FT                   /locus_tag="Dtox_0274"
FT   CDS_pept        297703..298128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0274"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: bsu:BSU01020 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61227"
FT                   /db_xref="GOA:C8W3X3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X3"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACV61227.1"
FT   gene            298212..298910
FT                   /locus_tag="Dtox_0275"
FT   CDS_pept        298212..298910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0275"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: bha:BH0120 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61228"
FT                   /db_xref="GOA:C8W3X4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X4"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ACV61228.1"
FT                   VSINTQKITG"
FT   gene            299090..299617
FT                   /locus_tag="Dtox_0276"
FT   CDS_pept        299090..299617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0276"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gbm:Gbem_0924
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61229"
FT                   /db_xref="GOA:C8W3X5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X5"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACV61229.1"
FT                   LEAVRKQKAGEA"
FT   gene            299691..300071
FT                   /locus_tag="Dtox_0277"
FT   CDS_pept        299691..300071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0277"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bha:BH0122 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61230"
FT                   /db_xref="GOA:C8W3X6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X6"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACV61230.1"
FT   gene            300462..304145
FT                   /locus_tag="Dtox_0278"
FT   CDS_pept        300462..304145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0278"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0689 RNA polymerase beta subunit;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta subunit; PFAM:
FT                   RNA polymerase Rpb2 domain 6; RNA polymerase beta subunit;
FT                   RNA polymerase Rpb2 domain 7; RNA polymerase Rpb2 domain 3;
FT                   RNA polymerase Rpb2 domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61231"
FT                   /db_xref="GOA:C8W3X7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X7"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACV61231.1"
FT                   DE"
FT   gene            304234..307761
FT                   /locus_tag="Dtox_0279"
FT   CDS_pept        304234..307761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0279"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: baa:BA_0690 RNA polymerase alpha subunit;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit; PFAM:
FT                   RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1 domain 5;
FT                   RNA polymerase Rpb1 domain 3; RNA polymerase alpha subunit;
FT                   RNA polymerase Rpb1 domain 4; SMART: RNA polymerase I
FT                   subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61232"
FT                   /db_xref="GOA:C8W3X8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X8"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACV61232.1"
FT                   DAGVMDERQ"
FT   gene            307995..308243
FT                   /locus_tag="Dtox_0280"
FT   CDS_pept        307995..308243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0280"
FT                   /product="putative ribosomal protein L7Ae-like protein"
FT                   /note="KEGG: bsu:BSU01090 putative ribosomal protein L7Ae-
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61233"
FT                   /db_xref="GOA:C8W3X9"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X9"
FT                   /inference="similar to AA sequence:KEGG:BSU01090"
FT                   /protein_id="ACV61233.1"
FT   gene            308314..308688
FT                   /locus_tag="Dtox_0281"
FT   CDS_pept        308314..308688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0281"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: geo:Geob_3630 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61234"
FT                   /db_xref="GOA:C8W3Y0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACV61234.1"
FT   gene            308736..309206
FT                   /locus_tag="Dtox_0282"
FT   CDS_pept        308736..309206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0282"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: bha:BH0130 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61235"
FT                   /db_xref="GOA:C8W3Y1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y1"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACV61235.1"
FT   gene            309219..311294
FT                   /locus_tag="Dtox_0283"
FT   CDS_pept        309219..311294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0283"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: gsu:GSU2860 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61236"
FT                   /db_xref="GOA:C8W3Y2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y2"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACV61236.1"
FT   gene            311554..312756
FT                   /locus_tag="Dtox_0284"
FT   CDS_pept        311554..312756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0284"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bsu:BSU01130
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61237"
FT                   /db_xref="GOA:C8W3Y3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y3"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACV61237.1"
FT                   A"
FT   gene            312867..313175
FT                   /locus_tag="Dtox_0285"
FT   CDS_pept        312867..313175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0285"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: bha:BH0133 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61238"
FT                   /db_xref="GOA:C8W3Y4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y4"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACV61238.1"
FT   gene            313228..313857
FT                   /locus_tag="Dtox_0286"
FT   CDS_pept        313228..313857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0286"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bsu:BSU01160 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61239"
FT                   /db_xref="GOA:C8W3Y5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y5"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ACV61239.1"
FT   gene            313886..314506
FT                   /locus_tag="Dtox_0287"
FT   CDS_pept        313886..314506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0287"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bha:BH0135 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61240"
FT                   /db_xref="GOA:C8W3Y6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y6"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACV61240.1"
FT   gene            314506..314790
FT                   /locus_tag="Dtox_0288"
FT   CDS_pept        314506..314790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0288"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rbo:A1I_02045
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61241"
FT                   /db_xref="GOA:C8W3Y7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y7"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACV61241.1"
FT   gene            314819..315646
FT                   /locus_tag="Dtox_0289"
FT   CDS_pept        314819..315646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0289"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: bha:BH0137 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61242"
FT                   /db_xref="GOA:C8W3Y8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y8"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACV61242.1"
FT   gene            315691..315975
FT                   /locus_tag="Dtox_0290"
FT   CDS_pept        315691..315975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0290"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bha:BH0138 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61243"
FT                   /db_xref="GOA:C8W3Y9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y9"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACV61243.1"
FT   gene            316009..316350
FT                   /locus_tag="Dtox_0291"
FT   CDS_pept        316009..316350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0291"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: bha:BH0139 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61244"
FT                   /db_xref="GOA:C8W3Z0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z0"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACV61244.1"
FT                   IVVREKKEG"
FT   gene            316352..317014
FT                   /locus_tag="Dtox_0292"
FT   CDS_pept        316352..317014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0292"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: baa:BA_0701 ribosomal protein S3, C-terminal
FT                   domain; TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; KH type 2 domain protein;
FT                   Ribosomal protein S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61245"
FT                   /db_xref="GOA:C8W3Z1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z1"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACV61245.1"
FT   gene            317019..317450
FT                   /locus_tag="Dtox_0293"
FT   CDS_pept        317019..317450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0293"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: bsu:BSU01230 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61246"
FT                   /db_xref="GOA:C8W3Z2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z2"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACV61246.1"
FT   gene            317440..317649
FT                   /locus_tag="Dtox_0294"
FT   CDS_pept        317440..317649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0294"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: bha:BH0142 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61247"
FT                   /db_xref="GOA:C8W3Z3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z3"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACV61247.1"
FT   gene            317676..317939
FT                   /locus_tag="Dtox_0295"
FT   CDS_pept        317676..317939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0295"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: gme:Gmet_0635 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61248"
FT                   /db_xref="GOA:C8W3Z4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z4"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACV61248.1"
FT   gene            317983..318351
FT                   /locus_tag="Dtox_0296"
FT   CDS_pept        317983..318351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0296"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bha:BH0144 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61249"
FT                   /db_xref="GOA:C8W3Z5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACV61249.1"
FT                   ELRDKDYMKIVSLAPEVI"
FT   gene            318414..318734
FT                   /locus_tag="Dtox_0297"
FT   CDS_pept        318414..318734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0297"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: sfu:Sfum_1566 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61250"
FT                   /db_xref="GOA:C8W3Z6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z6"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACV61250.1"
FT                   ID"
FT   gene            318762..319304
FT                   /locus_tag="Dtox_0298"
FT   CDS_pept        318762..319304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0298"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: bha:BH0146 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61251"
FT                   /db_xref="GOA:C8W3Z7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z7"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACV61251.1"
FT                   EEGRELLRLMGMPFKAN"
FT   gene            319334..319519
FT                   /locus_tag="Dtox_0299"
FT   CDS_pept        319334..319519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0299"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: dvl:Dvul_1752 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61252"
FT                   /db_xref="GOA:C8W3Z8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z8"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACV61252.1"
FT                   ELAYKGEIPGIRKASW"
FT   gene            319540..319938
FT                   /locus_tag="Dtox_0300"
FT   CDS_pept        319540..319938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0300"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61253"
FT                   /db_xref="GOA:C8W3Z9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z9"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACV61253.1"
FT   gene            319966..320508
FT                   /locus_tag="Dtox_0301"
FT   CDS_pept        319966..320508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0301"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: bha:BH0149 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61254"
FT                   /db_xref="GOA:C8W400"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C8W400"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ACV61254.1"
FT                   YEGEYVRRKAGKAGKAR"
FT   gene            320552..320920
FT                   /locus_tag="Dtox_0302"
FT   CDS_pept        320552..320920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0302"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bsu:BSU01320 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61255"
FT                   /db_xref="GOA:C8W401"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C8W401"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACV61255.1"
FT                   HGRVKALAEAARKGGLEF"
FT   gene            320943..321443
FT                   /locus_tag="Dtox_0303"
FT   CDS_pept        320943..321443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0303"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   bha:BH0151 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61256"
FT                   /db_xref="GOA:C8W402"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C8W402"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACV61256.1"
FT                   LLS"
FT   gene            321455..321634
FT                   /locus_tag="Dtox_0304"
FT   CDS_pept        321455..321634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0304"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: baa:BA_0711 ribosomal protein L30p/L7e"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61257"
FT                   /db_xref="GOA:C8W403"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W403"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACV61257.1"
FT                   MINKVSHLLKIEEV"
FT   gene            321647..322087
FT                   /locus_tag="Dtox_0305"
FT   CDS_pept        321647..322087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0305"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: bha:BH0153 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61258"
FT                   /db_xref="GOA:C8W404"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C8W404"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACV61258.1"
FT   gene            322089..323354
FT                   /locus_tag="Dtox_0306"
FT   CDS_pept        322089..323354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0306"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: sfu:Sfum_1575 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61259"
FT                   /db_xref="GOA:C8W405"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C8W405"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACV61259.1"
FT   gene            323374..324123
FT                   /locus_tag="Dtox_0307"
FT   CDS_pept        323374..324123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0307"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: bha:BH0156 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61260"
FT                   /db_xref="GOA:C8W406"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W406"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ACV61260.1"
FT   gene            324166..324447
FT                   /locus_tag="Dtox_0308"
FT   CDS_pept        324166..324447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61261"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:C8W407"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61261.1"
FT   gene            324497..324715
FT                   /locus_tag="Dtox_0309"
FT   CDS_pept        324497..324715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0309"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: bha:BH0158 translation initiation factor IF-1;
FT                   TIGRFAM: translation initiation factor IF-1; PFAM: S1 IF1
FT                   family protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61262"
FT                   /db_xref="GOA:C8W408"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W408"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ACV61262.1"
FT   gene            324746..324859
FT                   /locus_tag="Dtox_0310"
FT   CDS_pept        324746..324859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0310"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: bsu:BSU01400 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61263"
FT                   /db_xref="GOA:C8W409"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C8W409"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACV61263.1"
FT   gene            324881..325252
FT                   /locus_tag="Dtox_0311"
FT   CDS_pept        324881..325252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0311"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: geo:Geob_3602
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61264"
FT                   /db_xref="GOA:C8W410"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C8W410"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ACV61264.1"
FT   gene            325270..325659
FT                   /locus_tag="Dtox_0312"
FT   CDS_pept        325270..325659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0312"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bha:BH0161 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61265"
FT                   /db_xref="GOA:C8W411"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W411"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ACV61265.1"
FT   gene            325679..326305
FT                   /locus_tag="Dtox_0313"
FT   CDS_pept        325679..326305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0313"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: gbm:Gbem_0959 ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61266"
FT                   /db_xref="GOA:C8W412"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8W412"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACV61266.1"
FT   gene            326359..327306
FT                   /locus_tag="Dtox_0314"
FT   CDS_pept        326359..327306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0314"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bha:BH0162 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61267"
FT                   /db_xref="GOA:C8W413"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C8W413"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACV61267.1"
FT   gene            327320..327658
FT                   /locus_tag="Dtox_0315"
FT   CDS_pept        327320..327658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0315"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: pca:Pcar_0729 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61268"
FT                   /db_xref="GOA:C8W414"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C8W414"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACV61268.1"
FT                   DMVILELV"
FT   gene            327675..328508
FT                   /locus_tag="Dtox_0316"
FT   CDS_pept        327675..328508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0316"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_00209 ABC-type cobalt transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61269"
FT                   /db_xref="GOA:C8W415"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:C8W415"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61269.1"
FT   gene            328499..329350
FT                   /locus_tag="Dtox_0317"
FT   CDS_pept        328499..329350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0317"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU01460 cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61270"
FT                   /db_xref="GOA:C8W416"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:C8W416"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61270.1"
FT                   KK"
FT   gene            329368..330156
FT                   /locus_tag="Dtox_0318"
FT   CDS_pept        329368..330156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0318"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: baa:BA_0724
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61271"
FT                   /db_xref="GOA:C8W417"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W417"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV61271.1"
FT   gene            330175..330927
FT                   /locus_tag="Dtox_0319"
FT   CDS_pept        330175..330927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0319"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU01480 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61272"
FT                   /db_xref="GOA:C8W418"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W418"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACV61272.1"
FT   gene            331058..331504
FT                   /locus_tag="Dtox_0320"
FT   CDS_pept        331058..331504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0320"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: abo:ABO_0576 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61273"
FT                   /db_xref="GOA:C8W419"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C8W419"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACV61273.1"
FT   gene            331505..331897
FT                   /locus_tag="Dtox_0321"
FT   CDS_pept        331505..331897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0321"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bha:BH0169 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61274"
FT                   /db_xref="GOA:C8W420"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C8W420"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACV61274.1"
FT   gene            332107..332847
FT                   /locus_tag="Dtox_0322"
FT   CDS_pept        332107..332847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0322"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH0239 germination specific N-
FT                   acetylmuramoyl-L-alanine amidase; TIGRFAM:
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; PFAM: cell wall
FT                   hydrolase/autolysin; SMART: cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61275"
FT                   /db_xref="GOA:C8W421"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:C8W421"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ACV61275.1"
FT   sig_peptide     332107..332187
FT                   /locus_tag="Dtox_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.493 at
FT                   residue 27"
FT   gene            332977..333798
FT                   /locus_tag="Dtox_0323"
FT   CDS_pept        332977..333798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0323"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   sat:SYN_02198 lysine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61276"
FT                   /db_xref="GOA:C8W422"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C8W422"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACV61276.1"
FT   sig_peptide     332977..333057
FT                   /locus_tag="Dtox_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.754 at
FT                   residue 27"
FT   gene            333967..335370
FT                   /locus_tag="Dtox_0324"
FT   CDS_pept        333967..335370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0324"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; Extradiol ring-
FT                   cleavage dioxygenase class III protein subunit B; KEGG:
FT                   glo:Glov_0529 AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61277"
FT                   /db_xref="GOA:C8W423"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:C8W423"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ACV61277.1"
FT                   ERFEVIRYS"
FT   gene            335515..336516
FT                   /locus_tag="Dtox_0325"
FT   CDS_pept        335515..336516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0325"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gme:Gmet_1006 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61278"
FT                   /db_xref="GOA:C8W424"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W424"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61278.1"
FT   gene            336604..337260
FT                   /locus_tag="Dtox_0326"
FT   CDS_pept        336604..337260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0326"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: dal:Dalk_3454
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61279"
FT                   /db_xref="GOA:C8W425"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8W425"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACV61279.1"
FT   gene            337369..338340
FT                   /locus_tag="Dtox_0327"
FT   CDS_pept        337369..338340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0327"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="KEGG: dat:HRM2_33640 putative SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61280"
FT                   /db_xref="GOA:C8W426"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8W426"
FT                   /inference="similar to AA sequence:KEGG:HRM2_33640"
FT                   /protein_id="ACV61280.1"
FT   gene            338532..340154
FT                   /locus_tag="Dtox_0328"
FT   CDS_pept        338532..340154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0328"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: wsu:WS1160 oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61281"
FT                   /db_xref="GOA:C8W427"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W427"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61281.1"
FT   sig_peptide     338532..338606
FT                   /locus_tag="Dtox_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            340161..341141
FT                   /locus_tag="Dtox_0329"
FT   CDS_pept        340161..341141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0329"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce4301 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61282"
FT                   /db_xref="GOA:C8W428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W428"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61282.1"
FT   gene            341182..342072
FT                   /locus_tag="Dtox_0330"
FT   CDS_pept        341182..342072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0330"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dal:Dalk_0870
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61283"
FT                   /db_xref="GOA:C8W429"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W429"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61283.1"
FT                   ISRELERIVDPRMGR"
FT   sig_peptide     341182..341319
FT                   /locus_tag="Dtox_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.559 at
FT                   residue 46"
FT   gene            342100..343821
FT                   /locus_tag="Dtox_0331"
FT   CDS_pept        342100..343821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0331"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: noc:Noc_0936 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61284"
FT                   /db_xref="GOA:C8W430"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W430"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61284.1"
FT   gene            344548..344988
FT                   /locus_tag="Dtox_0332"
FT   CDS_pept        344548..344988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0332"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bha:BH1396 FUR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61285"
FT                   /db_xref="GOA:C8W431"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W431"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV61285.1"
FT   gene            345224..346132
FT                   /locus_tag="Dtox_0333"
FT   CDS_pept        345224..346132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0333"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dds:Ddes_1008 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61286"
FT                   /db_xref="GOA:C8W432"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C8W432"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACV61286.1"
FT   sig_peptide     345224..345298
FT                   /locus_tag="Dtox_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.530 at
FT                   residue 25"
FT   gene            346133..346951
FT                   /locus_tag="Dtox_0334"
FT   CDS_pept        346133..346951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pag:PLES_58961 zinc transport protein ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61287"
FT                   /db_xref="GOA:C8W433"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W433"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61287.1"
FT   gene            346948..347799
FT                   /locus_tag="Dtox_0335"
FT   CDS_pept        346948..347799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0335"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: dds:Ddes_1010 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61288"
FT                   /db_xref="GOA:C8W434"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8W434"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV61288.1"
FT                   FR"
FT   gene            347887..348927
FT                   /locus_tag="Dtox_0336"
FT   CDS_pept        347887..348927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0336"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: bsu:BSU03250 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61289"
FT                   /db_xref="GOA:C8W435"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C8W435"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ACV61289.1"
FT                   MGVIAR"
FT   gene            348924..349730
FT                   /locus_tag="Dtox_0337"
FT   CDS_pept        348924..349730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0337"
FT                   /product="Protein of unknown function DUF1980"
FT                   /note="PFAM: Protein of unknown function DUF1980; KEGG:
FT                   baa:BA_2274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61290"
FT                   /db_xref="GOA:C8W436"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:C8W436"
FT                   /inference="protein motif:PFAM:PF09323"
FT                   /protein_id="ACV61290.1"
FT   gene            349783..350784
FT                   /locus_tag="Dtox_0338"
FT   CDS_pept        349783..350784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0338"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: swd:Swoo_3483
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61291"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W437"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACV61291.1"
FT   gene            350771..351397
FT                   /locus_tag="Dtox_0339"
FT   CDS_pept        350771..351397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61292"
FT                   /db_xref="GOA:C8W438"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W438"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61292.1"
FT   gene            complement(351660..352802)
FT                   /locus_tag="Dtox_0340"
FT   CDS_pept        complement(351660..352802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0340"
FT                   /product="Metal-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61293"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:C8W439"
FT                   /inference="protein motif:COG:COG5643"
FT                   /protein_id="ACV61293.1"
FT   sig_peptide     complement(352731..352802)
FT                   /locus_tag="Dtox_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(352845..353297)
FT                   /locus_tag="Dtox_0341"
FT   CDS_pept        complement(352845..353297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0341"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   dal:Dalk_5286 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61294"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:C8W440"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ACV61294.1"
FT   gene            complement(353291..354070)
FT                   /locus_tag="Dtox_0342"
FT   CDS_pept        complement(353291..354070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0342"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: dol:Dole_2510 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61295"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W441"
FT                   /inference="similar to AA sequence:KEGG:Dole_2510"
FT                   /protein_id="ACV61295.1"
FT   gene            355018..356631
FT                   /locus_tag="Dtox_0343"
FT   CDS_pept        355018..356631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0343"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: wsu:WS1160 oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61296"
FT                   /db_xref="GOA:C8W442"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W442"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61296.1"
FT   sig_peptide     355018..355119
FT                   /locus_tag="Dtox_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.734 at
FT                   residue 34"
FT   gene            356661..357632
FT                   /locus_tag="Dtox_0344"
FT   CDS_pept        356661..357632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0344"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL110455 putative
FT                   substrate-binding component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61297"
FT                   /db_xref="GOA:C8W443"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W443"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61297.1"
FT   gene            357622..358485
FT                   /locus_tag="Dtox_0345"
FT   CDS_pept        357622..358485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0345"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: wsu:WS1158 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61298"
FT                   /db_xref="GOA:C8W4U6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61298.1"
FT                   EKHVKH"
FT   gene            358472..360190
FT                   /locus_tag="Dtox_0346"
FT   CDS_pept        358472..360190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0346"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: tbd:Tbd_1668 oligopeptidee ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61299"
FT                   /db_xref="GOA:C8W4U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61299.1"
FT   gene            complement(360406..361368)
FT                   /locus_tag="Dtox_0347"
FT   CDS_pept        complement(360406..361368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0347"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0571 oligopeptide ABC
FT                   transporter ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61300"
FT                   /db_xref="GOA:C8W4U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61300.1"
FT   gene            complement(361355..362350)
FT                   /locus_tag="Dtox_0348"
FT   CDS_pept        complement(361355..362350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0348"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: reh:H16_B1125 ABC-type transporter, ATPase
FT                   component: PepT family; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61301"
FT                   /db_xref="GOA:C8W4U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61301.1"
FT   gene            complement(362347..363198)
FT                   /locus_tag="Dtox_0349"
FT   CDS_pept        complement(362347..363198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0349"
FT                   /product="nickel ABC transporter, permease subunit NikC"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikC; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61302"
FT                   /db_xref="GOA:C8W4V0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V0"
FT                   /inference="protein motif:TFAM:TIGR02790"
FT                   /protein_id="ACV61302.1"
FT                   IL"
FT   gene            complement(363208..364140)
FT                   /locus_tag="Dtox_0350"
FT   CDS_pept        complement(363208..364140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0350"
FT                   /product="nickel ABC transporter, permease subunit NikB"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikB; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7614 nickel ABC
FT                   transporter permease subunit NikB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61303"
FT                   /db_xref="GOA:C8W4V1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V1"
FT                   /inference="protein motif:TFAM:TIGR02789"
FT                   /protein_id="ACV61303.1"
FT   gene            complement(364217..365815)
FT                   /locus_tag="Dtox_0351"
FT   CDS_pept        complement(364217..365815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0351"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /note="TIGRFAM: nickel ABC transporter, periplasmic nickel-
FT                   binding protein; PFAM: extracellular solute-binding protein
FT                   family 5; KEGG: dvm:DvMF_2402 nickel ABC transporter,
FT                   periplasmic nickel-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61304"
FT                   /db_xref="GOA:C8W4V2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V2"
FT                   /inference="protein motif:TFAM:TIGR02294"
FT                   /protein_id="ACV61304.1"
FT                   LSTQYDVPLTDIDIK"
FT   sig_peptide     complement(365750..365815)
FT                   /locus_tag="Dtox_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.617 at
FT                   residue 22"
FT   gene            366511..367260
FT                   /locus_tag="Dtox_0352"
FT   CDS_pept        366511..367260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0352"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61305"
FT                   /db_xref="GOA:C8W4V3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61305.1"
FT   gene            367315..369042
FT                   /locus_tag="Dtox_0353"
FT   CDS_pept        367315..369042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1962 ABC efflux pump, fused ATPase and
FT                   inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61306"
FT                   /db_xref="GOA:C8W4V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61306.1"
FT   sig_peptide     367315..367431
FT                   /locus_tag="Dtox_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.663 at
FT                   residue 39"
FT   gene            369057..370814
FT                   /locus_tag="Dtox_0354"
FT   CDS_pept        369057..370814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0354"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bch:Bcen2424_4081 ABC transporter, transmembrane region,
FT                   type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61307"
FT                   /db_xref="GOA:C8W4V5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61307.1"
FT                   VSSQVAVSG"
FT   gene            371174..371854
FT                   /locus_tag="Dtox_0355"
FT   CDS_pept        371174..371854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0355"
FT                   /product="Peroxiredoxin"
FT                   /EC_number=""
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   swi:Swit_3743 1-Cys peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61308"
FT                   /db_xref="GOA:C8W4V6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61308.1"
FT                   RKEK"
FT   gene            complement(372045..372356)
FT                   /pseudo
FT                   /locus_tag="Dtox_0356"
FT   gene            372720..373328
FT                   /locus_tag="Dtox_0357"
FT   CDS_pept        372720..373328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61309"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61309.1"
FT   gene            373598..373741
FT                   /locus_tag="Dtox_0358"
FT   CDS_pept        373598..373741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61310"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61310.1"
FT                   EG"
FT   gene            complement(373749..375461)
FT                   /locus_tag="Dtox_0359"
FT   CDS_pept        complement(373749..375461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0359"
FT                   /product="transposase-like protein"
FT                   /note="KEGG: dal:Dalk_3879 transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61311"
FT                   /db_xref="UniProtKB/TrEMBL:C8VXG4"
FT                   /inference="similar to AA sequence:KEGG:Dalk_3879"
FT                   /protein_id="ACV61311.1"
FT   gene            375721..377241
FT                   /locus_tag="Dtox_0360"
FT   CDS_pept        375721..377241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0360"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bar:GBAA4729 solute-binding family 5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61312"
FT                   /db_xref="GOA:C8W4W0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61312.1"
FT   sig_peptide     375721..375795
FT                   /locus_tag="Dtox_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.736 at
FT                   residue 25"
FT   gene            377281..377883
FT                   /locus_tag="Dtox_0361"
FT   CDS_pept        377281..377883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0361"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: pha:PSHAa2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61313"
FT                   /db_xref="GOA:C8W4W1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W1"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACV61313.1"
FT   gene            377977..379047
FT                   /locus_tag="Dtox_0362"
FT   CDS_pept        377977..379047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0362"
FT                   /product="O-methyltransferase family 2"
FT                   /note="PFAM: O-methyltransferase family 2; KEGG:
FT                   sus:Acid_0820 hydroxyneurosporene-O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61314"
FT                   /db_xref="GOA:C8W4W2"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W2"
FT                   /inference="protein motif:PFAM:PF00891"
FT                   /protein_id="ACV61314.1"
FT                   KIGDTLDSKIIIASRC"
FT   gene            379418..379719
FT                   /pseudo
FT                   /locus_tag="Dtox_0363"
FT   gene            379709..380056
FT                   /pseudo
FT                   /locus_tag="Dtox_0364"
FT   gene            380445..381998
FT                   /locus_tag="Dtox_0365"
FT   CDS_pept        380445..381998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0365"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH0031 oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61315"
FT                   /db_xref="GOA:C8W4W3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61315.1"
FT                   "
FT   sig_peptide     380445..380510
FT                   /locus_tag="Dtox_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.487 at
FT                   residue 22"
FT   gene            382010..382287
FT                   /pseudo
FT                   /locus_tag="Dtox_0366"
FT   gene            complement(382404..382877)
FT                   /locus_tag="Dtox_0367"
FT   CDS_pept        complement(382404..382877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0367"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dat:HRM2_46890 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61316"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W4"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACV61316.1"
FT   gene            383530..383820
FT                   /locus_tag="Dtox_0368"
FT   CDS_pept        383530..383820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W5"
FT                   /inference="similar to AA sequence:KEGG:BH3910"
FT                   /protein_id="ACV61317.1"
FT   sig_peptide     383530..383625
FT                   /locus_tag="Dtox_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.615 at
FT                   residue 32"
FT   gene            383889..384839
FT                   /locus_tag="Dtox_0369"
FT   CDS_pept        383889..384839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0369"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0568 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61318"
FT                   /db_xref="GOA:C8W4W6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61318.1"
FT   gene            384829..385683
FT                   /locus_tag="Dtox_0370"
FT   CDS_pept        384829..385683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0370"
FT                   /product="nickel ABC transporter, permease subunit NikC"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikC; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61319"
FT                   /db_xref="GOA:C8W4W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W7"
FT                   /inference="protein motif:TFAM:TIGR02790"
FT                   /protein_id="ACV61319.1"
FT                   TER"
FT   gene            385763..386758
FT                   /locus_tag="Dtox_0371"
FT   CDS_pept        385763..386758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0371"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: avi:Avi_5352 ABC transporter nucleotide
FT                   binding/ATPase protein (oligopeptide); TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61320"
FT                   /db_xref="GOA:C8W4W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61320.1"
FT   gene            386755..387726
FT                   /locus_tag="Dtox_0372"
FT   CDS_pept        386755..387726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0372"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61321"
FT                   /db_xref="GOA:C8W4W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61321.1"
FT   gene            387843..388829
FT                   /locus_tag="Dtox_0373"
FT   CDS_pept        387843..388829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0373"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_0545 domain of unknown function DUF25;
FT                   TIGRFAM: methionine-R-sulfoxide reductase; peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase B; Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61322"
FT                   /db_xref="GOA:C8W4X0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X0"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ACV61322.1"
FT   gene            complement(388989..391061)
FT                   /locus_tag="Dtox_0374"
FT   CDS_pept        complement(388989..391061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61323"
FT                   /db_xref="GOA:C8W4X1"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR033734"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61323.1"
FT   gene            391323..391748
FT                   /pseudo
FT                   /locus_tag="Dtox_0375"
FT   gene            392255..392422
FT                   /locus_tag="Dtox_0376"
FT   CDS_pept        392255..392422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61324"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61324.1"
FT                   NILQKAENWL"
FT   gene            392771..393328
FT                   /locus_tag="Dtox_0377"
FT   CDS_pept        392771..393328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0377"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: pla:Plav_0951 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61325"
FT                   /db_xref="GOA:C8W4X3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61325.1"
FT   gene            393321..394364
FT                   /locus_tag="Dtox_0378"
FT   CDS_pept        393321..394364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61326"
FT                   /db_xref="GOA:C8W4X4"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61326.1"
FT                   DVIVPLN"
FT   gene            complement(394568..394780)
FT                   /pseudo
FT                   /locus_tag="Dtox_0379"
FT   gene            complement(394896..395215)
FT                   /pseudo
FT                   /locus_tag="Dtox_0380"
FT   gene            complement(395436..395953)
FT                   /pseudo
FT                   /locus_tag="Dtox_0381"
FT   gene            complement(396030..396563)
FT                   /locus_tag="Dtox_0382"
FT   CDS_pept        complement(396030..396563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61327"
FT                   /db_xref="GOA:C8W4X5"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61327.1"
FT                   VVILIALTSRTIPN"
FT   gene            complement(397470..399284)
FT                   /locus_tag="Dtox_0383"
FT   CDS_pept        complement(397470..399284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0383"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   shn:Shewana3_3655 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61328"
FT                   /db_xref="GOA:C8W4X6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X6"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV61328.1"
FT   gene            400126..400602
FT                   /locus_tag="Dtox_0384"
FT   CDS_pept        400126..400602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61329"
FT                   /db_xref="GOA:C8W4X7"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61329.1"
FT   gene            400605..401447
FT                   /locus_tag="Dtox_0385"
FT   CDS_pept        400605..401447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0385"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   bha:BH0397 sensory histidine kinase DcuS"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61330"
FT                   /db_xref="GOA:C8W4X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61330.1"
FT   gene            401450..402046
FT                   /locus_tag="Dtox_0386"
FT   CDS_pept        401450..402046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0386"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; SMART: Accessory
FT                   gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61331"
FT                   /db_xref="GOA:C8W4X9"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X9"
FT                   /inference="protein motif:PFAM:PF04647"
FT                   /protein_id="ACV61331.1"
FT   gene            402073..402195
FT                   /locus_tag="Dtox_0387"
FT   CDS_pept        402073..402195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61332"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61332.1"
FT   sig_peptide     402073..402153
FT                   /locus_tag="Dtox_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.654 at
FT                   residue 27"
FT   gene            402266..402967
FT                   /locus_tag="Dtox_0388"
FT   CDS_pept        402266..402967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0388"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding region; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gme:Gmet_2697 LytR/AlgR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61333"
FT                   /db_xref="GOA:C8W4Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y1"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ACV61333.1"
FT                   YAGMVKSAIKW"
FT   gene            403562..404020
FT                   /locus_tag="Dtox_0389"
FT   CDS_pept        403562..404020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61334"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61334.1"
FT   sig_peptide     403562..403642
FT                   /locus_tag="Dtox_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            404023..404388
FT                   /locus_tag="Dtox_0390"
FT   CDS_pept        404023..404388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61335"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61335.1"
FT                   KHNGETDTDGSYASTNY"
FT   sig_peptide     404023..404100
FT                   /locus_tag="Dtox_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.671 at
FT                   residue 26"
FT   gene            complement(404714..404932)
FT                   /locus_tag="Dtox_0391"
FT   CDS_pept        complement(404714..404932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61336"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61336.1"
FT   gene            complement(404962..405708)
FT                   /locus_tag="Dtox_0392"
FT   CDS_pept        complement(404962..405708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0392"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   sat:SYN_00397 ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61337"
FT                   /db_xref="GOA:C8W4Y5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y5"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACV61337.1"
FT   gene            complement(405698..407276)
FT                   /pseudo
FT                   /locus_tag="Dtox_0393"
FT   gene            complement(407618..408088)
FT                   /locus_tag="Dtox_0394"
FT   CDS_pept        complement(407618..408088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0512 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61338"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61338.1"
FT   sig_peptide     complement(407999..408088)
FT                   /locus_tag="Dtox_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(408248..408589)
FT                   /locus_tag="Dtox_0395"
FT   CDS_pept        complement(408248..408589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61339.1"
FT                   NSWSYKDSS"
FT   sig_peptide     complement(408512..408589)
FT                   /locus_tag="Dtox_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 26"
FT   gene            complement(408579..408683)
FT                   /locus_tag="Dtox_0396"
FT   CDS_pept        complement(408579..408683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61340.1"
FT   gene            complement(408715..409185)
FT                   /locus_tag="Dtox_0397"
FT   CDS_pept        complement(408715..409185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61341"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61341.1"
FT   sig_peptide     complement(409108..409185)
FT                   /locus_tag="Dtox_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.910 at
FT                   residue 26"
FT   gene            409323..409694
FT                   /pseudo
FT                   /locus_tag="Dtox_0398"
FT   gene            complement(409886..410614)
FT                   /locus_tag="Dtox_0399"
FT   CDS_pept        complement(409886..410614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0399"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   aba:Acid345_3291 transcriptional regulator, LytR/AlgR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61342"
FT                   /db_xref="GOA:C8W4Z0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61342.1"
FT   gene            complement(410665..410973)
FT                   /locus_tag="Dtox_0400"
FT   CDS_pept        complement(410665..410973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61343"
FT                   /db_xref="GOA:C8W4Z1"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61343.1"
FT   gene            complement(410970..412409)
FT                   /locus_tag="Dtox_0401"
FT   CDS_pept        complement(410970..412409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0401"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   ent:Ent638_3378 signal transduction histidine kinase
FT                   regulating citrate/malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61344"
FT                   /db_xref="GOA:C8W4Z2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61344.1"
FT   gene            413494..413688
FT                   /locus_tag="Dtox_0402"
FT   CDS_pept        413494..413688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61345"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61345.1"
FT   gene            complement(413855..415147)
FT                   /locus_tag="Dtox_0403"
FT   CDS_pept        complement(413855..415147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0403"
FT                   /product="oxidoreductase/nitrogenase component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   dat:HRM2_08730 NifD1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61346"
FT                   /db_xref="GOA:C8W4Z4"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z4"
FT                   /inference="protein motif:PFAM:PF00148"
FT                   /protein_id="ACV61346.1"
FT   gene            complement(415116..417311)
FT                   /locus_tag="Dtox_0404"
FT   CDS_pept        complement(415116..417311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0404"
FT                   /product="NifH/frxC-family protein"
FT                   /note="PFAM: NifH/frxC-family protein;
FT                   oxidoreductase/nitrogenase component 1; KEGG: dal:Dalk_0725
FT                   NifH/FrxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61347"
FT                   /db_xref="GOA:C8W4Z5"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z5"
FT                   /inference="protein motif:PFAM:PF00142"
FT                   /protein_id="ACV61347.1"
FT   gene            complement(417458..418192)
FT                   /locus_tag="Dtox_0405"
FT   CDS_pept        complement(417458..418192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61348"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61348.1"
FT   gene            418463..418600
FT                   /pseudo
FT                   /locus_tag="Dtox_0406"
FT   gene            418717..420632
FT                   /pseudo
FT                   /locus_tag="Dtox_0407"
FT   gene            421509..421838
FT                   /pseudo
FT                   /locus_tag="Dtox_0408"
FT   gene            421838..422903
FT                   /pseudo
FT                   /locus_tag="Dtox_0409"
FT   gene            423066..425318
FT                   /locus_tag="Dtox_0410"
FT   CDS_pept        423066..425318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0410"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Propeptide PepSY amd
FT                   peptidase M4; KEGG: bar:GBAA_pXO1_0124 S-layer protein,
FT                   (pXO1-90)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61349"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z7"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61349.1"
FT   sig_peptide     423066..423143
FT                   /locus_tag="Dtox_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 26"
FT   gene            425756..426055
FT                   /locus_tag="Dtox_0411"
FT   CDS_pept        425756..426055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0411"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: pha:PSHAa1040
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61350"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z8"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACV61350.1"
FT   gene            426048..426494
FT                   /locus_tag="Dtox_0412"
FT   CDS_pept        426048..426494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0412"
FT                   /product="nucleic acid-binding protein contains PIN
FT                   domain-like protein"
FT                   /note="KEGG: sme:SMa0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61351"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z9"
FT                   /inference="protein motif:COG:COG4113"
FT                   /protein_id="ACV61351.1"
FT   gene            complement(426877..428235)
FT                   /locus_tag="Dtox_0413"
FT   CDS_pept        complement(426877..428235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61352"
FT                   /db_xref="UniProtKB/TrEMBL:C8W500"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61352.1"
FT   gene            428835..429113
FT                   /locus_tag="Dtox_0414"
FT   CDS_pept        428835..429113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0414"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: rfe:RF_0827
FT                   DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61353"
FT                   /db_xref="GOA:C8W501"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:C8W501"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACV61353.1"
FT   gene            429185..429298
FT                   /locus_tag="Dtox_0415"
FT   CDS_pept        429185..429298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61354"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61354.1"
FT   gene            429285..429689
FT                   /locus_tag="Dtox_0416"
FT   CDS_pept        429285..429689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0416"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   acr:Acry_3301 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61355"
FT                   /db_xref="GOA:C8VVY0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVY0"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV61355.1"
FT   gene            429695..430786
FT                   /locus_tag="Dtox_0417"
FT   CDS_pept        429695..430786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0417"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0388
FT                   IS891/IS1136/IS1341 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61356"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C8W504"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61356.1"
FT   gene            430949..431197
FT                   /pseudo
FT                   /locus_tag="Dtox_0418"
FT   gene            431603..431776
FT                   /locus_tag="Dtox_0419"
FT   CDS_pept        431603..431776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61357"
FT                   /db_xref="UniProtKB/TrEMBL:C8W505"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61357.1"
FT                   RSVRTNIESAWM"
FT   gene            432221..432820
FT                   /pseudo
FT                   /locus_tag="Dtox_0420"
FT   gene            complement(433134..433514)
FT                   /locus_tag="Dtox_0421"
FT   CDS_pept        complement(433134..433514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W506"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61358.1"
FT   gene            complement(433750..438939)
FT                   /locus_tag="Dtox_0422"
FT   CDS_pept        complement(433750..438939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0422"
FT                   /product="cell wall/surface repeat protein"
FT                   /note="TIGRFAM: cell wall/surface repeat protein; PFAM:
FT                   protein of unknown function DUF291; S-layer domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61359"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:C8W507"
FT                   /inference="protein motif:TFAM:TIGR02543"
FT                   /protein_id="ACV61359.1"
FT   sig_peptide     complement(438853..438939)
FT                   /locus_tag="Dtox_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(439141..440076)
FT                   /locus_tag="Dtox_0423"
FT   CDS_pept        complement(439141..440076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0423"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain-containing protein
FT                   AraC type; SMART: helix-turn-helix- domain-containing
FT                   protein AraC type; KEGG: scl:sce7020 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61360"
FT                   /db_xref="GOA:C8W508"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8W508"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV61360.1"
FT   gene            complement(440204..440755)
FT                   /locus_tag="Dtox_0424"
FT   CDS_pept        complement(440204..440755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61361"
FT                   /db_xref="UniProtKB/TrEMBL:C8W509"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61361.1"
FT   gene            complement(440845..441048)
FT                   /locus_tag="Dtox_0425"
FT   CDS_pept        complement(440845..441048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61362"
FT                   /db_xref="UniProtKB/TrEMBL:C8W510"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61362.1"
FT   sig_peptide     complement(440974..441048)
FT                   /locus_tag="Dtox_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.777 at
FT                   residue 25"
FT   gene            complement(441124..441651)
FT                   /locus_tag="Dtox_0426"
FT   CDS_pept        complement(441124..441651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61363"
FT                   /db_xref="UniProtKB/TrEMBL:C8W511"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61363.1"
FT                   RIYTKTEIRLGI"
FT   sig_peptide     complement(441550..441651)
FT                   /locus_tag="Dtox_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.584 at
FT                   residue 34"
FT   gene            complement(441743..442098)
FT                   /pseudo
FT                   /locus_tag="Dtox_0427"
FT   gene            complement(442155..442448)
FT                   /pseudo
FT                   /locus_tag="Dtox_0428"
FT   gene            complement(442454..442798)
FT                   /pseudo
FT                   /locus_tag="Dtox_0429"
FT   gene            complement(442799..443528)
FT                   /pseudo
FT                   /locus_tag="Dtox_0430"
FT   gene            complement(443692..443967)
FT                   /pseudo
FT                   /locus_tag="Dtox_0431"
FT   gene            complement(444177..445031)
FT                   /pseudo
FT                   /locus_tag="Dtox_0432"
FT   gene            complement(445028..445678)
FT                   /locus_tag="Dtox_0433"
FT   CDS_pept        complement(445028..445678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61364"
FT                   /db_xref="UniProtKB/TrEMBL:C8W512"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61364.1"
FT   gene            complement(445801..445977)
FT                   /locus_tag="Dtox_0434"
FT   CDS_pept        complement(445801..445977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61365"
FT                   /db_xref="UniProtKB/TrEMBL:C8W513"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61365.1"
FT                   TAWMREQTLQLSR"
FT   gene            complement(446380..447792)
FT                   /locus_tag="Dtox_0435"
FT   CDS_pept        complement(446380..447792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0435"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: gsu:GSU2670 LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61366"
FT                   /db_xref="GOA:C8W514"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W514"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV61366.1"
FT                   LLAQLVSNRDEK"
FT   gene            448277..451957
FT                   /locus_tag="Dtox_0436"
FT   CDS_pept        448277..451957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0436"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Ig domain protein
FT                   group 2 domain protein; SMART: Ig domain protein group 2
FT                   domain protein; KEGG: baa:BA_1469 SLH, S-layer homology
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61367"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W515"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61367.1"
FT                   E"
FT   sig_peptide     448277..448354
FT                   /locus_tag="Dtox_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(452128..452685)
FT                   /locus_tag="Dtox_0437"
FT   CDS_pept        complement(452128..452685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0437"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sfu:Sfum_3444 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61368"
FT                   /db_xref="GOA:C8W516"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W516"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACV61368.1"
FT   gene            complement(453100..453486)
FT                   /locus_tag="Dtox_0438"
FT   CDS_pept        complement(453100..453486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0438"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   ppd:Ppro_1109 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61369"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W517"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACV61369.1"
FT   gene            453733..455799
FT                   /locus_tag="Dtox_0439"
FT   CDS_pept        453733..455799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0439"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /EC_number=""
FT                   /note="KEGG: vha:VIBHAR_05301 citrate lyase ligase;
FT                   TIGRFAM: cytidyltransferase-related domain protein; PFAM:
FT                   Citrate lyase ligase domain protein; SMART: Citrate lyase
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61370"
FT                   /db_xref="GOA:C8W518"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W518"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACV61370.1"
FT   gene            455970..456515
FT                   /locus_tag="Dtox_0440"
FT   CDS_pept        455970..456515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0440"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bar:GBAA1753 RNA polymerase factor
FT                   sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61371"
FT                   /db_xref="GOA:C8W519"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W519"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61371.1"
FT                   DNRLLRGRKIIKEVLSYD"
FT   gene            456508..457824
FT                   /locus_tag="Dtox_0441"
FT   CDS_pept        456508..457824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61372"
FT                   /db_xref="GOA:C8W520"
FT                   /db_xref="UniProtKB/TrEMBL:C8W520"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61372.1"
FT   gene            complement(458003..458779)
FT                   /locus_tag="Dtox_0442"
FT   CDS_pept        complement(458003..458779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0442"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   scl:sce6748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61373"
FT                   /db_xref="GOA:C8W521"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W521"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ACV61373.1"
FT   gene            complement(458781..459584)
FT                   /locus_tag="Dtox_0443"
FT   CDS_pept        complement(458781..459584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0443"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="KEGG: aav:Aave_2072 putative ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61374"
FT                   /db_xref="GOA:C8W522"
FT                   /db_xref="UniProtKB/TrEMBL:C8W522"
FT                   /inference="similar to AA sequence:KEGG:Aave_2072"
FT                   /protein_id="ACV61374.1"
FT   sig_peptide     complement(459483..459584)
FT                   /locus_tag="Dtox_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.756) with cleavage site probability 0.373 at
FT                   residue 34"
FT   gene            complement(459581..460555)
FT                   /locus_tag="Dtox_0444"
FT   CDS_pept        complement(459581..460555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0444"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6750 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61375"
FT                   /db_xref="GOA:C8W523"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W523"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61375.1"
FT   gene            460841..461854
FT                   /locus_tag="Dtox_0445"
FT   CDS_pept        460841..461854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0445"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: afw:Anae109_0117 cell shape determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61376"
FT                   /db_xref="GOA:C8W524"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C8W524"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACV61376.1"
FT   gene            complement(462393..463187)
FT                   /locus_tag="Dtox_0446"
FT   CDS_pept        complement(462393..463187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0446"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vvu:VV1_0837 ABC-type oligopeptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61377"
FT                   /db_xref="GOA:C8W525"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W525"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61377.1"
FT   gene            complement(463171..464178)
FT                   /locus_tag="Dtox_0447"
FT   CDS_pept        complement(463171..464178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0447"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61378"
FT                   /db_xref="GOA:C8W526"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W526"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61378.1"
FT   gene            complement(464202..465065)
FT                   /locus_tag="Dtox_0448"
FT   CDS_pept        complement(464202..465065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bar:GBAA4731 oligopeptide
FT                   ABC transporter, oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61379"
FT                   /db_xref="GOA:C8W527"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W527"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61379.1"
FT                   REGQIE"
FT   sig_peptide     complement(464952..465065)
FT                   /locus_tag="Dtox_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.940 at
FT                   residue 38"
FT   gene            complement(465067..466017)
FT                   /locus_tag="Dtox_0449"
FT   CDS_pept        complement(465067..466017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0449"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2185 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61380"
FT                   /db_xref="GOA:C8W528"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W528"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61380.1"
FT   sig_peptide     complement(465928..466017)
FT                   /locus_tag="Dtox_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.640 at
FT                   residue 30"
FT   gene            complement(466023..467582)
FT                   /locus_tag="Dtox_0450"
FT   CDS_pept        complement(466023..467582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0450"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH1796 nickel ABC transporter (nickel- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61381"
FT                   /db_xref="GOA:C8W529"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W529"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61381.1"
FT                   KE"
FT   sig_peptide     complement(467496..467582)
FT                   /locus_tag="Dtox_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.421 at
FT                   residue 29"
FT   gene            complement(467918..468610)
FT                   /locus_tag="Dtox_0451"
FT   CDS_pept        complement(467918..468610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0451"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: net:Neut_1733 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61382"
FT                   /db_xref="GOA:C8W530"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W530"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61382.1"
FT                   FRFVLTDK"
FT   gene            468993..469412
FT                   /locus_tag="Dtox_0452"
FT   CDS_pept        468993..469412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0452"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: dps:DP1497 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61383"
FT                   /db_xref="GOA:C8W531"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W531"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV61383.1"
FT   gene            469430..471322
FT                   /locus_tag="Dtox_0453"
FT   CDS_pept        469430..471322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0453"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: dvm:DvMF_1917 heavy metal
FT                   translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61384"
FT                   /db_xref="GOA:C8W532"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W532"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACV61384.1"
FT   gene            471725..473068
FT                   /locus_tag="Dtox_0454"
FT   CDS_pept        471725..473068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asu:Asuc_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61385"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C8W533"
FT                   /inference="similar to AA sequence:KEGG:Asuc_1537"
FT                   /protein_id="ACV61385.1"
FT   gene            473109..473222
FT                   /locus_tag="Dtox_0455"
FT   CDS_pept        473109..473222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61386"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61386.1"
FT   gene            473209..473613
FT                   /locus_tag="Dtox_0456"
FT   CDS_pept        473209..473613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0456"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   acr:Acry_3301 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61387"
FT                   /db_xref="GOA:C8VVY0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVY0"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV61387.1"
FT   gene            473619..474710
FT                   /locus_tag="Dtox_0457"
FT   CDS_pept        473619..474710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0457"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0388
FT                   IS891/IS1136/IS1341 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61388"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C8W536"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61388.1"
FT   gene            complement(474967..475197)
FT                   /pseudo
FT                   /locus_tag="Dtox_0458"
FT   gene            complement(475313..476317)
FT                   /locus_tag="Dtox_0459"
FT   CDS_pept        complement(475313..476317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0459"
FT                   /product="Putative phage-associated protein"
FT                   /note="KEGG: ngk:NGK_1933 putative phage associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61389"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:C8W537"
FT                   /inference="protein motif:COG:COG3600"
FT                   /protein_id="ACV61389.1"
FT   gene            complement(476345..476755)
FT                   /locus_tag="Dtox_0460"
FT   CDS_pept        complement(476345..476755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W538"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61390.1"
FT   gene            477360..477602
FT                   /pseudo
FT                   /locus_tag="Dtox_0461"
FT   gene            477622..478041
FT                   /locus_tag="Dtox_0462"
FT   CDS_pept        477622..478041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0462"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   gur:Gura_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61391"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C8W539"
FT                   /inference="protein motif:PFAM:PF08818"
FT                   /protein_id="ACV61391.1"
FT   gene            478038..478385
FT                   /locus_tag="Dtox_0463"
FT   CDS_pept        478038..478385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61392"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:C8W540"
FT                   /inference="similar to AA sequence:KEGG:Acid_6254"
FT                   /protein_id="ACV61392.1"
FT                   AKGKPVEKVLR"
FT   gene            478496..478798
FT                   /locus_tag="Dtox_0464"
FT   CDS_pept        478496..478798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0464"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: hpa:HPAG1_0202
FT                   putative transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61393"
FT                   /db_xref="GOA:C8W541"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W541"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV61393.1"
FT   gene            478823..480103
FT                   /locus_tag="Dtox_0465"
FT   CDS_pept        478823..480103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0465"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; KEGG:
FT                   bar:GBAA1783 IS605 family transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61394"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W542"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61394.1"
FT   gene            480227..480526
FT                   /locus_tag="Dtox_0466"
FT   CDS_pept        480227..480526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_3375 prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61395"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C8W543"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61395.1"
FT   gene            complement(480600..482414)
FT                   /locus_tag="Dtox_0467"
FT   CDS_pept        complement(480600..482414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0467"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: shn:Shewana3_3655 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61396"
FT                   /db_xref="GOA:C8VZR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8VZR2"
FT                   /inference="protein motif:COG:COG5421"
FT                   /protein_id="ACV61396.1"
FT   gene            482524..482871
FT                   /locus_tag="Dtox_0468"
FT   CDS_pept        482524..482871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE0510A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61397"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C8W545"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61397.1"
FT                   VYLMAQKRTDK"
FT   gene            483304..483756
FT                   /locus_tag="Dtox_0469"
FT   CDS_pept        483304..483756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61398"
FT                   /db_xref="GOA:C8W546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W546"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61398.1"
FT   gene            complement(484776..485010)
FT                   /pseudo
FT                   /locus_tag="Dtox_0470"
FT   gene            485017..485694
FT                   /locus_tag="Dtox_0471"
FT   CDS_pept        485017..485694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0471"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: bsu:BSU07580 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61399"
FT                   /db_xref="GOA:C8W547"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W547"
FT                   /inference="protein motif:COG:COG3290"
FT                   /protein_id="ACV61399.1"
FT                   SEQ"
FT   gene            485971..486108
FT                   /locus_tag="Dtox_0472"
FT   CDS_pept        485971..486108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61400"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W548"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61400.1"
FT                   "
FT   gene            486210..487163
FT                   /locus_tag="Dtox_0473"
FT   CDS_pept        486210..487163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0473"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ppd:Ppro_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61401"
FT                   /db_xref="GOA:C8W549"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8W549"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV61401.1"
FT   gene            487821..488018
FT                   /locus_tag="Dtox_0474"
FT   CDS_pept        487821..488018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61402"
FT                   /db_xref="UniProtKB/TrEMBL:C8W550"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61402.1"
FT   gene            488039..488851
FT                   /locus_tag="Dtox_0475"
FT   CDS_pept        488039..488851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0475"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: pca:Pcar_0192
FT                   molybdopterin oxidoreductase/precorrin-4 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61403"
FT                   /db_xref="GOA:C8W551"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W551"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACV61403.1"
FT   gene            489003..489128
FT                   /locus_tag="Dtox_0476"
FT   CDS_pept        489003..489128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61404"
FT                   /db_xref="UniProtKB/TrEMBL:C8W552"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61404.1"
FT   gene            489358..489741
FT                   /pseudo
FT                   /locus_tag="Dtox_0477"
FT   gene            489749..491206
FT                   /locus_tag="Dtox_0478"
FT   CDS_pept        489749..491206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0478"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; KEGG:
FT                   bar:GBAA1783 IS605 family transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61405"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W553"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61405.1"
FT   gene            491477..492658
FT                   /locus_tag="Dtox_0479"
FT   CDS_pept        491477..492658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0479"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61406"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C8W554"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACV61406.1"
FT   gene            492649..493494
FT                   /locus_tag="Dtox_0480"
FT   CDS_pept        492649..493494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0480"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   cbg:CbuG_1165 radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61407"
FT                   /db_xref="GOA:C8W555"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:C8W555"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61407.1"
FT                   "
FT   gene            complement(493538..493654)
FT                   /locus_tag="Dtox_0481"
FT   CDS_pept        complement(493538..493654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61408"
FT                   /db_xref="UniProtKB/TrEMBL:C8W556"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61408.1"
FT   gene            complement(493821..494351)
FT                   /locus_tag="Dtox_0482"
FT   CDS_pept        complement(493821..494351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0482"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   sat:SYN_00084 multimeric flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61409"
FT                   /db_xref="GOA:C8W557"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W557"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ACV61409.1"
FT                   QRIAQKASELFGE"
FT   gene            494758..495189
FT                   /locus_tag="Dtox_0483"
FT   CDS_pept        494758..495189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0483"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   plu:plu4158 IS200 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61410"
FT                   /db_xref="GOA:C8W558"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8W558"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV61410.1"
FT   gene            495322..496382
FT                   /pseudo
FT                   /locus_tag="Dtox_0484"
FT   gene            496382..497455
FT                   /locus_tag="Dtox_0485"
FT   CDS_pept        496382..497455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0485"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: dal:Dalk_5081 transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61411"
FT                   /db_xref="GOA:C8W5V6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V6"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV61411.1"
FT                   LGAPLFLYLLFKGVRTR"
FT   sig_peptide     496382..496516
FT                   /locus_tag="Dtox_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.620 at
FT                   residue 45"
FT   gene            497452..498210
FT                   /locus_tag="Dtox_0486"
FT   CDS_pept        497452..498210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0486"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_3057 ATP-binding component of
FT                   citrate-dependent iron (III) transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61412"
FT                   /db_xref="GOA:C8W5V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61412.1"
FT   gene            498349..499161
FT                   /locus_tag="Dtox_0487"
FT   CDS_pept        498349..499161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0487"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: dds:Ddes_1510 cyclopropane-fatty-acyl-
FT                   phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61413"
FT                   /db_xref="GOA:C8W5V8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61413.1"
FT   gene            499724..500431
FT                   /locus_tag="Dtox_0488"
FT   CDS_pept        499724..500431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0488"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bha:BH1808 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61414"
FT                   /db_xref="GOA:C8W5V9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61414.1"
FT                   IKTVWGVGYKIEK"
FT   gene            500421..501581
FT                   /locus_tag="Dtox_0489"
FT   CDS_pept        500421..501581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0489"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bar:GBAA5105 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61415"
FT                   /db_xref="GOA:C8W5W0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61415.1"
FT   sig_peptide     500421..500549
FT                   /locus_tag="Dtox_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.215 at
FT                   residue 43"
FT   gene            complement(501626..502354)
FT                   /locus_tag="Dtox_0490"
FT   CDS_pept        complement(501626..502354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0490"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bar:GBAA0962
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61416"
FT                   /db_xref="GOA:C8W5W1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W1"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACV61416.1"
FT   gene            502634..503755
FT                   /locus_tag="Dtox_0491"
FT   CDS_pept        502634..503755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0491"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: wsu:WS0721 penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61417"
FT                   /db_xref="GOA:C8W5W2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W2"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACV61417.1"
FT   sig_peptide     502634..502726
FT                   /locus_tag="Dtox_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.403 at
FT                   residue 31"
FT   gene            503978..504850
FT                   /locus_tag="Dtox_0492"
FT   CDS_pept        503978..504850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0492"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7347 ABC
FT                   transporter membrane spanning protein (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61418"
FT                   /db_xref="GOA:C8W5W3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61418.1"
FT                   ERKISNMIN"
FT   gene            504880..505767
FT                   /locus_tag="Dtox_0493"
FT   CDS_pept        504880..505767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0493"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sml:Smlt3250 putative sugar
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61419"
FT                   /db_xref="GOA:C8W5W4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61419.1"
FT                   KYLLEGIRLSGIKG"
FT   sig_peptide     504880..504975
FT                   /locus_tag="Dtox_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.366 at
FT                   residue 32"
FT   gene            505824..507073
FT                   /pseudo
FT                   /locus_tag="Dtox_0494"
FT   gene            507070..508473
FT                   /locus_tag="Dtox_0495"
FT   CDS_pept        507070..508473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU33260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61420"
FT                   /db_xref="GOA:C8W5W5"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61420.1"
FT                   TPAETWAFL"
FT   sig_peptide     507070..507156
FT                   /locus_tag="Dtox_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.727 at
FT                   residue 29"
FT   gene            508510..509625
FT                   /locus_tag="Dtox_0496"
FT   CDS_pept        508510..509625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0496"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bha:BH1140
FT                   sugar ABC transportor ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61421"
FT                   /db_xref="GOA:C8W5W6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61421.1"
FT   gene            509690..511069
FT                   /locus_tag="Dtox_0497"
FT   CDS_pept        509690..511069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0497"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61422"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV61422.1"
FT                   E"
FT   sig_peptide     509690..509782
FT                   /locus_tag="Dtox_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 31"
FT   gene            511071..511190
FT                   /pseudo
FT                   /locus_tag="Dtox_0498"
FT   gene            511222..511440
FT                   /pseudo
FT                   /locus_tag="Dtox_0499"
FT   gene            complement(511714..512337)
FT                   /locus_tag="Dtox_0500"
FT   CDS_pept        complement(511714..512337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61423"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61423.1"
FT   sig_peptide     complement(512257..512337)
FT                   /locus_tag="Dtox_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.888 at
FT                   residue 27"
FT   gene            complement(512405..514066)
FT                   /locus_tag="Dtox_0501"
FT   CDS_pept        complement(512405..514066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61424.1"
FT   sig_peptide     complement(513992..514066)
FT                   /locus_tag="Dtox_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            514667..515194
FT                   /locus_tag="Dtox_0502"
FT   CDS_pept        514667..515194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0502"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   bha:BH0263 RNA polymerase sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61425"
FT                   /db_xref="GOA:C8W5X0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61425.1"
FT                   EGYLELKEGGIK"
FT   gene            515194..515946
FT                   /locus_tag="Dtox_0503"
FT   CDS_pept        515194..515946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61426"
FT                   /db_xref="GOA:C8W5X1"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61426.1"
FT   gene            complement(515924..516358)
FT                   /locus_tag="Dtox_0504"
FT   CDS_pept        complement(515924..516358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61427"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61427.1"
FT   sig_peptide     complement(516278..516358)
FT                   /locus_tag="Dtox_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.812 at
FT                   residue 27"
FT   gene            complement(516556..516831)
FT                   /locus_tag="Dtox_0505"
FT   CDS_pept        complement(516556..516831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61428"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61428.1"
FT   gene            516954..517121
FT                   /locus_tag="Dtox_0506"
FT   CDS_pept        516954..517121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0506"
FT                   /product="substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="KEGG: pfo:Pfl01_1606 substrate-binding region of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61429"
FT                   /db_xref="GOA:C8W5X4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X4"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_1606"
FT                   /protein_id="ACV61429.1"
FT                   YRCDETAVPE"
FT   gene            complement(517515..518291)
FT                   /locus_tag="Dtox_0507"
FT   CDS_pept        complement(517515..518291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0507"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   maq:Maqu_3709 IstB ATP binding domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61430"
FT                   /db_xref="GOA:C8W5X5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X5"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACV61430.1"
FT   gene            complement(518298..519824)
FT                   /pseudo
FT                   /locus_tag="Dtox_0508"
FT   gene            519940..520404
FT                   /pseudo
FT                   /locus_tag="Dtox_0509"
FT   gene            complement(520864..521262)
FT                   /locus_tag="Dtox_0510"
FT   CDS_pept        complement(520864..521262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61431"
FT                   /db_xref="GOA:C8W5X6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61431.1"
FT   gene            complement(521597..523411)
FT                   /locus_tag="Dtox_0511"
FT   CDS_pept        complement(521597..523411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0511"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: rsq:Rsph17025_3830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61432"
FT                   /db_xref="GOA:C8VXB5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8VXB5"
FT                   /inference="protein motif:COG:COG5421"
FT                   /protein_id="ACV61432.1"
FT   gene            complement(523543..523866)
FT                   /locus_tag="Dtox_0512"
FT   CDS_pept        complement(523543..523866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61433"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61433.1"
FT                   YKI"
FT   sig_peptide     complement(523801..523866)
FT                   /locus_tag="Dtox_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.584 at
FT                   residue 22"
FT   gene            524492..524695
FT                   /locus_tag="Dtox_0513"
FT   CDS_pept        524492..524695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wpi:WPa_0972 putative reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61434"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61434.1"
FT   gene            complement(524700..524782)
FT                   /pseudo
FT                   /locus_tag="Dtox_0514"
FT   gene            525055..526251
FT                   /locus_tag="Dtox_0515"
FT   CDS_pept        525055..526251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0515"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bar:GBAA2786 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; CBS domain-containing protein;
FT                   SMART: AAA ATPase; CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61435"
FT                   /db_xref="GOA:C8W5Y0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y0"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ACV61435.1"
FT   gene            526241..527074
FT                   /locus_tag="Dtox_0516"
FT   CDS_pept        526241..527074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0516"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aeh:Mlg_0733
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61436"
FT                   /db_xref="GOA:C8W5Y1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61436.1"
FT   gene            527090..527989
FT                   /locus_tag="Dtox_0517"
FT   CDS_pept        527090..527989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0517"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bsu:BSU03000 glycine
FT                   betaine ABC transporter (glycine betaine-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61437"
FT                   /db_xref="GOA:C8W5Y2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y2"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV61437.1"
FT                   IGLVVPDYVTINSIEELK"
FT   sig_peptide     527090..527179
FT                   /locus_tag="Dtox_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.831 at
FT                   residue 30"
FT   gene            528133..529506
FT                   /locus_tag="Dtox_0518"
FT   CDS_pept        528133..529506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0518"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number=""
FT                   /note="PFAM: cation transporter; KEGG: bsu:BSU13500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61438"
FT                   /db_xref="GOA:C8W5Y3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y3"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61438.1"
FT   sig_peptide     528133..528273
FT                   /locus_tag="Dtox_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.635) with cleavage site probability 0.360 at
FT                   residue 47"
FT   gene            529603..530280
FT                   /locus_tag="Dtox_0519"
FT   CDS_pept        529603..530280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0519"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: bha:BH2663 potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61439"
FT                   /db_xref="GOA:C8W5Y4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACV61439.1"
FT                   DDK"
FT   gene            530577..531170
FT                   /locus_tag="Dtox_0520"
FT   CDS_pept        530577..531170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0520"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tgr:Tgr7_0301
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61440"
FT                   /db_xref="GOA:C8W5Y5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV61440.1"
FT   gene            531195..532379
FT                   /locus_tag="Dtox_0521"
FT   CDS_pept        531195..532379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0521"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tdn:Suden_0535 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61441"
FT                   /db_xref="GOA:C8W5Y6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV61441.1"
FT   sig_peptide     531195..531272
FT                   /locus_tag="Dtox_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.677 at
FT                   residue 26"
FT   gene            532366..535464
FT                   /locus_tag="Dtox_0522"
FT   CDS_pept        532366..535464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0522"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   nis:NIS_0076 RND efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61442"
FT                   /db_xref="GOA:C8W5Y7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACV61442.1"
FT   gene            complement(536032..537792)
FT                   /locus_tag="Dtox_0523"
FT   CDS_pept        complement(536032..537792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0523"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: hha:Hhal_0784 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61443"
FT                   /db_xref="GOA:C8VWQ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C8VWQ4"
FT                   /inference="protein motif:COG:COG5421"
FT                   /protein_id="ACV61443.1"
FT                   NILQKAENWL"
FT   gene            538488..539276
FT                   /locus_tag="Dtox_0524"
FT   CDS_pept        538488..539276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61444"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61444.1"
FT   sig_peptide     538488..538571
FT                   /locus_tag="Dtox_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            complement(539514..539987)
FT                   /locus_tag="Dtox_0525"
FT   CDS_pept        complement(539514..539987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61445"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z0"
FT                   /inference="similar to AA sequence:KEGG:DDBDRAFT_0204403"
FT                   /protein_id="ACV61445.1"
FT   gene            540067..540759
FT                   /locus_tag="Dtox_0526"
FT   CDS_pept        540067..540759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61446"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR021617"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61446.1"
FT                   NAPIYKNN"
FT   gene            541224..541760
FT                   /locus_tag="Dtox_0527"
FT   CDS_pept        541224..541760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG03185"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61447"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61447.1"
FT                   KHEQDIFMLRKRLVG"
FT   gene            542060..543022
FT                   /locus_tag="Dtox_0528"
FT   CDS_pept        542060..543022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0528"
FT                   /product="Domain of unknown function DUF1835"
FT                   /note="PFAM: Domain of unknown function DUF1835; KEGG:
FT                   bar:GBAA2625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61448"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z3"
FT                   /inference="protein motif:PFAM:PF08874"
FT                   /protein_id="ACV61448.1"
FT   gene            complement(543338..543769)
FT                   /locus_tag="Dtox_0529"
FT   CDS_pept        complement(543338..543769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0529"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: vok:COSY_0678
FT                   negative regulator of ferric iron uptake"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61449"
FT                   /db_xref="GOA:C8W5Z4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV61449.1"
FT   gene            complement(543954..544178)
FT                   /locus_tag="Dtox_0530"
FT   CDS_pept        complement(543954..544178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0530"
FT                   /product="peptide deformylase"
FT                   /note="KEGG: bph:Bphy_0035 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61450"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_0035"
FT                   /protein_id="ACV61450.1"
FT   gene            complement(544258..544581)
FT                   /locus_tag="Dtox_0531"
FT   CDS_pept        complement(544258..544581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61451"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z6"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1582"
FT                   /protein_id="ACV61451.1"
FT                   DTE"
FT   gene            complement(544707..544874)
FT                   /locus_tag="Dtox_0532"
FT   CDS_pept        complement(544707..544874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0532"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dal:Dalk_3511 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61452.1"
FT                   EECPNEAISL"
FT   gene            545621..546802
FT                   /locus_tag="Dtox_0533"
FT   CDS_pept        545621..546802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0533"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH3300 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61453"
FT                   /db_xref="GOA:C8W5Z8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z8"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACV61453.1"
FT   gene            546964..547848
FT                   /locus_tag="Dtox_0534"
FT   CDS_pept        546964..547848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0534"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number=""
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   dol:Dole_2330 methylenetetrahydrofolate reductase
FT                   (NAD(P)H)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61454"
FT                   /db_xref="GOA:C8W5Z9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Z9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61454.1"
FT                   IVKGLRNRGFLTI"
FT   gene            548429..549193
FT                   /locus_tag="Dtox_0535"
FT   CDS_pept        548429..549193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0535"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; Transcription regulator MerR DNA
FT                   binding; SMART: regulatory protein MerR; KEGG: bar:GBAA5200
FT                   transcriptional activator TipA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61455"
FT                   /db_xref="GOA:C8W600"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C8W600"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACV61455.1"
FT   gene            549335..549949
FT                   /locus_tag="Dtox_0536"
FT   CDS_pept        549335..549949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0536"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sfu:Sfum_3090
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61456"
FT                   /db_xref="GOA:C8W601"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8W601"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV61456.1"
FT   gene            550091..550792
FT                   /locus_tag="Dtox_0537"
FT   CDS_pept        550091..550792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0537"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mno:Mnod_0192 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61457"
FT                   /db_xref="GOA:C8W602"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C8W602"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACV61457.1"
FT                   KIRYRLIPFVW"
FT   sig_peptide     550091..550189
FT                   /locus_tag="Dtox_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.547 at
FT                   residue 33"
FT   gene            551136..552071
FT                   /locus_tag="Dtox_0538"
FT   CDS_pept        551136..552071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0538"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0568 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61458"
FT                   /db_xref="GOA:C8W603"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W603"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61458.1"
FT   sig_peptide     551136..551240
FT                   /locus_tag="Dtox_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.615 at
FT                   residue 35"
FT   gene            552086..553078
FT                   /locus_tag="Dtox_0539"
FT   CDS_pept        552086..553078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0539"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61459"
FT                   /db_xref="GOA:C8W604"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W604"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61459.1"
FT   gene            553041..553826
FT                   /locus_tag="Dtox_0540"
FT   CDS_pept        553041..553826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0540"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH0350 oligopeptide ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61460"
FT                   /db_xref="GOA:C8W605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W605"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61460.1"
FT   gene            553789..554796
FT                   /locus_tag="Dtox_0541"
FT   CDS_pept        553789..554796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0541"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: aha:AHA_3428 oligopeptide transport ATP-
FT                   binding protein AppF; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61461"
FT                   /db_xref="GOA:C8W606"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W606"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61461.1"
FT   gene            554810..556423
FT                   /locus_tag="Dtox_0542"
FT   CDS_pept        554810..556423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0542"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH0567 nickel transport system (nickel- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61462"
FT                   /db_xref="GOA:C8W607"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W607"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61462.1"
FT   sig_peptide     554810..554881
FT                   /locus_tag="Dtox_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.471 at
FT                   residue 24"
FT   gene            556497..557240
FT                   /locus_tag="Dtox_0543"
FT   CDS_pept        556497..557240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0543"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61463"
FT                   /db_xref="GOA:C8W608"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W608"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61463.1"
FT   gene            557666..559429
FT                   /locus_tag="Dtox_0544"
FT   CDS_pept        557666..559429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0544"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   sat:SYN_01564 phospholipid-lipopolysaccharide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61464"
FT                   /db_xref="GOA:C8W609"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W609"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61464.1"
FT                   NFDFGGGSQAK"
FT   sig_peptide     557666..557764
FT                   /locus_tag="Dtox_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.935 at
FT                   residue 33"
FT   gene            559426..561234
FT                   /locus_tag="Dtox_0545"
FT   CDS_pept        559426..561234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0545"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   aba:Acid345_2371 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61465"
FT                   /db_xref="GOA:C8W610"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W610"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61465.1"
FT   gene            complement(561398..563647)
FT                   /locus_tag="Dtox_0546"
FT   CDS_pept        complement(561398..563647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0546"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   prw:PsycPRwf_1367 putative outer membrane adhesin like
FT                   proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61466"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W611"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61466.1"
FT   sig_peptide     complement(563567..563647)
FT                   /locus_tag="Dtox_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(563699..564778)
FT                   /locus_tag="Dtox_0547"
FT   CDS_pept        complement(563699..564778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0547"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_3523 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61467"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8W612"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV61467.1"
FT   sig_peptide     complement(564689..564778)
FT                   /locus_tag="Dtox_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 30"
FT   gene            complement(564859..565086)
FT                   /locus_tag="Dtox_0548"
FT   CDS_pept        complement(564859..565086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61468"
FT                   /db_xref="UniProtKB/TrEMBL:C8W613"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61468.1"
FT   gene            complement(565410..566015)
FT                   /locus_tag="Dtox_0549"
FT   CDS_pept        complement(565410..566015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0549"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methionine
FT                   biosynthesis MetW protein; UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 12; KEGG: dvu:DVU0101 UbiE/COQ5
FT                   family methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61469"
FT                   /db_xref="GOA:C8W614"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W614"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61469.1"
FT   gene            566580..566939
FT                   /locus_tag="Dtox_0550"
FT   CDS_pept        566580..566939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0550"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: abo:ABO_1703
FT                   ArsR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61470"
FT                   /db_xref="GOA:C8W615"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W615"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACV61470.1"
FT                   FSSCQPGQGDSHQHK"
FT   gene            567240..567491
FT                   /locus_tag="Dtox_0551"
FT   CDS_pept        567240..567491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61471"
FT                   /db_xref="UniProtKB/TrEMBL:C8W616"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61471.1"
FT   gene            complement(567493..568227)
FT                   /locus_tag="Dtox_0552"
FT   CDS_pept        complement(567493..568227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0552"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ppd:Ppro_1264
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61472"
FT                   /db_xref="GOA:C8W617"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W617"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV61472.1"
FT   gene            complement(568227..569066)
FT                   /locus_tag="Dtox_0553"
FT   CDS_pept        complement(568227..569066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0553"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_1827 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61473"
FT                   /db_xref="GOA:C8W618"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W618"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61473.1"
FT   gene            complement(569059..569781)
FT                   /locus_tag="Dtox_0554"
FT   CDS_pept        complement(569059..569781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0554"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: sfu:Sfum_2135 precorrin-2 C20-
FT                   methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61474"
FT                   /db_xref="GOA:C8W619"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8W619"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ACV61474.1"
FT                   YLSTILARKHSAMDCNYD"
FT   gene            complement(569812..570765)
FT                   /locus_tag="Dtox_0555"
FT   CDS_pept        complement(569812..570765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0555"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: dps:DP0217
FT                   Fe(III) ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61475"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8W620"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV61475.1"
FT   sig_peptide     complement(570685..570765)
FT                   /locus_tag="Dtox_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.669 at
FT                   residue 27"
FT   gene            complement(570779..571573)
FT                   /locus_tag="Dtox_0556"
FT   CDS_pept        complement(570779..571573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0556"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_0442 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61476"
FT                   /db_xref="GOA:C8W621"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W621"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61476.1"
FT   gene            complement(571582..572649)
FT                   /locus_tag="Dtox_0557"
FT   CDS_pept        complement(571582..572649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0557"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   dps:DP0215 Fe(III) ABC-transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61477"
FT                   /db_xref="GOA:C8W622"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8W622"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV61477.1"
FT                   FFCYIFKIKTKKQMY"
FT   gene            complement(572752..573699)
FT                   /locus_tag="Dtox_0558"
FT   CDS_pept        complement(572752..573699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0558"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number=""
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG: plu:plu2989
FT                   cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61478"
FT                   /db_xref="GOA:C8W623"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W623"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61478.1"
FT   sig_peptide     complement(573622..573699)
FT                   /locus_tag="Dtox_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.464 at
FT                   residue 26"
FT   misc_binding    complement(573815..574078)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 105.30"
FT   misc_binding    complement(574165..574349)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 109.91"
FT   misc_binding    574534..574727
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 116.91"
FT   gene            574935..578441
FT                   /locus_tag="Dtox_0559"
FT   CDS_pept        574935..578441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0559"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61479"
FT                   /db_xref="GOA:C8W624"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W624"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61479.1"
FT                   EY"
FT   sig_peptide     574935..575045
FT                   /locus_tag="Dtox_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.878 at
FT                   residue 37"
FT   gene            578538..579269
FT                   /locus_tag="Dtox_0560"
FT   CDS_pept        578538..579269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA3366 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61480"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C8W625"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61480.1"
FT   sig_peptide     578538..578624
FT                   /locus_tag="Dtox_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.903 at
FT                   residue 29"
FT   gene            579309..580685
FT                   /locus_tag="Dtox_0561"
FT   CDS_pept        579309..580685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0561"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   bar:GBAA3367 cell wall anchor domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61481"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W626"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61481.1"
FT                   "
FT   sig_peptide     579309..579389
FT                   /locus_tag="Dtox_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.559 at
FT                   residue 27"
FT   gene            580711..581640
FT                   /locus_tag="Dtox_0562"
FT   CDS_pept        580711..581640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0562"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bar:GBAA3365
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61482"
FT                   /db_xref="GOA:C8W627"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W627"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV61482.1"
FT   gene            581613..583358
FT                   /locus_tag="Dtox_0563"
FT   CDS_pept        581613..583358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0563"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bar:GBAA3364 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61483"
FT                   /db_xref="GOA:C8W628"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W628"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61483.1"
FT                   LRHIQ"
FT   gene            583336..584070
FT                   /locus_tag="Dtox_0564"
FT   CDS_pept        583336..584070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61484"
FT                   /db_xref="GOA:C8W629"
FT                   /db_xref="InterPro:IPR017196"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:C8W629"
FT                   /inference="similar to AA sequence:KEGG:GBAA3363"
FT                   /protein_id="ACV61484.1"
FT   gene            584264..584701
FT                   /locus_tag="Dtox_0565"
FT   CDS_pept        584264..584701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0565"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61485"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:C8W630"
FT                   /inference="protein motif:PFAM:PF06803"
FT                   /protein_id="ACV61485.1"
FT   gene            585120..586160
FT                   /locus_tag="Dtox_0566"
FT   CDS_pept        585120..586160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0566"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number=""
FT                   /note="KEGG: dps:DP1325 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61486"
FT                   /db_xref="GOA:C8W631"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W631"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACV61486.1"
FT                   DPSLYP"
FT   gene            586308..587525
FT                   /locus_tag="Dtox_0567"
FT   CDS_pept        586308..587525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0567"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH2899 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61487"
FT                   /db_xref="GOA:C8W632"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C8W632"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ACV61487.1"
FT                   NGSYRS"
FT   gene            587554..588441
FT                   /locus_tag="Dtox_0568"
FT   CDS_pept        587554..588441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0568"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: gur:Gura_0225 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61488"
FT                   /db_xref="GOA:C8W633"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C8W633"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACV61488.1"
FT                   EVFTDQGVGTMVVS"
FT   gene            588602..589804
FT                   /locus_tag="Dtox_0569"
FT   CDS_pept        588602..589804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0569"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number=""
FT                   /note="KEGG: sat:SYN_02155 acetylornithine
FT                   aminotransferase; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61489"
FT                   /db_xref="GOA:C8W634"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W634"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACV61489.1"
FT                   V"
FT   gene            589832..590794
FT                   /locus_tag="Dtox_0570"
FT   CDS_pept        589832..590794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0570"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: bsu:BSU11250 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61490"
FT                   /db_xref="GOA:C8W635"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C8W635"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACV61490.1"
FT   gene            590853..592058
FT                   /locus_tag="Dtox_0571"
FT   CDS_pept        590853..592058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0571"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number=""
FT                   /note="KEGG: Os12g0235800; hypothetical protein ; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61491"
FT                   /db_xref="GOA:C8W636"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C8W636"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACV61491.1"
FT                   LR"
FT   gene            592107..593477
FT                   /locus_tag="Dtox_0572"
FT   CDS_pept        592107..593477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0572"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pca:Pcar_2418 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61492"
FT                   /db_xref="GOA:C8W637"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C8W637"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACV61492.1"
FT   gene            593656..594501
FT                   /locus_tag="Dtox_0573"
FT   CDS_pept        593656..594501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61493"
FT                   /db_xref="UniProtKB/TrEMBL:C8W638"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61493.1"
FT                   "
FT   gene            complement(594964..595554)
FT                   /locus_tag="Dtox_0574"
FT   CDS_pept        complement(594964..595554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0574"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   baa:BA_0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61494"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:C8W639"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ACV61494.1"
FT   gene            596063..596638
FT                   /locus_tag="Dtox_0575"
FT   CDS_pept        596063..596638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0575"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61495"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W640"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61495.1"
FT   gene            596666..597268
FT                   /locus_tag="Dtox_0576"
FT   CDS_pept        596666..597268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0576"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02890
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61496"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W641"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61496.1"
FT   gene            597298..597876
FT                   /locus_tag="Dtox_0577"
FT   CDS_pept        597298..597876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0577"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61497"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W642"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61497.1"
FT   gene            597971..598714
FT                   /locus_tag="Dtox_0578"
FT   CDS_pept        597971..598714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0578"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   baa:BA_0977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61498"
FT                   /db_xref="GOA:C8W643"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:C8W643"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACV61498.1"
FT   gene            598711..599889
FT                   /locus_tag="Dtox_0579"
FT   CDS_pept        598711..599889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_01791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61499"
FT                   /db_xref="GOA:C8W644"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W644"
FT                   /inference="similar to AA sequence:KEGG:ESA_01791"
FT                   /protein_id="ACV61499.1"
FT   gene            599882..601207
FT                   /locus_tag="Dtox_0580"
FT   CDS_pept        599882..601207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_O1R66 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61500"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:C8W645"
FT                   /inference="similar to AA sequence:KEGG:APECO1_O1R66"
FT                   /protein_id="ACV61500.1"
FT   gene            601207..602397
FT                   /locus_tag="Dtox_0581"
FT   CDS_pept        601207..602397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61501"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:C8W646"
FT                   /inference="similar to AA sequence:KEGG:Noc_1005"
FT                   /protein_id="ACV61501.1"
FT   gene            602394..603230
FT                   /locus_tag="Dtox_0582"
FT   CDS_pept        602394..603230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61502"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W647"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61502.1"
FT   gene            complement(603289..603516)
FT                   /locus_tag="Dtox_0583"
FT   CDS_pept        complement(603289..603516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61503"
FT                   /db_xref="GOA:C8W648"
FT                   /db_xref="UniProtKB/TrEMBL:C8W648"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61503.1"
FT   gene            complement(603553..604776)
FT                   /locus_tag="Dtox_0584"
FT   CDS_pept        complement(603553..604776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0584"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="TIGRFAM: germination protein, Ger(x)C family; PFAM:
FT                   spore germination B3 GerAC family protein; KEGG: bha:BH1935
FT                   spore germination protein KC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61504"
FT                   /db_xref="GOA:C8W649"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:C8W649"
FT                   /inference="protein motif:TFAM:TIGR02887"
FT                   /protein_id="ACV61504.1"
FT                   SDPLKPRL"
FT   gene            complement(604800..606458)
FT                   /locus_tag="Dtox_0585"
FT   CDS_pept        complement(604800..606458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0585"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bsu:BSU03700 germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61505"
FT                   /db_xref="GOA:C8W650"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C8W650"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACV61505.1"
FT   gene            complement(606575..606892)
FT                   /locus_tag="Dtox_0586"
FT   CDS_pept        complement(606575..606892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W651"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61506.1"
FT                   I"
FT   gene            complement(607140..607931)
FT                   /locus_tag="Dtox_0587"
FT   CDS_pept        complement(607140..607931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0587"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61507"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W652"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61507.1"
FT   gene            609064..609945
FT                   /locus_tag="Dtox_0588"
FT   CDS_pept        609064..609945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0588"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number=""
FT                   /note="KEGG: baa:BA_2352 aminotransferase class IV;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61508"
FT                   /db_xref="GOA:C8W653"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C8W653"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACV61508.1"
FT                   LTETDGPQIFPE"
FT   gene            610036..611700
FT                   /locus_tag="Dtox_0589"
FT   CDS_pept        610036..611700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0589"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number=""
FT                   /note="KEGG: sat:SYN_01708 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61509"
FT                   /db_xref="GOA:C8W654"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C8W654"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACV61509.1"
FT   gene            611741..613402
FT                   /locus_tag="Dtox_0590"
FT   CDS_pept        611741..613402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0590"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: dol:Dole_2037 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61510"
FT                   /db_xref="GOA:C8W655"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8W655"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACV61510.1"
FT   gene            613436..613936
FT                   /locus_tag="Dtox_0591"
FT   CDS_pept        613436..613936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0591"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3022
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61511"
FT                   /db_xref="GOA:C8W656"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C8W656"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACV61511.1"
FT                   NED"
FT   gene            613939..614031
FT                   /locus_tag="Dtox_0592"
FT   CDS_pept        613939..614031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61512"
FT                   /db_xref="UniProtKB/TrEMBL:C8W657"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61512.1"
FT                   /translation="MEVINPAIAVNGMIVKILLYGLKCCCLHVY"
FT   gene            614080..615075
FT                   /locus_tag="Dtox_0593"
FT   CDS_pept        614080..615075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0593"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number=""
FT                   /note="KEGG: dvl:Dvul_1690 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61513"
FT                   /db_xref="GOA:C8W658"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W658"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACV61513.1"
FT   gene            615176..616849
FT                   /locus_tag="Dtox_0594"
FT   CDS_pept        615176..616849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0594"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: sfu:Sfum_2981 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61514"
FT                   /db_xref="GOA:C8W659"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8W659"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACV61514.1"
FT   gene            616861..618459
FT                   /locus_tag="Dtox_0595"
FT   CDS_pept        616861..618459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0595"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: sat:SYN_00090 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61515"
FT                   /db_xref="GOA:C8W660"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:C8W660"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ACV61515.1"
FT                   DAVNKLVYEADRREE"
FT   gene            618467..619729
FT                   /locus_tag="Dtox_0596"
FT   CDS_pept        618467..619729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0596"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; homoaconitate hydratase family protein; 3-
FT                   isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: sat:SYN_00091 3-isopropylmalate
FT                   dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61516"
FT                   /db_xref="GOA:C8W661"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C8W661"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ACV61516.1"
FT   gene            619730..621301
FT                   /locus_tag="Dtox_0597"
FT   CDS_pept        619730..621301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0597"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; 3-
FT                   isopropylmalate dehydratase, small subunit; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; aconitate
FT                   hydratase domain protein; KEGG: dvm:DvMF_1794
FT                   3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61517"
FT                   /db_xref="GOA:C8W662"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C8W662"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACV61517.1"
FT                   EQILAG"
FT   gene            621590..623155
FT                   /locus_tag="Dtox_0598"
FT   CDS_pept        621590..623155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0598"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; KEGG:
FT                   gsu:GSU1798 alpha-isopropylmalate/homocitrate synthase
FT                   family transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61518"
FT                   /db_xref="GOA:C8W663"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:C8W663"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACV61518.1"
FT                   KQND"
FT   gene            623650..624948
FT                   /locus_tag="Dtox_0599"
FT   CDS_pept        623650..624948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0599"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number=""
FT                   /note="KEGG: dat:HRM2_03800 KamA1; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61519"
FT                   /db_xref="GOA:C8W664"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:C8W664"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACV61519.1"
FT   gene            625024..626307
FT                   /locus_tag="Dtox_0600"
FT   CDS_pept        625024..626307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0600"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number=""
FT                   /note="KEGG: dat:HRM2_03800 KamA1; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61520"
FT                   /db_xref="GOA:C8W665"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:C8W665"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACV61520.1"
FT   gene            626297..627187
FT                   /locus_tag="Dtox_0601"
FT   CDS_pept        626297..627187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0601"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dde:Dde_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61521"
FT                   /db_xref="GOA:C8W666"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W666"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV61521.1"
FT                   IGGGFEDMNVWSKVH"
FT   gene            complement(627267..627782)
FT                   /locus_tag="Dtox_0602"
FT   CDS_pept        complement(627267..627782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61522"
FT                   /db_xref="UniProtKB/TrEMBL:C8W667"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61522.1"
FT                   NTLGYLAK"
FT   sig_peptide     complement(627696..627782)
FT                   /locus_tag="Dtox_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 29"
FT   gene            complement(627769..628095)
FT                   /locus_tag="Dtox_0603"
FT   CDS_pept        complement(627769..628095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61523"
FT                   /db_xref="GOA:C8W668"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W668"
FT                   /inference="similar to AA sequence:KEGG:BH3170"
FT                   /protein_id="ACV61523.1"
FT                   GGKN"
FT   sig_peptide     complement(628006..628095)
FT                   /locus_tag="Dtox_0603"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.730 at
FT                   residue 30"
FT   gene            628486..629313
FT                   /locus_tag="Dtox_0604"
FT   CDS_pept        628486..629313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0604"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   bsu:BSU01750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61524"
FT                   /db_xref="GOA:C8W669"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:C8W669"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACV61524.1"
FT   gene            629443..630798
FT                   /locus_tag="Dtox_0605"
FT   CDS_pept        629443..630798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0605"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number=""
FT                   /note="KEGG: bha:BH0267 phosphoglucosamine mutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61525"
FT                   /db_xref="GOA:C8W670"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W670"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACV61525.1"
FT   gene            631095..632921
FT                   /locus_tag="Dtox_0606"
FT   CDS_pept        631095..632921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0606"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: aba:Acid345_0997
FT                   glutamine--fructose-6- phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61526"
FT                   /db_xref="GOA:C8W671"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C8W671"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACV61526.1"
FT   gene            complement(633042..633503)
FT                   /locus_tag="Dtox_0607"
FT   CDS_pept        complement(633042..633503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61527"
FT                   /db_xref="GOA:C8W672"
FT                   /db_xref="UniProtKB/TrEMBL:C8W672"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61527.1"
FT   gene            633626..635380
FT                   /locus_tag="Dtox_0608"
FT   CDS_pept        633626..635380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0608"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /EC_number=""
FT                   /note="PFAM: protein of unknown function UPF0047;
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: gsu:GSU2631
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61528"
FT                   /db_xref="GOA:C8W673"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C8W673"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61528.1"
FT                   VLVKIIGE"
FT   gene            635504..635692
FT                   /locus_tag="Dtox_0609"
FT   CDS_pept        635504..635692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0609"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   pna:Pnap_3733 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61529"
FT                   /db_xref="GOA:C8W674"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:C8W674"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ACV61529.1"
FT                   LAKTELAKAGQLIADKQ"
FT   gene            635987..637126
FT                   /locus_tag="Dtox_0610"
FT   CDS_pept        635987..637126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0610"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   gsu:GSU0494 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61530"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W1"
FT                   /inference="protein motif:PFAM:PF04015"
FT                   /protein_id="ACV61530.1"
FT   gene            637435..639486
FT                   /locus_tag="Dtox_0611"
FT   CDS_pept        637435..639486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0611"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; CheW
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; CheW domain protein; Hpt domain
FT                   protein; KEGG: pca:Pcar_1197 chemotaxis protein histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61531"
FT                   /db_xref="GOA:C8W0W2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61531.1"
FT   gene            639491..639991
FT                   /locus_tag="Dtox_0612"
FT   CDS_pept        639491..639991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0612"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: dal:Dalk_3928 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61532"
FT                   /db_xref="GOA:C8W0W3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACV61532.1"
FT                   LPV"
FT   gene            640033..642312
FT                   /locus_tag="Dtox_0613"
FT   CDS_pept        640033..642312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0613"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: gbm:Gbem_2944 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61533"
FT                   /db_xref="GOA:C8W0W4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACV61533.1"
FT                   REFDKY"
FT   gene            642411..643238
FT                   /locus_tag="Dtox_0614"
FT   CDS_pept        642411..643238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0614"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number=""
FT                   /note="KEGG: dal:Dalk_3925 MCP methyltransferase, CheR-
FT                   type; PFAM: MCP methyltransferase CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61534"
FT                   /db_xref="GOA:C8W0W5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W5"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61534.1"
FT   gene            643289..644332
FT                   /locus_tag="Dtox_0615"
FT   CDS_pept        643289..644332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0615"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number=""
FT                   /note="KEGG: pca:Pcar_1200 chemotactic response
FT                   regulator/methylesterase; PFAM: CheB methylesterase;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61535"
FT                   /db_xref="GOA:C8W0W6"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACV61535.1"
FT                   DNIQKYR"
FT   gene            644408..646708
FT                   /locus_tag="Dtox_0616"
FT   CDS_pept        644408..646708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0616"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: gsu:GSU2314 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; response
FT                   regulator receiver; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61536"
FT                   /db_xref="GOA:C8W0W7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61536.1"
FT                   SKIEMELDRLKLL"
FT   gene            646761..647156
FT                   /locus_tag="Dtox_0617"
FT   CDS_pept        646761..647156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0617"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dal:Dalk_2353 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61537"
FT                   /db_xref="GOA:C8W0W8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61537.1"
FT   gene            complement(647189..648580)
FT                   /locus_tag="Dtox_0618"
FT   CDS_pept        complement(647189..648580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0618"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61538"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W9"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV